Citrus Sinensis ID: 042131

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MTPPLGFCSSPCPLPSPTIHCRRGRRFPVDRPLKDSRLWELDSGAIAARGISPPPLLDSARPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAPFVKVNV
cccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccHHHHHccccEEEEEcccccHHHHHHHHHccccccccHHHHHHHHcHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHcccEEEEEcccccccccEEEEccHHHHHHHHHHHccccccEEEEEccccEEEcc
ccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHcHEEcccccHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccEEcccHHHHHHHHHHccccEEEEEccccccccccEEEccHHHHHHHHHHHccccccEEEEEEEEEEEEcc
mtpplgfcsspcplpsptihcrrgrrfpvdrplkdsrlweldsgaiaargisppplldsarpevhnfeLPVAVVACGVLTVEIEHVDVAIMEKLEqqgvdcqpkastIRIIqdkyiqkvhfsphgiplpefmevndLESARRagkqfgyplmvkskslaydgrgnavAKSEEELSSAITALggfdrslyiekwapfvkvnv
mtpplgfcsspcplpsptihcrrgrrfpvdrplkdsrlwELDSGAIAARGISPPPLLDSARPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLeqqgvdcqpKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITAlggfdrslyiekwapfvkvnv
MTPPLGFCSSPCPLPSPTIHCRRGRRFPVDRPLKDSRLWELDSGAIAARGISPPPLLDSARPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAPFVKVNV
******************IHCRRG*RFPV***L*DSRLWELDSGAIAARGI*********RPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLE****AGKQFGYPLMVKSKSLAY***************SAITALGGFDRSLYIEKWAPFVK***
****LGFCSSPCPLPSPTIHCRRGRRFPVDRPLKDSRLWELDSGAIAARGISPPPLLDSARPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAPFVKVNV
MTPPLGFCSSPCPLPSPTIHCRRGRRFPVDRPLKDSRLWELDSGAIAARGISPPPLLDSARPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDG**********ELSSAITALGGFDRSLYIEKWAPFVKVNV
***PLGFCSSPCPLPSPTIHCRRGRRFPVDRPLKDSRLWELDSGAIAARGISPPPLLDSARPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAPFVKVNV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPPLGFCSSPCPLPSPTIHCRRGRRFPVDRPLKDSRLWELDSGAIAARGISPPPLLDSARPEVHNFELPVAVVACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAPFVKVNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
P55195 557 Phosphoribosylaminoimidaz N/A no 0.601 0.217 0.707 3e-44
P15567 552 Phosphoribosylaminoimidaz yes no 0.706 0.257 0.446 1e-27
P50504 557 Phosphoribosylaminoimidaz N/A no 0.601 0.217 0.492 1e-26
O74197 570 Phosphoribosylaminoimidaz yes no 0.601 0.212 0.460 7e-24
Q92210 568 Phosphoribosylaminoimidaz N/A no 0.592 0.209 0.472 1e-23
P0C017 582 Phosphoribosylaminoimidaz N/A no 0.766 0.264 0.4 3e-23
P21264 571 Phosphoribosylaminoimidaz yes no 0.601 0.211 0.456 3e-23
P0CQ37 582 Phosphoribosylaminoimidaz N/A no 0.606 0.209 0.461 4e-23
P0CQ36 582 Phosphoribosylaminoimidaz yes no 0.606 0.209 0.453 2e-22
Q01930 543 Phosphoribosylaminoimidaz N/A no 0.601 0.222 0.456 2e-22
>sp|P55195|PUR6_VIGAC Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment) OS=Vigna aconitifolia GN=PURKE PE=2 SV=1 Back     alignment and function desciption
 Score =  177 bits (450), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 87/123 (70%), Positives = 100/123 (81%), Gaps = 2/123 (1%)

Query: 76  CGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVN 135
           CGVLTVEIEHVDV  +EKLE+QGVDCQPKAST+RIIQDKY QKV   P  IPLPEFM+++
Sbjct: 66  CGVLTVEIEHVDVDTLEKLEKQGVDCQPKASTVRIIQDKYQQKVALLPAWIPLPEFMKID 125

Query: 136 DLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAP 195
           DL++ +       +  M+KS+ LAYDGRGN VAKSEEELSSA+ ALGGFDR LY EKWAP
Sbjct: 126 DLKAKKWDSLDIHF--MIKSRRLAYDGRGNFVAKSEEELSSAVDALGGFDRGLYAEKWAP 183

Query: 196 FVK 198
           FVK
Sbjct: 184 FVK 186

Vigna aconitifolia (taxid: 3918)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1
>sp|P15567|PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade6 PE=3 SV=1 Back     alignment and function description
>sp|P50504|PUR6_SCHOC Phosphoribosylaminoimidazole carboxylase OS=Schwanniomyces occidentalis GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|O74197|PUR6_CANGA Phosphoribosylaminoimidazole carboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|Q92210|PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE2 PE=3 SV=2 Back     alignment and function description
>sp|P0C017|PUR6_CRYNH Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=ADE2 PE=2 SV=1 Back     alignment and function description
>sp|P21264|PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE2 PE=1 SV=1 Back     alignment and function description
>sp|P0CQ37|PUR6_CRYNB Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ36|PUR6_CRYNJ Phosphoribosylaminoimidazole carboxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ADE2 PE=3 SV=1 Back     alignment and function description
>sp|Q01930|PUR6_OGAME Phosphoribosylaminoimidazole carboxylase OS=Ogataea methanolica GN=ADE1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
359487998 634 PREDICTED: phosphoribosylaminoimidazole 0.611 0.194 0.837 3e-56
296087911 591 unnamed protein product [Vitis vinifera] 0.611 0.208 0.837 3e-56
37983592 621 phosphoribosylaminoimidazole carboxylase 0.611 0.198 0.829 3e-56
13173434 623 phosphoribosylaminoimidazole carboxylase 0.611 0.197 0.829 4e-56
42569706 642 phosphoribosylaminoimidazole carboxylase 0.611 0.191 0.821 4e-56
3236251 645 putative phosphoribosylaminoimidazole ca 0.611 0.190 0.821 4e-56
147859592 604 hypothetical protein VITISV_024806 [Viti 0.611 0.203 0.837 6e-56
255561879 629 phosphoribosylaminoimidazole carboxylase 0.611 0.195 0.780 2e-54
17933427 634 aminoimidazole ribonucleotide carboxylas 0.611 0.194 0.813 2e-54
297823643 645 hypothetical protein ARALYDRAFT_321477 [ 0.611 0.190 0.796 2e-54
>gi|359487998|ref|XP_002263206.2| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 103/123 (83%), Positives = 114/123 (92%)

Query: 76  CGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVN 135
           CG+LTVEIEHVDVA +EKLEQQGVDCQPKASTIRIIQDKY+QKVHFS H IPLPEFM+++
Sbjct: 142 CGILTVEIEHVDVATLEKLEQQGVDCQPKASTIRIIQDKYLQKVHFSRHAIPLPEFMQID 201

Query: 136 DLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAP 195
           DLESA+RAG  FGYPLM+KSK LAYDGRGNAVAKSE ELSSA+TALGG++  LYIEKWAP
Sbjct: 202 DLESAKRAGDLFGYPLMIKSKRLAYDGRGNAVAKSEVELSSAVTALGGYEHGLYIEKWAP 261

Query: 196 FVK 198
           FVK
Sbjct: 262 FVK 264

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296087911|emb|CBI35194.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|42569706|ref|NP_181305.2| phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] gi|28973715|gb|AAO64174.1| putative phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] gi|30793959|gb|AAP40431.1| putative phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] gi|110737176|dbj|BAF00537.1| phosphoribosylaminoimidazole carboxylase like protein [Arabidopsis thaliana] gi|330254341|gb|AEC09435.1| phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3236251|gb|AAC23639.1| putative phosphoribosylaminoimidazole carboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147859592|emb|CAN83526.1| hypothetical protein VITISV_024806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561879|ref|XP_002521948.1| phosphoribosylaminoimidazole carboxylase atpase-subunit, putative [Ricinus communis] gi|223538752|gb|EEF40352.1| phosphoribosylaminoimidazole carboxylase atpase-subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|17933427|gb|AAL48287.1|AF452495_1 aminoimidazole ribonucleotide carboxylase [Vigna unguiculata] Back     alignment and taxonomy information
>gi|297823643|ref|XP_002879704.1| hypothetical protein ARALYDRAFT_321477 [Arabidopsis lyrata subsp. lyrata] gi|297325543|gb|EFH55963.1| hypothetical protein ARALYDRAFT_321477 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
TAIR|locus:2040771 642 AT2G37690 [Arabidopsis thalian 0.611 0.191 0.821 8e-53
POMBASE|SPCC1322.13 552 ade6 "phosphoribosylaminoimida 0.706 0.257 0.446 4.1e-27
CGD|CAL0003241 568 ADE2 [Candida albicans (taxid: 0.766 0.271 0.411 1.9e-23
UNIPROTKB|Q92210 568 ADE2 "Phosphoribosylaminoimida 0.766 0.271 0.411 1.9e-23
SGD|S000005654 571 ADE2 "Phosphoribosylaminoimida 0.721 0.253 0.410 2.5e-23
ASPGD|ASPL0000012782 564 AN3626 [Emericella nidulans (t 0.532 0.189 0.454 2.6e-20
TIGR_CMR|ECH_1034 361 ECH_1034 "phosphoribosylaminoi 0.577 0.321 0.286 7.3e-10
TIGR_CMR|SPO_0892 357 SPO_0892 "phosphoribosylaminoi 0.522 0.294 0.283 8.3e-08
TIGR_CMR|BA_0289 383 BA_0289 "phosphoribosylaminoim 0.582 0.305 0.270 5.3e-07
DICTYBASE|DDB_G0283987 997 purC/E "PAICS" [Dictyostelium 0.492 0.099 0.3 1.6e-06
TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 547 (197.6 bits), Expect = 8.0e-53, P = 8.0e-53
 Identities = 101/123 (82%), Positives = 114/123 (92%)

Query:    76 CGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVN 135
             CGVLTVEIEHVDV  +EKLE+QGVDCQPKASTIRIIQDKY+QKVHFS HGIPLPEFME++
Sbjct:   152 CGVLTVEIEHVDVDTLEKLEKQGVDCQPKASTIRIIQDKYMQKVHFSQHGIPLPEFMEIS 211

Query:   136 DLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWAP 195
             D+E AR+AG+ FGYPLM+KSK LAYDGRGNAVA +++ELSSA+TALGGF R LYIEKWAP
Sbjct:   212 DIEGARKAGELFGYPLMIKSKRLAYDGRGNAVANNQDELSSAVTALGGFSRGLYIEKWAP 271

Query:   196 FVK 198
             FVK
Sbjct:   272 FVK 274
GO:0004638 "phosphoribosylaminoimidazole carboxylase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA;ISS
GO:0016874 "ligase activity" evidence=IEA
GO:0034023 "5-(carboxyamino)imidazole ribonucleotide mutase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0009555 "pollen development" evidence=IMP
GO:0009570 "chloroplast stroma" evidence=IDA
POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000012782 AN3626 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_1034 ECH_1034 "phosphoribosylaminoimidazole carboxylase, ATPase subunit" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0892 SPO_0892 "phosphoribosylaminoimidazole carboxylase, ATPase subunit" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0289 BA_0289 "phosphoribosylaminoimidazole carboxylase, ATPase subunit" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283987 purC/E "PAICS" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT2G37690
phosphoribosylaminoimidazole carboxylase, putative / AIR carboxylase, putative; phosphoribosylaminoimidazole carboxylase, putative / AIR carboxylase, putative; FUNCTIONS IN- phosphoribosylaminoimidazole carboxylase activity, catalytic activity, ATP binding; INVOLVED IN- 'de novo' IMP biosynthetic process, pollen development; LOCATED IN- chloroplast; CONTAINS InterPro DOMAIN/s- Phosphoribosylaminoimidazole carboxylase (InterPro-IPR016301), PreATP-grasp-like fold (InterPro-IPR016185), ATP-grasp fold, ATP-dependent carboxylate-amine ligase-type (InterPro-IPR003135), 1-(5-Phosphoribosyl)-5 [...] (642 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
PUR5
PUR5; ATP binding / phosphoribosylformylglycinamidine cyclo-ligase; encoding phosphoribosylform [...] (389 aa)
• ••••• 0.998
PUR7
PUR7 (PURIN 7); phosphoribosylaminoimidazolesuccinocarboxamide synthase; 5'-phosphoribosyl-4-(N [...] (411 aa)
•  • •• 0.989
AT2G35040
AICARFT/IMPCHase bienzyme family protein; AICARFT/IMPCHase bienzyme family protein; FUNCTIONS I [...] (596 aa)
•  •  • 0.966
PUR2
phosphoribosylamine--glycine ligase (PUR2); glycinamide ribonucleotide synthetase (GAR syntheta [...] (532 aa)
••••••••0.946
AT2G05140
phosphoribosylaminoimidazole carboxylase family protein / AIR carboxylase family protein; phosp [...] (162 aa)
• •• •••0.910
AT1G63660
GMP synthase (glutamine-hydrolyzing), putative / glutamine amidotransferase, putative; GMP synt [...] (534 aa)
•  •  • 0.908
PUR4
PUR4 (purine biosynthesis 4); ATP binding / catalytic/ phosphoribosylformylglycinamidine syntha [...] (1407 aa)
   •••• 0.905
PYRD
PYRD (pyrimidine d); dihydroorotate dehydrogenase; dihydroorotate dehydrogenase, catalyses four [...] (460 aa)
   •  • 0.901
THIC
THIC (ThiaminC); ADP-ribose pyrophosphohydrolase/ catalytic/ iron-sulfur cluster binding; Encod [...] (644 aa)
     •• 0.883
AT4G30840
WD-40 repeat protein family; WD-40 repeat protein family; FUNCTIONS IN- molecular_function unkn [...] (361 aa)
   ••   0.845

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
PLN02948 577 PLN02948, PLN02948, phosphoribosylaminoimidazole c 5e-79
TIGR01161 352 TIGR01161, purK, phosphoribosylaminoimidazole carb 7e-34
COG0026 375 COG0026, PurK, Phosphoribosylaminoimidazole carbox 1e-28
PRK06019 372 PRK06019, PRK06019, phosphoribosylaminoimidazole c 6e-28
pfam02222171 pfam02222, ATP-grasp, ATP-grasp domain 9e-24
COG0439 449 COG0439, AccC, Biotin carboxylase [Lipid metabolis 3e-08
PRK08591 451 PRK08591, PRK08591, acetyl-CoA carboxylase biotin 3e-07
TIGR02144 280 TIGR02144, LysX_arch, Lysine biosynthesis enzyme L 4e-07
TIGR01205 315 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine l 6e-07
TIGR00514 449 TIGR00514, accC, acetyl-CoA carboxylase, biotin ca 2e-06
TIGR01142 380 TIGR01142, purT, phosphoribosylglycinamide formylt 9e-06
PRK08462 445 PRK08462, PRK08462, biotin carboxylase; Validated 1e-05
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 2e-05
TIGR00877 422 TIGR00877, purD, phosphoribosylamine--glycine liga 2e-05
PRK12833 467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin 2e-05
PRK06111 450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin 3e-05
COG0027 394 COG0027, PurT, Formate-dependent phosphoribosylgly 3e-05
PRK08654 499 PRK08654, PRK08654, pyruvate carboxylase subunit A 4e-05
PRK01372 304 PRK01372, ddl, D-alanine--D-alanine ligase; Review 4e-05
PRK05586 447 PRK05586, PRK05586, biotin carboxylase; Validated 6e-05
TIGR01369 1050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 7e-05
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy produc 9e-05
pfam01071 193 pfam01071, GARS_A, Phosphoribosylglycinamide synth 9e-05
pfam02786 211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha 1e-04
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 1e-04
PRK08463 478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit 1e-04
TIGR02068 864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 2e-04
PRK12767 326 PRK12767, PRK12767, carbamoyl phosphate synthase-l 2e-04
pfam07478 201 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-t 2e-04
TIGR01369 1050 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth 6e-04
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 7e-04
PRK07178 472 PRK07178, PRK07178, pyruvate carboxylase subunit A 7e-04
PRK09288 395 PRK09288, purT, phosphoribosylglycinamide formyltr 0.001
TIGR00768277 TIGR00768, rimK_fam, alpha-L-glutamate ligases, Ri 0.002
COG0189 318 COG0189, RimK, Glutathione synthase/Ribosomal prot 0.002
PRK00885 420 PRK00885, PRK00885, phosphoribosylamine--glycine l 0.002
COG0151 428 COG0151, PurD, Phosphoribosylamine-glycine ligase 0.002
PRK12815 1068 PRK12815, carB, carbamoyl phosphate synthase large 0.003
PRK14016 727 PRK14016, PRK14016, cyanophycin synthetase; Provis 0.003
PRK05294 1066 PRK05294, carB, carbamoyl phosphate synthase large 0.004
>gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase Back     alignment and domain information 
 Score =  246 bits (629), Expect = 5e-79
 Identities = 97/124 (78%), Positives = 109/124 (87%)

Query: 75  ACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEV 134
            C VLTVEIEHVDV  +E LE+QGVD QPK+STIRIIQDKY QKVHFS HGIPLPEFME+
Sbjct: 83  RCDVLTVEIEHVDVDTLEALEKQGVDVQPKSSTIRIIQDKYAQKVHFSKHGIPLPEFMEI 142

Query: 135 NDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWA 194
           +DLESA +AG  FGYPLM+KS+ LAYDGRGNAVAK+EE+LSSA+ ALGGF+R LY EKWA
Sbjct: 143 DDLESAEKAGDLFGYPLMLKSRRLAYDGRGNAVAKTEEDLSSAVAALGGFERGLYAEKWA 202

Query: 195 PFVK 198
           PFVK
Sbjct: 203 PFVK 206

Length = 577
>gnl|CDD|233295 TIGR01161, purK, phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>gnl|CDD|223105 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|235674 PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>gnl|CDD|216935 pfam02222, ATP-grasp, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX Back     alignment and domain information
>gnl|CDD|233310 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|130212 TIGR01142, purT, phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|233164 TIGR00877, purD, phosphoribosylamine--glycine ligase Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|223106 COG0027, PurT, Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|234948 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216282 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|233705 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|237195 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|203643 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus Back     alignment and domain information
>gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|236454 PRK09288, purT, phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>gnl|CDD|233121 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>gnl|CDD|223267 COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234856 PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>gnl|CDD|223229 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237586 PRK14016, PRK14016, cyanophycin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 99.97
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 99.97
PLN02948 577 phosphoribosylaminoimidazole carboxylase 99.97
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 99.96
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 99.96
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 99.95
COG0027 394 PurT Formate-dependent phosphoribosylglycinamide f 99.93
TIGR00514 449 accC acetyl-CoA carboxylase, biotin carboxylase su 99.93
PRK12833 467 acetyl-CoA carboxylase biotin carboxylase subunit; 99.93
PRK08462 445 biotin carboxylase; Validated 99.92
PRK08591 451 acetyl-CoA carboxylase biotin carboxylase subunit; 99.92
PRK07206 416 hypothetical protein; Provisional 99.91
PRK05586 447 biotin carboxylase; Validated 99.91
PRK08654 499 pyruvate carboxylase subunit A; Validated 99.91
PRK06111 450 acetyl-CoA carboxylase biotin carboxylase subunit; 99.91
PRK02186 887 argininosuccinate lyase; Provisional 99.9
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 99.9
TIGR00877 423 purD phosphoribosylamine--glycine ligase. This enz 99.9
PRK07178 472 pyruvate carboxylase subunit A; Validated 99.9
PRK00885 420 phosphoribosylamine--glycine ligase; Provisional 99.89
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 99.89
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 99.89
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 99.89
PRK12767 326 carbamoyl phosphate synthase-like protein; Provisi 99.89
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 99.88
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 99.88
PLN02257 434 phosphoribosylamine--glycine ligase 99.88
PRK01372 304 ddl D-alanine--D-alanine ligase; Reviewed 99.88
PRK13790 379 phosphoribosylamine--glycine ligase; Provisional 99.88
PRK14569 296 D-alanyl-alanine synthetase A; Provisional 99.87
PLN02735 1102 carbamoyl-phosphate synthase 99.87
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 99.87
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 99.87
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 99.87
PRK10446 300 ribosomal protein S6 modification protein; Provisi 99.86
PRK12999 1146 pyruvate carboxylase; Reviewed 99.86
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 99.86
PRK14572 347 D-alanyl-alanine synthetase A; Provisional 99.86
TIGR01205 315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 99.86
PRK05784 486 phosphoribosylamine--glycine ligase; Provisional 99.86
PLN02735 1102 carbamoyl-phosphate synthase 99.86
PRK01966 333 ddl D-alanyl-alanine synthetase A; Reviewed 99.85
PRK14568 343 vanB D-alanine--D-lactate ligase; Provisional 99.85
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 99.85
PRK14571 299 D-alanyl-alanine synthetase A; Provisional 99.84
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 99.84
PRK13278 358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 99.83
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 99.83
TIGR02144 280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 99.81
PRK06849 389 hypothetical protein; Provisional 99.81
COG0151 428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 99.79
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 99.79
KOG0238 670 consensus 3-Methylcrotonyl-CoA carboxylase, biotin 99.78
COG0458 400 CarB Carbamoylphosphate synthase large subunit (sp 99.78
PRK06524 493 biotin carboxylase-like protein; Validated 99.77
PRK14570 364 D-alanyl-alanine synthetase A; Provisional 99.76
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 99.76
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 99.76
COG0189 318 RimK Glutathione synthase/Ribosomal protein S6 mod 99.75
PF15632 329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 99.74
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 99.73
PRK02471 752 bifunctional glutamate--cysteine ligase/glutathion 99.7
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.7
PRK14016 727 cyanophycin synthetase; Provisional 99.69
TIGR01435 737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 99.66
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 99.66
PRK13277 366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 99.64
PF07478 203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 99.64
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 99.63
PF02786 211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 99.62
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 99.61
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 99.57
KOG0369 1176 consensus Pyruvate carboxylase [Energy production 99.57
PRK12458 338 glutathione synthetase; Provisional 99.57
TIGR01380 312 glut_syn glutathione synthetase, prokaryotic. This 99.56
PLN02941 328 inositol-tetrakisphosphate 1-kinase 99.55
PRK05246 316 glutathione synthetase; Provisional 99.5
KOG0237 788 consensus Glycinamide ribonucleotide synthetase (G 99.42
COG1181 317 DdlA D-alanine-D-alanine ligase and related ATP-gr 99.32
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 99.29
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.29
TIGR01016 386 sucCoAbeta succinyl-CoA synthetase, beta subunit. 99.28
COG3919 415 Predicted ATP-grasp enzyme [General function predi 99.23
PRK00696 388 sucC succinyl-CoA synthetase subunit beta; Provisi 99.23
COG1759 361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu 99.21
TIGR02291 317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 99.04
KOG0368 2196 consensus Acetyl-CoA carboxylase [Lipid transport 98.99
PF13549 222 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. 98.98
COG2232 389 Predicted ATP-dependent carboligase related to bio 98.93
COG0045 387 SucC Succinyl-CoA synthetase, beta subunit [Energy 98.76
PF14397 285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 98.7
COG1821 307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 98.66
PF08442202 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 98.66
PRK14046 392 malate--CoA ligase subunit beta; Provisional 98.63
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 98.5
PF14403445 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 98.48
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 98.47
PLN00124 422 succinyl-CoA ligase [GDP-forming] subunit beta; Pr 98.46
PF05770 307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 98.39
PLN02235 423 ATP citrate (pro-S)-lyase 98.24
PF14398 262 ATPgrasp_YheCD: YheC/D like ATP-grasp 98.18
PF06849124 DUF1246: Protein of unknown function (DUF1246); In 97.04
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 96.81
PF14305 239 ATPgrasp_TupA: TupA-like ATPgrasp 96.28
PF03133 292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 96.11
KOG2799 434 consensus Succinyl-CoA synthetase, beta subunit [E 96.1
PF11379 355 DUF3182: Protein of unknown function (DUF3182); In 96.08
PF02750 203 Synapsin_C: Synapsin, ATP binding domain; InterPro 95.2
KOG3895 488 consensus Synaptic vesicle protein Synapsin [Signa 94.13
COG2308488 Uncharacterized conserved protein [Function unknow 93.99
KOG1057 1018 consensus Arp2/3 complex-interacting protein VIP1/ 93.22
PF04174330 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; In 92.99
PF1028138 Ish1: Putative stress-responsive nuclear envelope 90.11
TIGR02049403 gshA_ferroox glutamate--cysteine ligase, T. ferroo 89.34
KOG1447 412 consensus GTP-specific succinyl-CoA synthetase, be 85.75
KOG2156 662 consensus Tubulin-tyrosine ligase-related protein 80.2
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information 
Probab=99.97  E-value=2.7e-31  Score=222.75  Aligned_cols=175  Identities=27%  Similarity=0.421  Sum_probs=158.0

Q ss_pred             chhhhhc----ccccccccccCCCeEEEECC-CCCcccccCCCCCCCCCCccccCCCCHhhhh----cCCeEEeccccCC
Q 042131           17 PTIHCRR----GRRFPVDRPLKDSRLWELDS-GAIAARGISPPPLLDSARPEVHNFELPVAVV----ACGVLTVEIEHVD   87 (201)
Q Consensus        17 ~~i~~~~----g~~l~~aa~~~G~~v~~~~~-~~~~~~~~~~~~~~~a~~~~~~~~~d~~~l~----~~d~i~~~~~~i~   87 (201)
                      ++|++++    |+|++.+|+++||+|+++|+ +++|+.++       ++..+..++.|.+.+.    .+|++++++++++
T Consensus         3 ~~igilG~Gql~~ml~~aa~~lG~~v~~~d~~~~~pa~~~-------ad~~~~~~~~D~~~l~~~a~~~dvit~e~e~i~   75 (372)
T PRK06019          3 KTIGIIGGGQLGRMLALAAAPLGYKVIVLDPDPDSPAAQV-------ADEVIVADYDDVAALRELAEQCDVITYEFENVP   75 (372)
T ss_pred             CEEEEECCCHHHHHHHHHHHHcCCEEEEEeCCCCCchhHh-------CceEEecCCCCHHHHHHHHhcCCEEEeCcCCCC
Confidence            4566664    47999999999999999999 88888888       8888888899988776    8999999999999


Q ss_pred             HHHHHHHHHCCCcccccHHHHHHHhCHHHHHHHHhhCCCCCCCccccCCHHHHHHHHHHhCCCEEEeecCCCCCCCCeEE
Q 042131           88 VAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAV  167 (201)
Q Consensus        88 ~~~~~~l~~~g~~~~~~~~~~~~~~dK~~~~~~l~~~gip~p~~~~~~~~~~~~~~~~~~~~P~VvKp~~g~~~g~gv~~  167 (201)
                      ...++.+++. ..++|+++++++++||..+|++|+++|||+|++..+++.+++.++.+++|||+|+||..|||+|+|+++
T Consensus        76 ~~~l~~l~~~-~~~~p~~~~~~~~~dK~~~k~~l~~~Gip~p~~~~v~s~~~l~~~~~~~g~P~vlKp~~~g~~g~Gv~~  154 (372)
T PRK06019         76 AEALDALAAR-VPVPPGPDALAIAQDRLTEKQFLDKLGIPVAPFAVVDSAEDLEAALADLGLPAVLKTRRGGYDGKGQWV  154 (372)
T ss_pred             HHHHHHHhcC-CeeCcCHHHHHHhcCHHHHHHHHHHCCCCCCCceEeCCHHHHHHHHHHcCCcEEEEeCCCCcCCCCeEE
Confidence            9888888877 557899999999999999999999999999999999999999998999999999999998789999999


Q ss_pred             cCCHHHHHHHHHHhcCCCCceEEeecCC-CceeeC
Q 042131          168 AKSEEELSSAITALGGFDRSLYIEKWAP-FVKVNV  201 (201)
Q Consensus       168 ~~~~~el~~~~~~~~~~~~~~lvEe~i~-G~e~sv  201 (201)
                      +++.+|+..++..+...  .+++|+||+ +.||||
T Consensus       155 v~~~~el~~a~~~~~~~--~~ivEe~I~~~~E~sv  187 (372)
T PRK06019        155 IRSAEDLEAAWALLGSV--PCILEEFVPFEREVSV  187 (372)
T ss_pred             ECCHHHHHHHHHhcCCC--CEEEEecCCCCeEEEE
Confidence            99999999999987544  499999999 589885

>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>KOG0237 consensus Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>PRK14046 malate--CoA ligase subunit beta; Provisional Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information
>PLN02235 ATP citrate (pro-S)-lyase Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>PF06849 DUF1246: Protein of unknown function (DUF1246); InterPro: IPR010672 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PF14305 ATPgrasp_TupA: TupA-like ATPgrasp Back     alignment and domain information
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>KOG2799 consensus Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PF11379 DUF3182: Protein of unknown function (DUF3182); InterPro: IPR021519 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>KOG3895 consensus Synaptic vesicle protein Synapsin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2308 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] Back     alignment and domain information
>PF04174 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; InterPro: IPR007302 This is a domain of unknown function Back     alignment and domain information
>PF10281 Ish1: Putative stress-responsive nuclear envelope protein; InterPro: IPR018803 This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues [] Back     alignment and domain information
>TIGR02049 gshA_ferroox glutamate--cysteine ligase, T Back     alignment and domain information
>KOG1447 consensus GTP-specific succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG2156 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
3k5i_A 403 Crystal Structure Of N5-Carboxyaminoimidazole Synth 1e-23
3k5h_A 403 Crystal Structure Of Carboxyaminoimidazole Ribonucl 1e-23
3ax6_A 380 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 5e-19
3aw8_A 369 Crystal Structure Of N5-Carboxyaminoimidazole Ribon 1e-13
2z04_B 365 Crystal Structure Of Phosphoribosylaminoimidazole C 5e-09
3v4s_A 387 Crystal Structure Of Adp-atp Complex Of Purk: N5-ca 2e-07
4dlk_A 380 Crystal Structure Of Atp-ca++ Complex Of Purk: N5- 2e-07
3q2o_A 389 Crystal Structure Of Purk: N5-Carboxyaminoimidazole 2e-07
3orq_A 377 Crystal Structure Of N5-Carboxyaminoimidazole Synth 8e-06
3mjf_A 431 Phosphoribosylamine-Glycine Ligase From Yersinia Pe 4e-04
>pdb|3K5I|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Synthase From Aspergillus Clavatus In Complex With Adp And 5- Aminoimadazole Ribonucleotide Length = 403 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 77/123 (62%), Gaps = 5/123 (4%)
Query: 76  CGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEV- 134
           C V+T EIEHVD   +E++  + V  +P    IR IQ+K+ QK H   +GIP+ E  E+ 
Sbjct: 87  CDVVTAEIEHVDTYALEEVASE-VKIEPSWQAIRTIQNKFNQKEHLRKYGIPMAEHRELV 145
Query: 135 -NDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKW 193
            N      + G+Q GYPLM+KSK++AYDGRGN    S++++  A+ AL   DR LY EKW
Sbjct: 146 ENTPAELAKVGEQLGYPLMLKSKTMAYDGRGNFRVNSQDDIPEALEALK--DRPLYAEKW 203
Query: 194 APF 196
           A F
Sbjct: 204 AYF 206
>pdb|3K5H|A Chain A, Crystal Structure Of Carboxyaminoimidazole Ribonucleotide Synthase From Asperigillus Clavatus Complexed With Atp Length = 403 Back     alignment and structure
>pdb|3AX6|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Synthetase From Thermotoga Maritima Length = 380 Back     alignment and structure
>pdb|3AW8|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Synthetase From Thermus Thermophilus Hb8 Length = 369 Back     alignment and structure
>pdb|2Z04|B Chain B, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Atpase Subunit From Aquifex Aeolicus Length = 365 Back     alignment and structure
>pdb|3V4S|A Chain A, Crystal Structure Of Adp-atp Complex Of Purk: N5-carboxyaminoimidazole Ribonucleotide Synthetase Length = 387 Back     alignment and structure
>pdb|4DLK|A Chain A, Crystal Structure Of Atp-ca++ Complex Of Purk: N5- Carboxyaminoimidazole Ribonucleotide Synthetase Length = 380 Back     alignment and structure
>pdb|3Q2O|A Chain A, Crystal Structure Of Purk: N5-Carboxyaminoimidazole Ribonucleotide Synthetase Length = 389 Back     alignment and structure
>pdb|3ORQ|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Synthetase From Staphylococcus Aureus Complexed With Adp Length = 377 Back     alignment and structure
>pdb|3MJF|A Chain A, Phosphoribosylamine-Glycine Ligase From Yersinia Pestis Length = 431 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 2e-42
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 2e-42
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 4e-42
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 2e-41
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 2e-41
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 3e-41
2z04_A 365 Phosphoribosylaminoimidazole carboxylase ATPase su 6e-39
3eth_A 355 Phosphoribosylaminoimidazole carboxylase ATPase su 6e-38
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 4e-34
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 1e-28
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 4e-11
3vmm_A 474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 2e-09
2pn1_A 331 Carbamoylphosphate synthase large subunit; ZP_0053 5e-09
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 7e-08
3r5x_A 307 D-alanine--D-alanine ligase; alpha-beta structure, 7e-08
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 8e-08
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 8e-08
1uc8_A 280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 9e-08
3ln6_A 750 Glutathione biosynthesis bifunctional protein GSH; 1e-07
4eg0_A 317 D-alanine--D-alanine ligase; structural genomics, 1e-07
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 2e-07
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 2e-07
1iow_A 306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 4e-07
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 7e-07
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 9e-07
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 1e-06
3ln7_A 757 Glutathione biosynthesis bifunctional protein GSH; 3e-06
3lwb_A 373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 4e-06
2fb9_A 322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 4e-06
3e5n_A 386 D-alanine-D-alanine ligase A; bacterial blight; 2. 6e-06
1e4e_A 343 Vancomycin/teicoplanin A-type resistance protein; 6e-06
3se7_A 346 VANA; alpha-beta structure, D-alanine-D-lactate li 7e-06
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 8e-06
3i12_A 364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 8e-06
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 1e-05
3ufx_B 397 Succinyl-COA synthetase beta subunit; ATP-grAsp fo 1e-05
2pvp_A 367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 2e-05
2i87_A 364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 2e-05
1ehi_A 377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 3e-05
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-05
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 4e-05
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 5e-05
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 6e-05
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 8e-05
3tqt_A 372 D-alanine--D-alanine ligase; cell envelope; 1.88A 1e-04
3k3p_A 383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 1e-04
2p0a_A 344 Synapsin-3, synapsin III; neurotransmitter release 2e-04
2r85_A 334 PURP protein PF1517; ATP-grAsp superfamily, unknow 2e-04
1i7n_A 309 Synapsin II; synapse, phosphorylation, neuropeptid 2e-04
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Length = 380 Back     alignment and structure
 Score =  145 bits (368), Expect = 2e-42
 Identities = 44/124 (35%), Positives = 71/124 (57%), Gaps = 9/124 (7%)

Query: 75  ACGVLTVEIEHVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEV 134
              V T ++EH+DV  ++KL  +G    P   T+ IIQDK++QK     +GIP+PE+  V
Sbjct: 62  GSDVTTYDLEHIDVQTLKKLYNEGYKIHPSPYTLEIIQDKFVQKEFLKKNGIPVPEYKLV 121

Query: 135 NDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALGGFDRSLYIEKWA 194
            DLES     ++FG+P++ K++   YDGRG  + K+E++L +A           Y+E++ 
Sbjct: 122 KDLES---DVREFGFPVVQKARKGGYDGRGVFIIKNEKDLENA------IKGETYLEEFV 172

Query: 195 PFVK 198
              K
Sbjct: 173 EIEK 176
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Length = 377 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Length = 389 Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Length = 403 Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Length = 369 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Length = 419 Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Length = 355 Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Length = 433 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Length = 391 Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Length = 474 Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Length = 331 Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Length = 307 Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Length = 280 Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Length = 750 Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A Length = 317 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Length = 306 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Length = 757 Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 373 Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Length = 322 Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Length = 386 Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Length = 343 Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Length = 346 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Length = 364 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Length = 397 Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Length = 367 Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Length = 364 Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Length = 377 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Length = 372 Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Length = 383 Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Length = 344 Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Length = 334 Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 99.97
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 99.97
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 99.96
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 99.96
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 99.95
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 99.95
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 99.95
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 99.94
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 99.94
3eth_A 355 Phosphoribosylaminoimidazole carboxylase ATPase su 99.93
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 99.92
2ip4_A 417 PURD, phosphoribosylamine--glycine ligase; GAR syn 99.92
3vot_A 425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 99.92
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 99.92
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 99.92
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 99.92
2yw2_A 424 Phosphoribosylamine--glycine ligase; glycinamide r 99.92
2yrx_A 451 Phosphoribosylglycinamide synthetase; glycinamide 99.91
2xcl_A 422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 99.91
2z04_A 365 Phosphoribosylaminoimidazole carboxylase ATPase su 99.91
2qk4_A 452 Trifunctional purine biosynthetic protein adenosi; 99.91
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 99.9
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 99.9
4eg0_A 317 D-alanine--D-alanine ligase; structural genomics, 99.9
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 99.9
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 99.89
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 99.89
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 99.89
1iow_A 306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 99.89
2pbz_A 320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 99.89
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 99.89
2r7k_A 361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 99.88
1vkz_A 412 Phosphoribosylamine--glycine ligase; TM1250, struc 99.88
4fu0_A 357 D-alanine--D-alanine ligase 7; vancomycin resistan 99.88
3i12_A 364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 99.88
3e5n_A 386 D-alanine-D-alanine ligase A; bacterial blight; 2. 99.88
3mjf_A 431 Phosphoribosylamine--glycine ligase; structural ge 99.88
2r85_A 334 PURP protein PF1517; ATP-grAsp superfamily, unknow 99.88
2i87_A 364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 99.88
3r5x_A 307 D-alanine--D-alanine ligase; alpha-beta structure, 99.88
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 99.88
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 99.87
2pn1_A 331 Carbamoylphosphate synthase large subunit; ZP_0053 99.87
1ehi_A 377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 99.87
3se7_A 346 VANA; alpha-beta structure, D-alanine-D-lactate li 99.86
3k3p_A 383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 99.86
1e4e_A 343 Vancomycin/teicoplanin A-type resistance protein; 99.85
1uc8_A 280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 99.85
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 99.85
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.85
3tqt_A 372 D-alanine--D-alanine ligase; cell envelope; 1.88A 99.85
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 99.85
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 99.84
3lwb_A 373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 99.84
3vmm_A 474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 99.83
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 99.82
2pvp_A 367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 99.79
2fb9_A 322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 99.76
1gsa_A 316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 99.74
1z2n_X 324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 99.73
3ln6_A 750 Glutathione biosynthesis bifunctional protein GSH; 99.73
3ln7_A 757 Glutathione biosynthesis bifunctional protein GSH; 99.69
3df7_A 305 Putative ATP-grAsp superfamily protein; putative p 99.63
1wr2_A 238 Hypothetical protein PH1789; structural genomics, 99.63
2q7d_A 346 Inositol-tetrakisphosphate 1-kinase; inositol kina 99.56
1i7n_A 309 Synapsin II; synapse, phosphorylation, neuropeptid 99.54
2p0a_A 344 Synapsin-3, synapsin III; neurotransmitter release 99.49
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 99.48
2nu8_B 388 SCS-beta, succinyl-COA synthetase beta chain; citr 99.43
3ufx_B 397 Succinyl-COA synthetase beta subunit; ATP-grAsp fo 99.41
2fp4_B 395 Succinyl-COA ligase [GDP-forming] beta-chain, mito 99.41
3t7a_A 330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 98.69
3mwd_A 425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 98.03
3pff_A 829 ATP-citrate synthase; phosphohistidine, organic ac 97.77
3tig_A 380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 96.92
3n6x_A474 Putative glutathionylspermidine synthase; domain o 96.7
2io8_A619 Bifunctional glutathionylspermidine synthetase/ami 93.13
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
Probab=99.97  E-value=3.7e-30  Score=216.80  Aligned_cols=177  Identities=37%  Similarity=0.540  Sum_probs=158.5

Q ss_pred             CCchhhhhc----ccccccccccCCCeEEEECCCCCcccccCCCCCCCCC--CccccCCCCHhhhh----cCCeEEeccc
Q 042131           15 PSPTIHCRR----GRRFPVDRPLKDSRLWELDSGAIAARGISPPPLLDSA--RPEVHNFELPVAVV----ACGVLTVEIE   84 (201)
Q Consensus        15 ~~~~i~~~~----g~~l~~aa~~~G~~v~~~~~~~~~~~~~~~~~~~~a~--~~~~~~~~d~~~l~----~~d~i~~~~~   84 (201)
                      +.++|++++    |++++++|+++|++|+++|..+.+..++       ++  ..+..++.|.+++.    .+|+++++++
T Consensus        23 ~~~~I~ilGgG~lg~~l~~aa~~lG~~v~~~d~~~~p~~~~-------ad~~~~~~~~~~d~~~l~~~a~~~d~i~~e~e   95 (403)
T 3k5i_A           23 NSRKVGVLGGGQLGRMLVESANRLNIQVNVLDADNSPAKQI-------SAHDGHVTGSFKEREAVRQLAKTCDVVTAEIE   95 (403)
T ss_dssp             SCCEEEEECCSHHHHHHHHHHHHHTCEEEEEESTTCTTGGG-------CCSSCCEESCTTCHHHHHHHHTTCSEEEESSS
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCcHHHh-------ccccceeecCCCCHHHHHHHHHhCCEEEECCC
Confidence            356788774    4799999999999999998656777788       66  66788899988776    8899999999


Q ss_pred             cCCHHHHHHHHHCCCcccccHHHHHHHhCHHHHHHHHhhCCCCCCCccccC--CHHHHHHHHHHhCCCEEEeecCCCCCC
Q 042131           85 HVDVAIMEKLEQQGVDCQPKASTIRIIQDKYIQKVHFSPHGIPLPEFMEVN--DLESARRAGKQFGYPLMVKSKSLAYDG  162 (201)
Q Consensus        85 ~i~~~~~~~l~~~g~~~~~~~~~~~~~~dK~~~~~~l~~~gip~p~~~~~~--~~~~~~~~~~~~~~P~VvKp~~g~~~g  162 (201)
                      +++..+++.+++ |+++++++++++++.||..++++|+++|||+|++..++  +.+++.++++++|||+||||..|+|+|
T Consensus        96 ~~~~~~l~~l~~-g~~v~p~~~a~~~~~dK~~~k~~l~~~Gip~p~~~~~~~~~~~~~~~~~~~~g~P~VvKp~~gg~~g  174 (403)
T 3k5i_A           96 HVDTYALEEVAS-EVKIEPSWQAIRTIQNKFNQKEHLRKYGIPMAEHRELVENTPAELAKVGEQLGYPLMLKSKTMAYDG  174 (403)
T ss_dssp             CSCHHHHHHHTT-TSEESSCHHHHHHHTSHHHHHHHHHTTTCCBCCEEEESSCCHHHHHHHHHHHCSSEEEEESSSCCTT
T ss_pred             CCCHHHHHHHHc-CCccCcCHHHHHHhcCHHHHHHHHHHCCcCCCCEEEEcCCCHHHHHHHHHHhCCCEEEEeCCCCcCC
Confidence            999999999998 88899999999999999999999999999999999999  999999999999999999999887899


Q ss_pred             CCeEEcCCHHHHHHHHHHhcCCCCceEEeecCC-CceeeC
Q 042131          163 RGNAVAKSEEELSSAITALGGFDRSLYIEKWAP-FVKVNV  201 (201)
Q Consensus       163 ~gv~~~~~~~el~~~~~~~~~~~~~~lvEe~i~-G~e~sv  201 (201)
                      +||+++++.+|+.++++.+...  .+++|+||+ |.|++|
T Consensus       175 ~Gv~~v~~~~el~~a~~~~~~~--~~lvEe~i~~~~E~sv  212 (403)
T 3k5i_A          175 RGNFRVNSQDDIPEALEALKDR--PLYAEKWAYFKMELAV  212 (403)
T ss_dssp             TTEEEECSTTSHHHHHHHTTTS--CEEEEECCCEEEEEEE
T ss_pred             CCEEEECCHHHHHHHHHhcCCC--cEEEecCCCCCeEEEE
Confidence            9999999999999999987544  499999999 689885
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* Back     alignment and structure
>3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Back     alignment and structure
>2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
>3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d1uc8a2 192 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme Ly 1e-06
d1a9xa6 259 d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta 2e-06
d1a9xa5 275 d.142.1.2 (A:128-402) Carbamoyl phosphate syntheta 2e-06
d3etja3 198 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribo 2e-05
d2r7ka2 238 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carbo 4e-05
d1e4ea2 211 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase V 5e-05
d1kjqa3 206 d.142.1.2 (A:113-318) Glycinamide ribonucleotide t 5e-05
d2r85a2 235 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carbo 7e-05
d1gsoa3 224 d.142.1.2 (A:104-327) Glycinamide ribonucleotide s 1e-04
d1ehia2 228 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase V 2e-04
d1vkza3 220 d.142.1.2 (A:94-313) Glycinamide ribonucleotide sy 5e-04
d1kjqa2111 c.30.1.1 (A:2-112) Glycinamide ribonucleotide tran 7e-04
d1eucb2 246 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta- 0.003
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Length = 192 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: Lysine biosynthesis enzyme LysX ATP-binding domain
domain: Lysine biosynthesis enzyme LysX ATP-binding domain
species: Thermus thermophilus [TaxId: 274]

 Score = 45.0 bits (105), Expect = 1e-06
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 114 KYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVK 154
           K+   V  +  G+P P+     D E A R  + FGYP+++K
Sbjct: 1   KWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLK 41
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 275 Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 238 Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Length = 211 Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Length = 235 Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Length = 224 Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Length = 228 Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Length = 220 Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Length = 111 Back     information, alignment and structure
>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1vkza3 220 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.79
d1a9xa5 275 Carbamoyl phosphate synthetase (CPS), large subuni 99.76
d1ulza3 214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 99.74
d1gsoa3 224 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.74
d1iowa2 210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 99.71
d1ehia2 228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 99.71
d2j9ga3 216 Biotin carboxylase (BC), domain 2 {Escherichia col 99.69
d1e4ea2 211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 99.68
d1w96a3 267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 99.68
d2r7ka2 238 5-formaminoimidazole-4-carboxamide ribonucleotide 99.68
d1a9xa6 259 Carbamoyl phosphate synthetase (CPS), large subuni 99.66
d1kjqa3 206 Glycinamide ribonucleotide transformylase PurT, do 99.66
d1uc8a2 192 Lysine biosynthesis enzyme LysX ATP-binding domain 99.65
d2r85a2 235 5-formaminoimidazole-4-carboxamide ribonucleotide 99.62
d3etja3 198 N5-carboxyaminoimidazole ribonucleotide synthetase 99.57
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 99.54
d1i7na2 206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 99.34
d2nu7b2 238 Succinyl-CoA synthetase, beta-chain, N-terminal do 98.88
d1eucb2 246 Succinyl-CoA synthetase, beta-chain, N-terminal do 98.71
d1gsaa2 192 Prokaryotic glutathione synthetase, C-domain {Esch 98.14
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.98
d1ulza2114 Biotin carboxylase (BC), N-terminal domain {Aquife 97.37
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 97.22
d2pbza2 213 5-formaminoimidazole-4-carboxamide ribonucleotide 97.19
d2j9ga2114 Biotin carboxylase (BC), N-terminal domain {Escher 97.17
d1uc8a188 Lysine biosynthesis enzyme LysX, N-terminal domain 96.01
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.44
d1w96a2170 Acetyl-CoA carboxylase, BC-N subdomain {Baker's ye 93.16
d1gsaa1122 Prokaryotic glutathione synthetase, N-terminal dom 87.25
d2r85a199 5-formaminoimidazole-4-carboxamide ribonucleotide 81.74
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Glycinamide ribonucleotide synthetase (GAR-syn), domain 2
species: Thermotoga maritima [TaxId: 2336]

Probab=99.79  E-value=2.6e-19  Score=136.85  Aligned_cols=88  Identities=24%  Similarity=0.308  Sum_probs=79.8

Q ss_pred             CHHHHHHHHhhCCCCCCCccccCCHHHHHHHHHHhCCCEEEeecCCCCCCCCeEEcCCHHHHHHHHHHhc------CCCC
Q 042131          113 DKYIQKVHFSPHGIPLPEFMEVNDLESARRAGKQFGYPLMVKSKSLAYDGRGNAVAKSEEELSSAITALG------GFDR  186 (201)
Q Consensus       113 dK~~~~~~l~~~gip~p~~~~~~~~~~~~~~~~~~~~P~VvKp~~g~~~g~gv~~~~~~~el~~~~~~~~------~~~~  186 (201)
                      .|..+|++|+++|||+|++..++|.+++.++++++|||+||||.+++ ||+||+++++.+++.++++.+.      ....
T Consensus         1 sK~~~K~~l~~~gIptp~~~~~~~~~e~~~~~~~ig~PvVvKP~~~~-gs~Gv~~v~~~~el~~a~~~~~~~~~~~~~~~   79 (220)
T d1vkza3           1 SKVYAKRFMKKYGIRTARFEVAETPEELREKIKKFSPPYVIKADGLA-RGKGVLILDSKEETIEKGSKLIIGELIKGVKG   79 (220)
T ss_dssp             CHHHHHHHHHHTTCCCCCEEEESSHHHHHHHHTTSCSSEEEEESSCC-SSCCEEEESSHHHHHHHHHHHHHTSSSTTCCS
T ss_pred             CHHHHHHHHHHCCCCCCCeEEeCCHHHHHHHHHHcCCCEEEEecccc-ccccceeeccHHHHHHHhhhhccccccccccc
Confidence            48899999999999999999999999999999999999999999976 8999999999999999998753      2345


Q ss_pred             ceEEeecCCCceeeC
Q 042131          187 SLYIEKWAPFVKVNV  201 (201)
Q Consensus       187 ~~lvEe~i~G~e~sv  201 (201)
                      .+++|||++|.|++|
T Consensus        80 ~vliEe~i~g~e~~v   94 (220)
T d1vkza3          80 PVVIDEFLAGNELSA   94 (220)
T ss_dssp             CEEEEECCCSEEEEE
T ss_pred             eEeeeccccccccee
Confidence            699999999999975
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsaa1 c.30.1.3 (A:1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r85a1 c.30.1.8 (A:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure