Citrus Sinensis ID: 042552
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| 224132000 | 344 | predicted protein [Populus trichocarpa] | 0.955 | 0.497 | 0.912 | 4e-83 | |
| 225435339 | 348 | PREDICTED: uncharacterized membrane prot | 0.955 | 0.491 | 0.918 | 2e-82 | |
| 356550202 | 349 | PREDICTED: uncharacterized membrane prot | 0.955 | 0.489 | 0.912 | 3e-82 | |
| 255578135 | 343 | UDP-glucuronic acid/UDP-N-acetylgalactos | 0.955 | 0.498 | 0.900 | 5e-82 | |
| 356543480 | 349 | PREDICTED: uncharacterized membrane prot | 0.955 | 0.489 | 0.912 | 8e-82 | |
| 255635117 | 196 | unknown [Glycine max] | 0.955 | 0.872 | 0.906 | 2e-81 | |
| 357453963 | 354 | Membrane protein, putative [Medicago tru | 0.960 | 0.485 | 0.866 | 8e-80 | |
| 449456018 | 344 | PREDICTED: uncharacterized membrane prot | 0.955 | 0.497 | 0.865 | 2e-79 | |
| 186503767 | 342 | nucleotide/sugar transporter-like protei | 0.955 | 0.5 | 0.853 | 1e-78 | |
| 297790031 | 342 | hypothetical protein ARALYDRAFT_921025 [ | 0.955 | 0.5 | 0.853 | 1e-78 |
| >gi|224132000|ref|XP_002328160.1| predicted protein [Populus trichocarpa] gi|222837675|gb|EEE76040.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 312 bits (799), Expect = 4e-83, Method: Compositional matrix adjust.
Identities = 156/171 (91%), Positives = 166/171 (97%)
Query: 1 MGEMSSFQLGVIGALFLSVASSVSIVICNKALMSNLGFPFATTLTSWHLMVTFCTLHAAQ 60
MGEM SFQLGVIGALFLSVASSVSIVICNKALMSNLGFPFATTLTSWHLMVTFCTLHAAQ
Sbjct: 1 MGEMPSFQLGVIGALFLSVASSVSIVICNKALMSNLGFPFATTLTSWHLMVTFCTLHAAQ 60
Query: 61 RLNFFESKAVDVKTVMLFGILNGISIGLLNLSLGFNSVGFYQMTKLAIIPFTVLLETLFL 120
RLN FESK++++K VMLFGILNG+SIGLLNLSLGFNS+GFYQMTKLAIIPFTVLLETLFL
Sbjct: 61 RLNLFESKSIEMKPVMLFGILNGVSIGLLNLSLGFNSIGFYQMTKLAIIPFTVLLETLFL 120
Query: 121 KKQFSQKIKFSLFLLLVGVGIASVTDLQLNMVGTILSLLAIVTTCVGQIVS 171
KKQFSQKIK SLF+LLVGVGIASVTDLQLN VGTILSLLAI+TTCVGQI++
Sbjct: 121 KKQFSQKIKLSLFVLLVGVGIASVTDLQLNFVGTILSLLAIITTCVGQILT 171
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225435339|ref|XP_002285229.1| PREDICTED: uncharacterized membrane protein At1g06890 [Vitis vinifera] gi|297746270|emb|CBI16326.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356550202|ref|XP_003543477.1| PREDICTED: uncharacterized membrane protein At1g06890-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255578135|ref|XP_002529937.1| UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter, putative [Ricinus communis] gi|223530567|gb|EEF32445.1| UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356543480|ref|XP_003540188.1| PREDICTED: uncharacterized membrane protein At1g06890-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255635117|gb|ACU17916.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357453963|ref|XP_003597262.1| Membrane protein, putative [Medicago truncatula] gi|355486310|gb|AES67513.1| Membrane protein, putative [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449456018|ref|XP_004145747.1| PREDICTED: uncharacterized membrane protein At1g06890-like [Cucumis sativus] gi|449524366|ref|XP_004169194.1| PREDICTED: uncharacterized membrane protein At1g06890-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|186503767|ref|NP_850120.3| nucleotide/sugar transporter-like protein [Arabidopsis thaliana] gi|330253012|gb|AEC08106.1| nucleotide/sugar transporter-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297790031|ref|XP_002862929.1| hypothetical protein ARALYDRAFT_921025 [Arabidopsis lyrata subsp. lyrata] gi|297308706|gb|EFH39188.1| hypothetical protein ARALYDRAFT_921025 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| TAIR|locus:504955965 | 342 | AT2G28315 [Arabidopsis thalian | 0.955 | 0.5 | 0.736 | 3.8e-62 | |
| TAIR|locus:2033097 | 357 | AT1G06890 [Arabidopsis thalian | 0.955 | 0.478 | 0.637 | 1.1e-50 | |
| TAIR|locus:2064316 | 353 | AT2G30460 "AT2G30460" [Arabido | 0.955 | 0.484 | 0.614 | 2.8e-50 | |
| TAIR|locus:2162271 | 350 | AT5G42420 [Arabidopsis thalian | 0.888 | 0.454 | 0.341 | 2.1e-20 | |
| TAIR|locus:2199557 | 348 | AT1G21070 [Arabidopsis thalian | 0.882 | 0.454 | 0.337 | 4.4e-20 | |
| TAIR|locus:2118514 | 335 | AT4G09810 [Arabidopsis thalian | 0.865 | 0.462 | 0.341 | 9.2e-20 | |
| TAIR|locus:2009076 | 335 | AT1G34020 [Arabidopsis thalian | 0.865 | 0.462 | 0.335 | 2.5e-19 | |
| TAIR|locus:2030076 | 347 | AT1G76670 [Arabidopsis thalian | 0.882 | 0.455 | 0.331 | 2.5e-19 | |
| TAIR|locus:2122467 | 337 | NST-K1 "nucleotide sugar trans | 0.877 | 0.465 | 0.305 | 2.9e-17 | |
| ZFIN|ZDB-GENE-041210-186 | 317 | slc35e3 "solute carrier family | 0.882 | 0.498 | 0.276 | 4.9e-16 |
| TAIR|locus:504955965 AT2G28315 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 635 (228.6 bits), Expect = 3.8e-62, P = 3.8e-62
Identities = 126/171 (73%), Positives = 142/171 (83%)
Query: 1 MGEMSSFQLGVIGALFLSVASSVSIVICNKALMSNLGFPFATTLTSWHLMVTFCTLHAAQ 60
MGEM S Q+GVIGALFLSVASSVSIVICNKALM+NLGFPFATTLTSWHLMVT+CTLH A
Sbjct: 1 MGEMKSMQMGVIGALFLSVASSVSIVICNKALMTNLGFPFATTLTSWHLMVTYCTLHVAY 60
Query: 61 RLNFFESKAVDVKTVMXXXXXXXXXXXXXXXXXXXXXVGFYQMTKLAIIPFTVLLETLFL 120
+LNFFE+K +D++TV+ +GFYQMTKLAIIPFTVLLETLFL
Sbjct: 61 KLNFFENKPIDMRTVVLFGLLNGISIGLLNLSLGFNSIGFYQMTKLAIIPFTVLLETLFL 120
Query: 121 KKQFSQKIKFSLFLLLVGVGIASVTDLQLNMVGTILSLLAIVTTCVGQIVS 171
K+FSQKIKFSLFLLLVGVGIAS+TDLQLN VG++LSLLAI TTCVGQI++
Sbjct: 121 NKKFSQKIKFSLFLLLVGVGIASITDLQLNFVGSVLSLLAIATTCVGQILT 171
|
|
| TAIR|locus:2033097 AT1G06890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2064316 AT2G30460 "AT2G30460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162271 AT5G42420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199557 AT1G21070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118514 AT4G09810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009076 AT1G34020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030076 AT1G76670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122467 NST-K1 "nucleotide sugar transporter-KT 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041210-186 slc35e3 "solute carrier family 35, member E3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 99.97 | |
| KOG1444 | 314 | consensus Nucleotide-sugar transporter VRG4/SQV-7 | 99.96 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 99.95 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 99.93 | |
| KOG1443 | 349 | consensus Predicted integral membrane protein [Fun | 99.89 | |
| COG5070 | 309 | VRG4 Nucleotide-sugar transporter [Carbohydrate tr | 99.84 | |
| KOG1442 | 347 | consensus GDP-fucose transporter [Carbohydrate tra | 99.83 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 99.83 | |
| KOG1582 | 367 | consensus UDP-galactose transporter related protei | 99.58 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 99.42 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 99.29 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 99.23 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 99.22 | |
| KOG1583 | 330 | consensus UDP-N-acetylglucosamine transporter [Car | 99.19 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 99.17 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 99.15 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 99.13 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 99.11 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 99.06 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 98.97 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 98.96 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 98.96 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 98.89 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 98.87 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 98.73 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 98.69 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 98.48 | |
| KOG3912 | 372 | consensus Predicted integral membrane protein [Gen | 98.47 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 98.37 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 98.28 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 98.07 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 97.98 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 97.78 | |
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 97.76 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 97.67 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 97.64 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 97.52 | |
| KOG4314 | 290 | consensus Predicted carbohydrate/phosphate translo | 97.5 | |
| KOG2766 | 336 | consensus Predicted membrane protein [Function unk | 97.43 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 97.38 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 97.32 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 97.3 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 97.25 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 97.18 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 97.07 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 97.07 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 96.97 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 96.91 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 96.77 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 96.76 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 96.75 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 96.74 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 96.63 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 96.61 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 96.6 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 96.58 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 96.47 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 96.28 | |
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 96.07 | |
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 95.98 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 95.69 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 95.44 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 95.02 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 94.39 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 94.21 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 90.63 | |
| KOG2922 | 335 | consensus Uncharacterized conserved protein [Funct | 89.47 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 88.6 | |
| PF04657 | 138 | DUF606: Protein of unknown function, DUF606; Inter | 82.59 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 82.54 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 81.49 |
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.97 E-value=5.8e-32 Score=221.59 Aligned_cols=172 Identities=33% Similarity=0.446 Sum_probs=163.0
Q ss_pred CcccchHHHHHHHHHHHHHHHHHHHHHHHhhccCCCchHHHHHHHHHHHHHHHHHHHHHcCCCccCc----cchhHHHHH
Q 042552 3 EMSSFQLGVIGALFLSVASSVSIVICNKALMSNLGFPFATTLTSWHLMVTFCTLHAAQRLNFFESKA----VDVKTVMLF 78 (179)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~S~~~~~~NK~ll~~~~f~~p~~lt~~q~~~~~~~~~i~~~~~~~~~~~----~~~~~~lp~ 78 (179)
+++++..+...+...|+.+|++.++.||+++++++||||+++|.+|..++++...+.+..+..++++ .+++.++|+
T Consensus 10 ~~~~~~~~~~~~~~~w~~~~v~~~~~nK~il~~~~f~~p~~lt~~~~~~~~l~~~v~~~l~~~~~~~~~~~~~~~~llpl 89 (316)
T KOG1441|consen 10 GQLKKILRIGIAFAIWYVLSVGVIILNKYILSKYGFPFPITLTMLHLFCGALALLVIKVLKLVPPSKISSKLPLRTLLPL 89 (316)
T ss_pred cccchhHHHHHHHHHHhhhheeeEEeeHhhhccCCCCCccHHHHHHHHHHHHHHHHHHHhcCCCCCccccccchHHHHHH
Confidence 4667788889999999999999999999999999999999999999999999999999888877655 678999999
Q ss_pred HHHHHHHhhhcccccccchhhHHHHHhHHHHHHHHHHHHHHhccccChhhhhHHhHhhhhheeeeecCccchHHHHHHHH
Q 042552 79 GILNGISIGLLNLSLGFNSVGFYQMTKLAIIPFTVLLETLFLKKQFSQKIKFSLFLLLVGVGIASVTDLQLNMVGTILSL 158 (179)
Q Consensus 79 ~l~~~~~~~~~n~sl~~~sv~~~~i~k~~~~~~~~~~~~~~~~~~~s~~~~~sl~li~~Gv~~~~~~d~~~~~~G~~~~l 158 (179)
|++++++++++|.|++|+||||+|++|+++||+++++++++.+|+++..+++++.+++.||++++.+|.+||+.|++.++
T Consensus 90 ~~~~~~~~v~~n~Sl~~v~VsF~q~iKa~~P~~tvl~~~~~~~~~~s~~~~lsL~piv~GV~ias~~e~~fn~~G~i~a~ 169 (316)
T KOG1441|consen 90 GLVFCISHVLGNVSLSYVPVSFYQTIKALMPPFTVLLSVLLLGKTYSSMTYLSLLPIVFGVAIASVTELSFNLFGFISAM 169 (316)
T ss_pred HHHHHHHHHhcchhhhccchhHHHHHHhhcchhHHHHHHHHhCCCCcceEEEEEEEeeeeEEEeeeccccccHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHccc
Q 042552 159 LAIVTTCVGQIVSFFK 174 (179)
Q Consensus 159 ~s~~~~a~~~i~~~~k 174 (179)
.+.+.+++++|+.++.
T Consensus 170 ~s~~~~al~~I~~~~l 185 (316)
T KOG1441|consen 170 ISNLAFALRNILSKKL 185 (316)
T ss_pred HHHHHHHHHHHHHHHh
Confidence 9999999999998543
|
|
| >KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >KOG1443 consensus Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1442 consensus GDP-fucose transporter [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >KOG1582 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >KOG1583 consensus UDP-N-acetylglucosamine transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >KOG3912 consensus Predicted integral membrane protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2766 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2922 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 97.93 | |
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 97.67 |
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
Probab=97.93 E-value=9.4e-05 Score=51.10 Aligned_cols=71 Identities=20% Similarity=0.141 Sum_probs=61.0
Q ss_pred HHHHHHHHHHhhhcccccccchhhHHHHH-hHHHHHHHHHHHHHHhccccChhhhhHHhHhhhhheeeeecC
Q 042552 76 MLFGILNGISIGLLNLSLGFNSVGFYQMT-KLAIIPFTVLLETLFLKKQFSQKIKFSLFLLLVGVGIASVTD 146 (179)
Q Consensus 76 lp~~l~~~~~~~~~n~sl~~~sv~~~~i~-k~~~~~~~~~~~~~~~~~~~s~~~~~sl~li~~Gv~~~~~~d 146 (179)
+...+++..+..+-+.++++.|++...-+ +...|..+.+.+.+++||++|..+++++.+++.|+......+
T Consensus 34 ~~~~~~~~~~~~~~~~al~~~p~s~ay~i~~g~~~v~~~l~~~~~~~E~~s~~~~~Gi~lIi~Gv~~l~~~~ 105 (110)
T 3b5d_A 34 VGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS 105 (110)
T ss_pred HHHHHHHHHHHHHHHHHHHhCChhhHHHHHhhHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHhcCC
Confidence 33344677788888999999999999877 889999999999999999999999999999999998765543
|
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00