Citrus Sinensis ID: 042077


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
SLSREPNIPLDLQFHNEKKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKNFNEKYLEIELL
cccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHc
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHc
slsrepnipldlqfhNEKKEEIEKLRGLVRDCVSKHLYSSAIFFADKIaaltndptgvYMQAQALFLgrhyrrpfhllnaskivprdlRFRYLAEQKNFNEKYLEIELL
slsrepnipldlqfhnekKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLlnaskivprdlRFRYLAeqknfnekyleiell
SLSREPNIPLDLQFHNEKKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKNFNEKYLEIELL
*********************IEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKNFNEKYLE****
*******************EEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKNFNEKYLEIELL
SLSREPNIPLDLQFHNEKKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKNFNEKYLEIELL
*****PNIPLDLQFHNEKKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKNFNEKYLEIELL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLSREPNIPLDLQFHNEKKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKNFNEKYLEIELL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
B3DNN5 543 Anaphase-promoting comple yes no 0.724 0.145 0.848 5e-35
Q13042 620 Cell division cycle prote yes no 0.743 0.130 0.365 6e-07
Q8R349 620 Cell division cycle prote yes no 0.743 0.130 0.378 8e-07
P09798 840 Anaphase-promoting comple yes no 0.660 0.085 0.291 0.0005
>sp|B3DNN5|CDC16_ARATH Anaphase-promoting complex subunit 6 OS=Arabidopsis thaliana GN=APC6 PE=2 SV=1 Back     alignment and function desciption
 Score =  146 bits (368), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 67/79 (84%), Positives = 75/79 (94%)

Query: 18 KKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHL 77
          ++EEIEK+RG+VRDCVSKHLYSSAIFFADK+AALTNDP+ +YMQAQALFLGRHYRR FHL
Sbjct: 2  REEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFHL 61

Query: 78 LNASKIVPRDLRFRYLAEQ 96
          LNASKIV RDLRFRYLA +
Sbjct: 62 LNASKIVLRDLRFRYLAAK 80




Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication.
Arabidopsis thaliana (taxid: 3702)
>sp|Q13042|CDC16_HUMAN Cell division cycle protein 16 homolog OS=Homo sapiens GN=CDC16 PE=1 SV=2 Back     alignment and function description
>sp|Q8R349|CDC16_MOUSE Cell division cycle protein 16 homolog OS=Mus musculus GN=Cdc16 PE=2 SV=1 Back     alignment and function description
>sp|P09798|CDC16_YEAST Anaphase-promoting complex subunit CDC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC16 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
3834317 521 Similar to CDC16 protein gb|U18291 (CDC1 0.724 0.151 0.848 2e-33
18412102 543 anaphase-promoting complex subunit 6 [Ar 0.724 0.145 0.848 2e-33
22324595 542 anaphase promoting complex/cyclosome sub 0.724 0.145 0.848 2e-33
297839749 543 cell division cycle family protein [Arab 0.724 0.145 0.848 3e-33
224116978 542 predicted protein [Populus trichocarpa] 0.706 0.142 0.844 3e-32
255565311 655 cell division cycle, putative [Ricinus c 0.724 0.120 0.822 3e-32
225461701 545 PREDICTED: anaphase-promoting complex su 0.770 0.154 0.752 5e-32
255578574 469 cell division cycle, putative [Ricinus c 0.724 0.168 0.810 1e-31
356517052 545 PREDICTED: anaphase-promoting complex su 0.724 0.144 0.810 2e-31
356545461 547 PREDICTED: anaphase-promoting complex su 0.724 0.144 0.810 1e-30
>gi|3834317|gb|AAC83033.1| Similar to CDC16 protein gb|U18291 (CDC16Hs) from Homo sapiens [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/79 (84%), Positives = 75/79 (94%)

Query: 18 KKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHL 77
          ++EEIEK+RG+VRDCVSKHLYSSAIFFADK+AALTNDP+ +YMQAQALFLGRHYRR FHL
Sbjct: 2  REEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFHL 61

Query: 78 LNASKIVPRDLRFRYLAEQ 96
          LNASKIV RDLRFRYLA +
Sbjct: 62 LNASKIVLRDLRFRYLAAK 80




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|18412102|ref|NP_565188.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] gi|302595634|sp|B3DNN5.1|CDC16_ARATH RecName: Full=Anaphase-promoting complex subunit 6; AltName: Full=Cell division cycle protein 16 homolog; Short=CDC16 homolog; AltName: Full=Cyclosome subunit 6; AltName: Full=Protein NOMEGA gi|190016006|gb|ACE62891.1| At1g78770 [Arabidopsis thaliana] gi|332198027|gb|AEE36148.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22324595|gb|AAM95623.1| anaphase promoting complex/cyclosome subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297839749|ref|XP_002887756.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] gi|297333597|gb|EFH64015.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224116978|ref|XP_002331799.1| predicted protein [Populus trichocarpa] gi|222874495|gb|EEF11626.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255565311|ref|XP_002523647.1| cell division cycle, putative [Ricinus communis] gi|223537099|gb|EEF38733.1| cell division cycle, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225461701|ref|XP_002283201.1| PREDICTED: anaphase-promoting complex subunit 6 [Vitis vinifera] gi|302142883|emb|CBI20178.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255578574|ref|XP_002530149.1| cell division cycle, putative [Ricinus communis] gi|223530348|gb|EEF32241.1| cell division cycle, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356517052|ref|XP_003527204.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] Back     alignment and taxonomy information
>gi|356545461|ref|XP_003541161.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
TAIR|locus:2037523 543 APC6 "anaphase promoting compl 0.706 0.141 0.870 5.6e-32
UNIPROTKB|E1BPM5 620 CDC16 "Uncharacterized protein 0.743 0.130 0.390 2.3e-08
UNIPROTKB|F1P4A5 623 CDC16 "Uncharacterized protein 0.743 0.130 0.365 1e-07
UNIPROTKB|E2R5H6 620 CDC16 "Uncharacterized protein 0.743 0.130 0.365 1.3e-07
UNIPROTKB|Q13042 620 CDC16 "Cell division cycle pro 0.743 0.130 0.365 1.6e-07
ZFIN|ZDB-GENE-051113-132 616 cdc16 "cell division cycle 16 0.743 0.131 0.365 2.1e-07
MGI|MGI:1917207 620 Cdc16 "CDC16 cell division cyc 0.743 0.130 0.378 2.1e-07
RGD|1305076 620 Cdc16 "cell division cycle 16" 0.743 0.130 0.378 2.1e-07
UNIPROTKB|I3L944 620 CDC16 "Uncharacterized protein 0.596 0.104 0.393 1.1e-05
UNIPROTKB|G4N150 664 MGG_07440 "Anaphase-promoting 0.642 0.105 0.385 3.2e-05
TAIR|locus:2037523 APC6 "anaphase promoting complex 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 5.6e-32, P = 5.6e-32
 Identities = 67/77 (87%), Positives = 74/77 (96%)

Query:    18 KKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHL 77
             ++EEIEK+RG+VRDCVSKHLYSSAIFFADK+AALTNDP+ +YMQAQALFLGRHYRR FHL
Sbjct:     2 REEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFHL 61

Query:    78 LNASKIVPRDLRFRYLA 94
             LNASKIV RDLRFRYLA
Sbjct:    62 LNASKIVLRDLRFRYLA 78




GO:0005634 "nucleus" evidence=ISM
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0032875 "regulation of DNA endoreduplication" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000280 "nuclear division" evidence=RCA
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0006260 "DNA replication" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006270 "DNA replication initiation" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0007067 "mitosis" evidence=RCA
GO:0007129 "synapsis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0007276 "gamete generation" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
GO:0009555 "pollen development" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=RCA
GO:0010564 "regulation of cell cycle process" evidence=RCA
GO:0016444 "somatic cell DNA recombination" evidence=RCA
GO:0016458 "gene silencing" evidence=RCA
GO:0016568 "chromatin modification" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0051225 "spindle assembly" evidence=RCA
GO:0051302 "regulation of cell division" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
UNIPROTKB|E1BPM5 CDC16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4A5 CDC16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5H6 CDC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q13042 CDC16 "Cell division cycle protein 16 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-132 cdc16 "cell division cycle 16 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1917207 Cdc16 "CDC16 cell division cycle 16" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305076 Cdc16 "cell division cycle 16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L944 CDC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G4N150 MGG_07440 "Anaphase-promoting complex subunit cut9" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B3DNN5CDC16_ARATHNo assigned EC number0.84810.72470.1454yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
APC6
cell division cycle family protein; cell division cycle family protein; FUNCTIONS IN- binding; INVOLVED IN- cell cycle; LOCATED IN- cellular_component unknown; EXPRESSED IN- 19 plant structures; EXPRESSED DURING- 12 growth stages; CONTAINS InterPro DOMAIN/s- Tetratricopeptide TPR-1 (InterPro-IPR001440), Tetratricopeptide-like helical (InterPro-IPR011990), Tetratricopeptide region (InterPro-IPR013026); BEST Arabidopsis thaliana protein match is- SEC (secret agent); transferase, transferring glycosyl groups (TAIR-AT3G04240.1); Has 8496 Blast hits to 5575 proteins in 581 species- Archae - [...] (543 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
APC8
APC8 (ANAPHASE-PROMOTING COMPLEX SUBUNIT 8); binding; anaphase-promoting complex or cyclosome s [...] (579 aa)
   0.996
APC10
anaphase-promoting complex, subunit 10 family / APC10 family; anaphase-promoting complex, subun [...] (192 aa)
     0.996
APC2
APC2; ubiquitin protein ligase binding / ubiquitin-protein ligase; a highly conserved ubiquitin [...] (865 aa)
     0.992
HBT
HBT (HOBBIT); binding; Required for cell division and cell differentiation in meristems. Encode [...] (744 aa)
    0.990
FZR3
FZR3 (FIZZY-RELATED 3); signal transducer; FIZZY-RELATED 3 (FZR3); FUNCTIONS IN- signal transdu [...] (481 aa)
    0.984
AT2G39090
tetratricopeptide repeat (TPR)-containing protein; tetratricopeptide repeat (TPR)-containing pr [...] (558 aa)
     0.983
CCS52A2
CCS52A2; signal transducer; Encodes a putative activator of the anaphase-promoting complex/cycl [...] (475 aa)
     0.981
AT1G06590
unknown protein; unknown protein; INVOLVED IN- biological_process unknown; EXPRESSED IN- 20 pla [...] (916 aa)
     0.980
AT3G25980
mitotic spindle checkpoint protein, putative (MAD2); mitotic spindle checkpoint protein, putati [...] (209 aa)
    0.974
CDC27a
CDC27a; binding; Subunit in the anaphase-promoting complex. Role in gametogenesis, control of m [...] (717 aa)
    0.960

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
pfam1289580 pfam12895, Apc3, Anaphase-promoting complex, cyclo 1e-08
>gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 Back     alignment and domain information
 Score = 47.6 bits (114), Expect = 1e-08
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 35 KHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLA 94
          +  Y +AIF A+K+ ALT      Y+ AQ  FL   Y+R + LL   K+       RYL 
Sbjct: 2  QGNYENAIFLAEKLLALTPSNEDAYLLAQCYFLQGQYKRAYELLRKLKLDNS-SGCRYLL 60


Apc3, otherwise known as Cdc27, is one of the subunits of the anaphase-promoting complex or cyclosome. The anaphase-promoting complex is a multiprotein subunit E3 ubiquitin ligase complex that controls segregation of chromosomes and exit from mitosis in eukaryotes. The protein members of this family contain TPR repeats just as those of Apc7 do, and it appears that these TPR units bind the C-termini of the APC co-activators CDH1 and CDC20. Length = 80

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.86
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.43
PF04049142 APC8: Anaphase promoting complex subunit 8 / Cdc23 98.07
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.68
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.51
PF1337173 TPR_9: Tetratricopeptide repeat 97.11
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.09
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.7
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.35
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.09
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.02
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.01
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 95.99
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.51
TIGR02521 234 type_IV_pilW type IV pilus biogenesis/stability pr 95.27
PRK15359144 type III secretion system chaperone protein SscB; 95.22
KOG1126638 consensus DNA-binding cell division cycle control 95.12
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 94.84
PRK15359144 type III secretion system chaperone protein SscB; 94.77
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.75
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.65
PRK10370198 formate-dependent nitrite reductase complex subuni 94.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 93.65
PRK10803263 tol-pal system protein YbgF; Provisional 93.62
PRK12370 553 invasion protein regulator; Provisional 93.54
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 93.53
PF1342844 TPR_14: Tetratricopeptide repeat 93.4
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.3
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 93.28
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 93.18
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 92.88
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.47
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 92.29
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 92.14
CHL00033168 ycf3 photosystem I assembly protein Ycf3 92.01
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.69
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 91.42
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 91.38
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.28
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 91.04
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 91.02
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 90.69
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 90.51
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 90.45
PF1343134 TPR_17: Tetratricopeptide repeat 90.07
PRK15331165 chaperone protein SicA; Provisional 90.0
PRK12370 553 invasion protein regulator; Provisional 89.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 89.32
PRK11788389 tetratricopeptide repeat protein; Provisional 89.21
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 89.18
PRK11788 389 tetratricopeptide repeat protein; Provisional 88.49
PF1337173 TPR_9: Tetratricopeptide repeat 88.29
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 86.57
PF13512142 TPR_18: Tetratricopeptide repeat 86.41
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 86.26
PRK11189 296 lipoprotein NlpI; Provisional 86.03
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 85.97
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 85.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 85.25
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 85.13
KOG2003 840 consensus TPR repeat-containing protein [General f 84.72
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 84.46
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 84.36
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 84.32
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 83.86
PRK11189 296 lipoprotein NlpI; Provisional 83.74
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 83.32
PRK10370198 formate-dependent nitrite reductase complex subuni 83.31
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.25
PRK10803263 tol-pal system protein YbgF; Provisional 83.2
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 83.17
COG1729262 Uncharacterized protein conserved in bacteria [Fun 82.27
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 81.68
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.86  E-value=5.4e-22  Score=169.08  Aligned_cols=86  Identities=45%  Similarity=0.787  Sum_probs=78.9

Q ss_pred             HHHHHHHHHHHHHhCCchhHHHHHHHHHhhcCCchhHHHHHHHHhhcCChHHHHHHHhcCCCCCCChhhHHHHhhcc---
Q 042077           22 IEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKN---   98 (109)
Q Consensus        22 ~~~LR~~v~~~L~~h~Y~tAiF~ADKl~als~~~~dv~lLAq~~y~~gqy~RA~~LL~~~~L~~~~~~crYLaA~c~---   98 (109)
                      +++.|.++++++++|+|+||+|||||+..++++|.|+||+|||||.+|||+||.++|+.+++...++.||||+|+|+   
T Consensus        16 ~~~~~~~~r~~l~q~~y~~a~f~adkV~~l~~dp~d~~~~aq~l~~~~~y~ra~~lit~~~le~~d~~cryL~~~~l~~l   95 (611)
T KOG1173|consen   16 LEKYRRLVRDALMQHRYKTALFWADKVAGLTNDPADIYWLAQVLYLGRQYERAAHLITTYKLEKRDIACRYLAAKCLVKL   95 (611)
T ss_pred             HHHHHHHHHHHHHHHhhhHHHHHHHHHHhccCChHHHHHHHHHHHhhhHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHH
Confidence            55566666699999999999999999999999999999999999999999999999999999999999999999998   


Q ss_pred             --hhHHHhhhh
Q 042077           99 --FNEKYLEIE  107 (109)
Q Consensus        99 --~~~al~~~~  107 (109)
                        |++++++|.
T Consensus        96 k~~~~al~vl~  106 (611)
T KOG1173|consen   96 KEWDQALLVLG  106 (611)
T ss_pred             HHHHHHHHHhc
Confidence              567777764



>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04049 APC8: Anaphase promoting complex subunit 8 / Cdc23 ; InterPro: IPR007192 The anaphase-promoting complex is composed of eight protein subunits, including BimE (APC1), CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8) Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-17
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
 Score = 73.7 bits (181), Expect = 5e-17
 Identities = 20/75 (26%), Positives = 29/75 (38%)

Query: 22  IEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNAS 81
            + LR    D + +  Y  A F  +K+  +T +P   +  AQ       Y R   LL   
Sbjct: 84  EDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKE 143

Query: 82  KIVPRDLRFRYLAEQ 96
            +  R    RYLA  
Sbjct: 144 DLYNRSSACRYLAAF 158


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 99.23
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 97.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.48
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.47
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.39
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.33
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.3
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.3
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.28
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.26
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.22
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.19
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.18
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.16
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.93
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.88
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.87
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.86
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.73
3k9i_A117 BH0479 protein; putative protein binding protein, 96.7
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.7
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.66
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.66
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.64
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.55
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.54
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.54
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.53
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.52
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.52
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.5
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 96.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.49
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.49
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 96.44
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 96.39
3k9i_A117 BH0479 protein; putative protein binding protein, 96.39
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.39
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.32
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.31
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.28
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.26
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.23
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.19
3kae_A 242 CDC27, possible protein of nuclear scaffold; tetra 96.18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.12
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.12
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.08
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 96.05
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.0
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.99
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.96
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.96
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.92
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.89
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.85
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.84
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.79
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.78
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.77
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.75
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.75
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.69
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.68
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 95.67
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.64
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 95.64
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 95.61
3mkr_A 291 Coatomer subunit epsilon; tetratricopeptide repeat 95.61
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 95.6
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 95.58
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.54
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.53
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.52
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 95.48
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.48
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 95.43
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.39
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 95.36
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.34
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.32
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.29
3u4t_A 272 TPR repeat-containing protein; structural genomics 95.29
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.27
3u4t_A 272 TPR repeat-containing protein; structural genomics 95.24
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.22
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.2
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.08
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 94.99
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 94.96
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.86
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 94.75
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 94.61
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.56
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.53
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 94.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.44
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.39
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.39
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.26
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 94.2
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 94.16
4i17_A228 Hypothetical protein; TPR repeats protein, structu 94.13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.02
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.94
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 93.72
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 93.65
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 93.19
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 93.13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 93.04
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 92.99
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 92.98
3mkr_A 291 Coatomer subunit epsilon; tetratricopeptide repeat 92.94
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 92.91
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 92.35
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 92.21
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 92.1
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 92.07
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 92.02
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.98
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.95
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 91.67
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.48
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 91.42
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 91.26
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 91.05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 90.97
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 90.77
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 89.94
3u3w_A293 Transcriptional activator PLCR protein; ternary co 88.99
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 88.98
3u3w_A 293 Transcriptional activator PLCR protein; ternary co 88.39
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 88.38
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 88.38
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 88.25
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 88.23
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 88.22
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 87.99
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 87.9
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 87.88
3rjv_A 212 Putative SEL1 repeat protein; alpha-alpha superhel 87.55
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 87.52
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 86.75
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 86.61
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 85.66
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 85.45
2l6j_A111 TPR repeat-containing protein associated with HSP; 85.33
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 85.26
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 85.1
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 84.74
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 84.53
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 83.95
1klx_A138 Cysteine rich protein B; structural genomics, heli 83.81
3qww_A433 SET and MYND domain-containing protein 2; methyltr 83.76
3q15_A378 PSP28, response regulator aspartate phosphatase H; 83.7
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 83.23
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 82.3
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 82.17
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 81.56
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.23  E-value=8.7e-12  Score=92.09  Aligned_cols=83  Identities=17%  Similarity=0.253  Sum_probs=67.9

Q ss_pred             HHHHHHHHHHhCCchhHHHHHHHHHhhcCCch----------hHHHHHHHHhhcCChHHHHHHHhc----CCCCCCCh--
Q 042077           25 LRGLVRDCVSKHLYSSAIFFADKIAALTNDPT----------GVYMQAQALFLGRHYRRPFHLLNA----SKIVPRDL--   88 (109)
Q Consensus        25 LR~~v~~~L~~h~Y~tAiF~ADKl~als~~~~----------dv~lLAq~~y~~gqy~RA~~LL~~----~~L~~~~~--   88 (109)
                      |+.+|++.+++++|++|++.|++++++++++.          -.+++|+++|..|+|.||....++    .+.+.+..  
T Consensus        23 l~dqik~L~d~~LY~sA~~La~lLlSl~~~~~~~~sp~~~~~~l~~ladalf~~~eyrrA~~~y~qALq~~k~l~k~~s~  102 (167)
T 3ffl_A           23 VIDHVRDMAAAGLHSNVRLLSSLLLTLSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKV  102 (167)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSTTSSCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHCC------
T ss_pred             HHHHHHHHHHhhhHHHHHHHHHHHHHhhcCCcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHhcCCCc
Confidence            78899999999999999999999999997444          459999999999999999998876    33222221  


Q ss_pred             --------------------hhHHHHhhcc-----hhHHHhhhh
Q 042077           89 --------------------RFRYLAEQKN-----FNEKYLEIE  107 (109)
Q Consensus        89 --------------------~crYLaA~c~-----~~~al~~~~  107 (109)
                                          -+||..|.|+     +++|+.+.|
T Consensus       103 ~~~~~~~ss~p~s~~~~~e~Elkykia~C~~~l~~~~~Ai~~Le  146 (167)
T 3ffl_A          103 RPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAILD  146 (167)
T ss_dssp             --------------CCCCHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             cccccccCCCcccccccchHHHHHHHHHHHHHHCCHHHHHHHHh
Confidence                                5999999997     678888765



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.49
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.46
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 97.41
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.25
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.97
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.42
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.39
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.3
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.18
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.88
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.88
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.76
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.67
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.65
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.57
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.4
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.35
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.1
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.05
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 94.99
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.92
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.65
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 94.52
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.29
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 93.99
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 92.33
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 91.32
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 90.48
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 90.39
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 89.6
d1e52a_56 C-terminal UvrC-binding domain of UvrB {Escherichi 88.39
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 88.06
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 86.48
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 82.89
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.49  E-value=0.00025  Score=44.97  Aligned_cols=85  Identities=11%  Similarity=0.000  Sum_probs=68.0

Q ss_pred             HHHHHHHHHHHHHhCCchhHHHHHHHHHhhcC-CchhHHHHHHHHhhcCChHHHHHHHhcC-CCCCCChhhHHHHhhcc-
Q 042077           22 IEKLRGLVRDCVSKHLYSSAIFFADKIAALTN-DPTGVYMQAQALFLGRHYRRPFHLLNAS-KIVPRDLRFRYLAEQKN-   98 (109)
Q Consensus        22 ~~~LR~~v~~~L~~h~Y~tAiF~ADKl~als~-~~~dv~lLAq~~y~~gqy~RA~~LL~~~-~L~~~~~~crYLaA~c~-   98 (109)
                      ++.|+..-..++..+.|+.|+-.-++++...+ ++.--+.+|.||+..|+|..|+....+. .+.+.++..-+-.|.|+ 
T Consensus         3 ~~~l~~~g~~~~~~g~~~eAi~~~~~al~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~g~~~~   82 (117)
T d1elwa_           3 VNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALE   82 (117)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCcchhhhhcccccccccccccccchhhhhHHHhccchhhHHHHHHHHHH
Confidence            56788888999999999999999999999998 6777888999999999999999987663 33456667767777765 


Q ss_pred             ----hhHHHhhh
Q 042077           99 ----FNEKYLEI  106 (109)
Q Consensus        99 ----~~~al~~~  106 (109)
                          |++|+...
T Consensus        83 ~~~~~~~A~~~~   94 (117)
T d1elwa_          83 FLNRFEEAKRTY   94 (117)
T ss_dssp             HTTCHHHHHHHH
T ss_pred             HccCHHHHHHHH
Confidence                55665443



>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure