Citrus Sinensis ID: 042077
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| 3834317 | 521 | Similar to CDC16 protein gb|U18291 (CDC1 | 0.724 | 0.151 | 0.848 | 2e-33 | |
| 18412102 | 543 | anaphase-promoting complex subunit 6 [Ar | 0.724 | 0.145 | 0.848 | 2e-33 | |
| 22324595 | 542 | anaphase promoting complex/cyclosome sub | 0.724 | 0.145 | 0.848 | 2e-33 | |
| 297839749 | 543 | cell division cycle family protein [Arab | 0.724 | 0.145 | 0.848 | 3e-33 | |
| 224116978 | 542 | predicted protein [Populus trichocarpa] | 0.706 | 0.142 | 0.844 | 3e-32 | |
| 255565311 | 655 | cell division cycle, putative [Ricinus c | 0.724 | 0.120 | 0.822 | 3e-32 | |
| 225461701 | 545 | PREDICTED: anaphase-promoting complex su | 0.770 | 0.154 | 0.752 | 5e-32 | |
| 255578574 | 469 | cell division cycle, putative [Ricinus c | 0.724 | 0.168 | 0.810 | 1e-31 | |
| 356517052 | 545 | PREDICTED: anaphase-promoting complex su | 0.724 | 0.144 | 0.810 | 2e-31 | |
| 356545461 | 547 | PREDICTED: anaphase-promoting complex su | 0.724 | 0.144 | 0.810 | 1e-30 |
| >gi|3834317|gb|AAC83033.1| Similar to CDC16 protein gb|U18291 (CDC16Hs) from Homo sapiens [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 146 bits (368), Expect = 2e-33, Method: Compositional matrix adjust.
Identities = 67/79 (84%), Positives = 75/79 (94%)
Query: 18 KKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHL 77
++EEIEK+RG+VRDCVSKHLYSSAIFFADK+AALTNDP+ +YMQAQALFLGRHYRR FHL
Sbjct: 2 REEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFHL 61
Query: 78 LNASKIVPRDLRFRYLAEQ 96
LNASKIV RDLRFRYLA +
Sbjct: 62 LNASKIVLRDLRFRYLAAK 80
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|18412102|ref|NP_565188.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] gi|302595634|sp|B3DNN5.1|CDC16_ARATH RecName: Full=Anaphase-promoting complex subunit 6; AltName: Full=Cell division cycle protein 16 homolog; Short=CDC16 homolog; AltName: Full=Cyclosome subunit 6; AltName: Full=Protein NOMEGA gi|190016006|gb|ACE62891.1| At1g78770 [Arabidopsis thaliana] gi|332198027|gb|AEE36148.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22324595|gb|AAM95623.1| anaphase promoting complex/cyclosome subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297839749|ref|XP_002887756.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] gi|297333597|gb|EFH64015.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224116978|ref|XP_002331799.1| predicted protein [Populus trichocarpa] gi|222874495|gb|EEF11626.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255565311|ref|XP_002523647.1| cell division cycle, putative [Ricinus communis] gi|223537099|gb|EEF38733.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225461701|ref|XP_002283201.1| PREDICTED: anaphase-promoting complex subunit 6 [Vitis vinifera] gi|302142883|emb|CBI20178.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255578574|ref|XP_002530149.1| cell division cycle, putative [Ricinus communis] gi|223530348|gb|EEF32241.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356517052|ref|XP_003527204.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356545461|ref|XP_003541161.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| TAIR|locus:2037523 | 543 | APC6 "anaphase promoting compl | 0.706 | 0.141 | 0.870 | 5.6e-32 | |
| UNIPROTKB|E1BPM5 | 620 | CDC16 "Uncharacterized protein | 0.743 | 0.130 | 0.390 | 2.3e-08 | |
| UNIPROTKB|F1P4A5 | 623 | CDC16 "Uncharacterized protein | 0.743 | 0.130 | 0.365 | 1e-07 | |
| UNIPROTKB|E2R5H6 | 620 | CDC16 "Uncharacterized protein | 0.743 | 0.130 | 0.365 | 1.3e-07 | |
| UNIPROTKB|Q13042 | 620 | CDC16 "Cell division cycle pro | 0.743 | 0.130 | 0.365 | 1.6e-07 | |
| ZFIN|ZDB-GENE-051113-132 | 616 | cdc16 "cell division cycle 16 | 0.743 | 0.131 | 0.365 | 2.1e-07 | |
| MGI|MGI:1917207 | 620 | Cdc16 "CDC16 cell division cyc | 0.743 | 0.130 | 0.378 | 2.1e-07 | |
| RGD|1305076 | 620 | Cdc16 "cell division cycle 16" | 0.743 | 0.130 | 0.378 | 2.1e-07 | |
| UNIPROTKB|I3L944 | 620 | CDC16 "Uncharacterized protein | 0.596 | 0.104 | 0.393 | 1.1e-05 | |
| UNIPROTKB|G4N150 | 664 | MGG_07440 "Anaphase-promoting | 0.642 | 0.105 | 0.385 | 3.2e-05 |
| TAIR|locus:2037523 APC6 "anaphase promoting complex 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 353 (129.3 bits), Expect = 5.6e-32, P = 5.6e-32
Identities = 67/77 (87%), Positives = 74/77 (96%)
Query: 18 KKEEIEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHL 77
++EEIEK+RG+VRDCVSKHLYSSAIFFADK+AALTNDP+ +YMQAQALFLGRHYRR FHL
Sbjct: 2 REEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFHL 61
Query: 78 LNASKIVPRDLRFRYLA 94
LNASKIV RDLRFRYLA
Sbjct: 62 LNASKIVLRDLRFRYLA 78
|
|
| UNIPROTKB|E1BPM5 CDC16 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4A5 CDC16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5H6 CDC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13042 CDC16 "Cell division cycle protein 16 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051113-132 cdc16 "cell division cycle 16 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917207 Cdc16 "CDC16 cell division cycle 16" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305076 Cdc16 "cell division cycle 16" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L944 CDC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N150 MGG_07440 "Anaphase-promoting complex subunit cut9" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| APC6 | cell division cycle family protein; cell division cycle family protein; FUNCTIONS IN- binding; INVOLVED IN- cell cycle; LOCATED IN- cellular_component unknown; EXPRESSED IN- 19 plant structures; EXPRESSED DURING- 12 growth stages; CONTAINS InterPro DOMAIN/s- Tetratricopeptide TPR-1 (InterPro-IPR001440), Tetratricopeptide-like helical (InterPro-IPR011990), Tetratricopeptide region (InterPro-IPR013026); BEST Arabidopsis thaliana protein match is- SEC (secret agent); transferase, transferring glycosyl groups (TAIR-AT3G04240.1); Has 8496 Blast hits to 5575 proteins in 581 species- Archae - [...] (543 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| APC8 | • | • | • | • | • | 0.996 | |||||
| APC10 | • | • | • | 0.996 | |||||||
| APC2 | • | • | • | 0.992 | |||||||
| HBT | • | • | • | • | 0.990 | ||||||
| FZR3 | • | • | • | • | 0.984 | ||||||
| AT2G39090 | • | • | • | 0.983 | |||||||
| CCS52A2 | • | • | • | 0.981 | |||||||
| AT1G06590 | • | • | • | 0.980 | |||||||
| AT3G25980 | • | • | • | • | 0.974 | ||||||
| CDC27a | • | • | • | • | 0.960 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| pfam12895 | 80 | pfam12895, Apc3, Anaphase-promoting complex, cyclo | 1e-08 |
| >gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 | Back alignment and domain information |
|---|
Score = 47.6 bits (114), Expect = 1e-08
Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
Query: 35 KHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLA 94
+ Y +AIF A+K+ ALT Y+ AQ FL Y+R + LL K+ RYL
Sbjct: 2 QGNYENAIFLAEKLLALTPSNEDAYLLAQCYFLQGQYKRAYELLRKLKLDNS-SGCRYLL 60
|
Apc3, otherwise known as Cdc27, is one of the subunits of the anaphase-promoting complex or cyclosome. The anaphase-promoting complex is a multiprotein subunit E3 ubiquitin ligase complex that controls segregation of chromosomes and exit from mitosis in eukaryotes. The protein members of this family contain TPR repeats just as those of Apc7 do, and it appears that these TPR units bind the C-termini of the APC co-activators CDH1 and CDC20. Length = 80 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.86 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.43 | |
| PF04049 | 142 | APC8: Anaphase promoting complex subunit 8 / Cdc23 | 98.07 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.68 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.51 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.11 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.09 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.7 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.35 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.09 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.02 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.01 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 95.99 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 95.51 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 95.27 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.22 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 95.12 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 94.84 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 94.77 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 94.75 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 94.65 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 94.4 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 93.65 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 93.62 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.54 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 93.53 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 93.4 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 93.3 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 93.28 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 93.18 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 92.88 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 92.47 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 92.29 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 92.14 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 92.01 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 91.69 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 91.42 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 91.38 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 91.28 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 91.04 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 91.02 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 90.69 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 90.51 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 90.45 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 90.07 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 90.0 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 89.91 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 89.32 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 89.21 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 89.18 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 88.49 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 88.29 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 86.57 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 86.41 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 86.26 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 86.03 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 85.97 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 85.84 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 85.25 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 85.13 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 84.72 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 84.46 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 84.36 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 84.32 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 83.86 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 83.74 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 83.32 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 83.31 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 83.25 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 83.2 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 83.17 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 82.27 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 81.68 |
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.86 E-value=5.4e-22 Score=169.08 Aligned_cols=86 Identities=45% Similarity=0.787 Sum_probs=78.9
Q ss_pred HHHHHHHHHHHHHhCCchhHHHHHHHHHhhcCCchhHHHHHHHHhhcCChHHHHHHHhcCCCCCCChhhHHHHhhcc---
Q 042077 22 IEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIVPRDLRFRYLAEQKN--- 98 (109)
Q Consensus 22 ~~~LR~~v~~~L~~h~Y~tAiF~ADKl~als~~~~dv~lLAq~~y~~gqy~RA~~LL~~~~L~~~~~~crYLaA~c~--- 98 (109)
+++.|.++++++++|+|+||+|||||+..++++|.|+||+|||||.+|||+||.++|+.+++...++.||||+|+|+
T Consensus 16 ~~~~~~~~r~~l~q~~y~~a~f~adkV~~l~~dp~d~~~~aq~l~~~~~y~ra~~lit~~~le~~d~~cryL~~~~l~~l 95 (611)
T KOG1173|consen 16 LEKYRRLVRDALMQHRYKTALFWADKVAGLTNDPADIYWLAQVLYLGRQYERAAHLITTYKLEKRDIACRYLAAKCLVKL 95 (611)
T ss_pred HHHHHHHHHHHHHHHhhhHHHHHHHHHHhccCChHHHHHHHHHHHhhhHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHH
Confidence 55566666699999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred --hhHHHhhhh
Q 042077 99 --FNEKYLEIE 107 (109)
Q Consensus 99 --~~~al~~~~ 107 (109)
|++++++|.
T Consensus 96 k~~~~al~vl~ 106 (611)
T KOG1173|consen 96 KEWDQALLVLG 106 (611)
T ss_pred HHHHHHHHHhc
Confidence 567777764
|
|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF04049 APC8: Anaphase promoting complex subunit 8 / Cdc23 ; InterPro: IPR007192 The anaphase-promoting complex is composed of eight protein subunits, including BimE (APC1), CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8) | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-17 |
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
Score = 73.7 bits (181), Expect = 5e-17
Identities = 20/75 (26%), Positives = 29/75 (38%)
Query: 22 IEKLRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNAS 81
+ LR D + + Y A F +K+ +T +P + AQ Y R LL
Sbjct: 84 EDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKE 143
Query: 82 KIVPRDLRFRYLAEQ 96
+ R RYLA
Sbjct: 144 DLYNRSSACRYLAAF 158
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 99.23 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.79 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.48 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.47 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.39 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.35 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.33 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.3 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.3 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.28 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.26 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.22 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.19 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.18 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.16 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.08 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 97.05 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 96.93 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.88 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 96.87 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 96.86 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.73 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.7 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.7 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 96.66 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.66 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 96.64 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.55 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.54 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.54 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 96.53 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.52 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.52 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.5 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 96.49 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.49 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 96.49 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.44 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 96.39 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.39 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.39 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.34 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 96.32 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.31 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.28 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 96.26 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.23 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.19 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 96.18 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 96.16 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.12 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.12 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.08 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.05 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.0 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 95.99 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 95.96 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.96 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 95.92 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.89 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 95.85 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.84 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.79 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.78 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 95.77 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 95.75 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.75 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 95.69 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.68 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.67 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 95.64 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.64 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.61 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 95.61 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 95.6 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 95.58 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 95.54 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 95.53 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.52 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 95.48 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.48 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 95.43 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.39 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 95.36 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.34 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.32 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 95.29 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 95.29 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.27 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 95.24 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 95.23 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.22 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.2 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 95.08 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 94.99 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 94.96 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.86 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 94.75 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 94.61 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 94.56 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.53 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 94.48 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 94.44 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 94.39 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 94.39 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.26 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 94.2 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 94.16 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 94.13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 94.02 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 93.94 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 93.88 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 93.72 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 93.65 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 93.19 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 93.13 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 93.04 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 92.99 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 92.98 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 92.94 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 92.91 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 92.35 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 92.21 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 92.1 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 92.07 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 92.02 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 91.98 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 91.95 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 91.67 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 91.48 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 91.42 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 91.26 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 91.05 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 90.97 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 90.77 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 89.94 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 88.99 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 88.98 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 88.39 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 88.38 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 88.38 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 88.25 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 88.23 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 88.22 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 87.99 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 87.9 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 87.88 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 87.55 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 87.52 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 86.75 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 86.61 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 85.66 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 85.45 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 85.33 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 85.26 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 85.1 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 84.74 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 84.53 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 83.95 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 83.81 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 83.76 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 83.7 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 83.23 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 82.3 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 82.17 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 81.56 |
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.23 E-value=8.7e-12 Score=92.09 Aligned_cols=83 Identities=17% Similarity=0.253 Sum_probs=67.9
Q ss_pred HHHHHHHHHHhCCchhHHHHHHHHHhhcCCch----------hHHHHHHHHhhcCChHHHHHHHhc----CCCCCCCh--
Q 042077 25 LRGLVRDCVSKHLYSSAIFFADKIAALTNDPT----------GVYMQAQALFLGRHYRRPFHLLNA----SKIVPRDL-- 88 (109)
Q Consensus 25 LR~~v~~~L~~h~Y~tAiF~ADKl~als~~~~----------dv~lLAq~~y~~gqy~RA~~LL~~----~~L~~~~~-- 88 (109)
|+.+|++.+++++|++|++.|++++++++++. -.+++|+++|..|+|.||....++ .+.+.+..
T Consensus 23 l~dqik~L~d~~LY~sA~~La~lLlSl~~~~~~~~sp~~~~~~l~~ladalf~~~eyrrA~~~y~qALq~~k~l~k~~s~ 102 (167)
T 3ffl_A 23 VIDHVRDMAAAGLHSNVRLLSSLLLTLSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKV 102 (167)
T ss_dssp HHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSTTSSCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHCC------
T ss_pred HHHHHHHHHHhhhHHHHHHHHHHHHHhhcCCcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHhcCCCc
Confidence 78899999999999999999999999997444 459999999999999999998876 33222221
Q ss_pred --------------------hhHHHHhhcc-----hhHHHhhhh
Q 042077 89 --------------------RFRYLAEQKN-----FNEKYLEIE 107 (109)
Q Consensus 89 --------------------~crYLaA~c~-----~~~al~~~~ 107 (109)
-+||..|.|+ +++|+.+.|
T Consensus 103 ~~~~~~~ss~p~s~~~~~e~Elkykia~C~~~l~~~~~Ai~~Le 146 (167)
T 3ffl_A 103 RPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAILD 146 (167)
T ss_dssp --------------CCCCHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred cccccccCCCcccccccchHHHHHHHHHHHHHHCCHHHHHHHHh
Confidence 5999999997 678888765
|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.49 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.46 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.41 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.25 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.97 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.42 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.39 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.3 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.18 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 95.88 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 95.88 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.76 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 95.67 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.65 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 95.57 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 95.4 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.35 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.1 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 95.05 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.99 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 94.92 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.65 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 94.52 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 94.29 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 94.14 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 93.99 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 92.33 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 91.32 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 90.48 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 90.39 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 89.6 | |
| d1e52a_ | 56 | C-terminal UvrC-binding domain of UvrB {Escherichi | 88.39 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 88.06 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 86.48 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 82.89 |
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Hop species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.49 E-value=0.00025 Score=44.97 Aligned_cols=85 Identities=11% Similarity=0.000 Sum_probs=68.0
Q ss_pred HHHHHHHHHHHHHhCCchhHHHHHHHHHhhcC-CchhHHHHHHHHhhcCChHHHHHHHhcC-CCCCCChhhHHHHhhcc-
Q 042077 22 IEKLRGLVRDCVSKHLYSSAIFFADKIAALTN-DPTGVYMQAQALFLGRHYRRPFHLLNAS-KIVPRDLRFRYLAEQKN- 98 (109)
Q Consensus 22 ~~~LR~~v~~~L~~h~Y~tAiF~ADKl~als~-~~~dv~lLAq~~y~~gqy~RA~~LL~~~-~L~~~~~~crYLaA~c~- 98 (109)
++.|+..-..++..+.|+.|+-.-++++...+ ++.--+.+|.||+..|+|..|+....+. .+.+.++..-+-.|.|+
T Consensus 3 ~~~l~~~g~~~~~~g~~~eAi~~~~~al~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~g~~~~ 82 (117)
T d1elwa_ 3 VNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALE 82 (117)
T ss_dssp HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCcchhhhhcccccccccccccccchhhhhHHHhccchhhHHHHHHHHHH
Confidence 56788888999999999999999999999998 6777888999999999999999987663 33456667767777765
Q ss_pred ----hhHHHhhh
Q 042077 99 ----FNEKYLEI 106 (109)
Q Consensus 99 ----~~~al~~~ 106 (109)
|++|+...
T Consensus 83 ~~~~~~~A~~~~ 94 (117)
T d1elwa_ 83 FLNRFEEAKRTY 94 (117)
T ss_dssp HTTCHHHHHHHH
T ss_pred HccCHHHHHHHH
Confidence 55665443
|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|