Citrus Sinensis ID: 042559

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------
MDDALSVLLGVSTSTSASASASSSSSTTSMAKRLCSSSTSQNPNITAKLNPSMDNLLETLLNLADSPPSLSIDVSFERLLDSAPGDEDQSHLIDRAIKVSSLLLESAKRSARKRASHHNFLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIEQMVDSEFNSEISLPSQLSSRTSDDSLLMSCSESSYNSDHGSGNEEGQDSGYVIFEESSDEVDFLAI
ccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccccccEEEccccccccHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHccccccEEEccccccccccccccccHHHHHHccccccEEEEccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHcccccccccccccccccccHHccccccccccccccccHHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccc
cccEEEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHccccccccccccHcHHHHHcHHHHHHHHcccHccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccEEEEcHHccccccHHHHHHHHHHccccHEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHcHHHHHHHHccccccccHcEEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccHcEEEccccccccHHHccHHHHHHHHHHcccccEEEccccEccHHHHHHHHHccccccEEEcccccHccHHHHHHHHcccccccEEEEEEcccHcccHHHHHHHHHHccccccccEEEEEcccccccccccccHHcccccccccHHHHHHHcccEEEEEEccccccEEEHHHHEccccccccccccHcccccccccEEEEcccccccccccccccccccccEEEEEEccccEEEEcc
MDDALSVLLGVStstsasasassssstTSMAKRLcssstsqnpnitaklnpSMDNLLETLLNladsppslsidvsferlldsapgdedqshLIDRAIKVSSLLLESAKRSARKRAshhnflawplppdltiKVFSMLDTQSLCHAAATCSMfnkfamdplcyanidlrtvvpkVNNAVVSTMIHRAGKSLqslklgivpgptaspwscQSLVYTIRnsvdvssfswndkktrqgkesfiltrsclnplsgesgaaGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSmscpllerlffessktgrddslksptcvdfvnncpnltsmalrgfklpdyKIRILLKGFRklkyvdfstsySITGAFLrnlgsgtggnLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFlrhldisnreglasegdwydrcfnsriiplkevseerpdicvlaefpsegsfidieqmvdsefnseislpsqlssrtsddsllmscsessynsdhgsgneegqdsgyvifeessdevdflai
MDDALSVLLGvststsasasasssssttsMAKRLCSsstsqnpnitAKLNPSMDNLLETLLNLADSPPSLSIDVSFERLLDSapgdedqshLIDRAIKVSSLLLESAKRSARKrashhnflawplppDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNsvdvssfswndkktrqgkesfiltrsclnplsGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFEssktgrddslksptcVDFVNNCPNLtsmalrgfklpDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNreglasegdwydRCFNSRIIplkevseerpdICVLAEFPSEGSFIDIEQMVDSEFNSEISLPSQLSSRTSDDSLLMSCSESSYNSDHGSGNEEGQDSGYVIFEESSDEVDFLAI
MDDALSVLLGVststsasasasssssttsMAKRLCSSSTSQNPNITAKLNPSMDNLLETLLNLADSPPSLSIDVSFERLLDSAPGDEDQSHLIDRAIKVSSLLLESAKRSARKRASHHNFLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIEQMVDSEFNSEISLPSQLSSRTSDDSLLMSCSESSYNSDHGSGNEEGQDSGYVIFEESSDEVDFLAI
************************************************************************************************IKV*****************HHNFLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDK*****KESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFE************PTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIE******************************************************************
*****S*******************************************************************************************************************AWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIEQMVDSEFNSEIS**************************************YVIFEESSDEVDFLAI
MDDALSVLLGV*****************************QNPNITAKLNPSMDNLLETLLNLADSPPSLSIDVSFERLLDSAPGDEDQSHLIDRAIKVSSLLLES**********HHNFLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIEQMVDSEFNSEISLPSQLSSRTSDDSLLMSC***************GQDSGYVIFEESSDEVDFLAI
*DDALSVLLGVS**************************************PS**NLLETLLNLADSPPSLSIDVSFERLLDSAPGD**QSHLIDRAIKVSSLLLESAKRSARKRASHHNFLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIEQMVDSEFNSEI************************************DSGYVIFEESSDEVDFLAI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDALSVLLGVSTSTSASASASSSSSTTSMAKRLCSSSTSQNPNITAKLNPSMDNLLETLLNLADSPPSLSIDVSFERLLDSAPGDEDQSHLIDRAIKVSSLLLESAKRSARKRASHHNFLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIEQMVDSEFNSEISLPSQLSSRTSDDSLLMSCSESSYNSDHGSGNEEGQDSGYVIFEESSDEVDFLAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query547 2.2.26 [Sep-21-2011]
Q0WRC9479 F-box protein SKIP17 OS=A yes no 0.714 0.816 0.445 5e-82
Q9SY03506 F-box protein At4g02760 O no no 0.736 0.796 0.424 1e-79
Q2V3L6301 F-box protein At4g02733 O no no 0.431 0.784 0.398 3e-40
Q9CZV8436 F-box/LRR-repeat protein yes no 0.464 0.582 0.255 1e-09
Q96IG2436 F-box/LRR-repeat protein yes no 0.464 0.582 0.251 2e-09
Q58DG6436 F-box/LRR-repeat protein yes no 0.464 0.582 0.251 2e-09
Q9QZH7276 F-box/LRR-repeat protein yes no 0.444 0.880 0.255 6e-09
Q8BH16423 F-box/LRR-repeat protein no no 0.477 0.617 0.237 1e-06
Q5R3Z8423 F-box/LRR-repeat protein yes no 0.442 0.572 0.237 3e-06
Q9UKC9423 F-box/LRR-repeat protein no no 0.442 0.572 0.237 4e-06
>sp|Q0WRC9|SKI17_ARATH F-box protein SKIP17 OS=Arabidopsis thaliana GN=SKIP17 PE=1 SV=1 Back     alignment and function desciption
 Score =  305 bits (782), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 191/429 (44%), Positives = 252/429 (58%), Gaps = 38/429 (8%)

Query: 54  DNLLETLLNLADSPPSLSIDVSFERLLD----SAPGDED-QSHLIDRAIKVSSLLLESAK 108
           D ++ + L+  DS P +SI  SF+R+LD    SA  DE  Q  L+DR ++++SLLL+S +
Sbjct: 23  DLIISSFLSFPDSSP-ISISNSFDRVLDRALASASADESVQDRLVDRTLELASLLLDSTR 81

Query: 109 RSARKRASHHNFLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLR 168
           R  RKRAS HN  +W LPP+LTIKVFSMLDT+S+  AA  C+MFNK AMD LCY++IDL 
Sbjct: 82  RCFRKRASVHNSNSWSLPPELTIKVFSMLDTKSMMQAAVCCTMFNKCAMDRLCYSHIDLT 141

Query: 169 TVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWND 228
           T     +  VVSTMI+RAGK L+SLKLG V     S  +                     
Sbjct: 142 TSARYADKGVVSTMINRAGKELRSLKLGRVVRTAGSDSAAP------------------- 182

Query: 229 KKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDL 288
                     +L+ SCL+PL+   G  GS LR L LYN+  +   SL  ALS CP++ DL
Sbjct: 183 ----------LLSGSCLSPLAYNHGFLGSRLRSLRLYNLRPIKYRSLCDALSVCPNITDL 232

Query: 289 EIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRD-DSLKSPTCVDFVNNCPNLTSMAL 347
            IVGL+    +   S++  C L+E LF E+    R  +S    + V+FV NCPNLTS+ L
Sbjct: 233 RIVGLYNLTEELFNSLTKKCRLIEHLFLETYGYPRTLESKAGSSLVEFVTNCPNLTSLTL 292

Query: 348 RGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLK 407
             F L D   R L +  RKLKY++ S S +I G FLR LG     NLL+ LILR C  L+
Sbjct: 293 IRFGLTDDWARNLAESCRKLKYLNLSRSPTIKGRFLRELGLSCKENLLKTLILRSCPKLQ 352

Query: 408 EVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRCFNSRIIPLKEVSEERPDICV 467
           E EV  F  ++LTG+FK +R +D+S+  GLAS  D   RC N    PL+ + EER D+  
Sbjct: 353 EKEVLEFCNSLLTGNFKSIRQIDVSSNSGLAS-SDRGKRC-NKPNFPLERLKEERSDVTF 410

Query: 468 LAEFPSEGS 476
           +A+FPS  S
Sbjct: 411 VADFPSTSS 419
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SY03|FB219_ARATH F-box protein At4g02760 OS=Arabidopsis thaliana GN=At4g02760 PE=2 SV=2 Back     alignment and function description
>sp|Q2V3L6|FB343_ARATH F-box protein At4g02733 OS=Arabidopsis thaliana GN=At4g02733 PE=2 SV=1 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description
>sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 Back     alignment and function description
>sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 Back     alignment and function description
>sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 Back     alignment and function description
>sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
255559418515 conserved hypothetical protein [Ricinus 0.926 0.984 0.751 0.0
296085205532 unnamed protein product [Vitis vinifera] 0.939 0.966 0.746 0.0
147783780603 hypothetical protein VITISV_024140 [Viti 0.930 0.844 0.707 0.0
224062475471 f-box family protein [Populus trichocarp 0.857 0.995 0.686 0.0
449458488472 PREDICTED: F-box protein SKIP17-like [Cu 0.848 0.983 0.650 0.0
359479687486 PREDICTED: F-box protein SKIP17 [Vitis v 0.855 0.962 0.667 1e-178
356572196480 PREDICTED: F-box protein SKIP17-like [Gl 0.817 0.931 0.636 1e-177
224085473 676 predicted protein [Populus trichocarpa] 0.758 0.613 0.709 1e-171
294463610517 unknown [Picea sitchensis] 0.764 0.808 0.490 1e-105
79461446479 F-box protein SKIP17 [Arabidopsis thalia 0.714 0.816 0.445 3e-80
>gi|255559418|ref|XP_002520729.1| conserved hypothetical protein [Ricinus communis] gi|223540114|gb|EEF41691.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/520 (75%), Positives = 442/520 (85%), Gaps = 13/520 (2%)

Query: 28  TSMAKRLCSSSTSQNPNITAKLNPSMDNLLETLLNLADSPPSLSIDVSFERLLDSAPGDE 87
           TSMAKR C  + +      A  N  +D LL+T L+LADSP SLSID+S E LL+S+P D 
Sbjct: 9   TSMAKRPCPFTAATASTAVAMNNHQVDGLLQTFLDLADSP-SLSIDLSLEHLLESSPCDS 67

Query: 88  DQSHLIDRAIKVSSLLLESAKRSARKRASHHNFLAWPLPPDLTIKVFSMLDTQSLCHAAA 147
           DQS LIDRA+K+ S+LLE+  RS+RKR+S HN L W LPPDLTIKVFSMLDTQSLC+AAA
Sbjct: 68  DQSVLIDRALKLGSILLEAGNRSSRKRSSKHNSLTWVLPPDLTIKVFSMLDTQSLCYAAA 127

Query: 148 TCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWS 207
           TCSMF+K AMDPLCYANIDL TVVPKVNNAVVSTMI RAGKSLQSLKLGIVPGPT+SP S
Sbjct: 128 TCSMFHKCAMDPLCYANIDLTTVVPKVNNAVVSTMIQRAGKSLQSLKLGIVPGPTSSPGS 187

Query: 208 CQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNI 267
           C++LVY+IRNSVDVS+ SWNDK+TRQGKES ILTRSCL  L+G+SGAAG+LL+RLHLYNI
Sbjct: 188 CETLVYSIRNSVDVSNISWNDKRTRQGKESSILTRSCLYSLTGDSGAAGTLLKRLHLYNI 247

Query: 268 ERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSL 327
           ERMDN SL  ALSACPSLLDLEIVGLHVELRQTL+SVSM+CPL+ERLFFESSKTGRD+SL
Sbjct: 248 ERMDNTSLYGALSACPSLLDLEIVGLHVELRQTLVSVSMNCPLIERLFFESSKTGRDESL 307

Query: 328 KSPTCVDFVNNCPNLTSMALRGFKLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLG 387
           KSPTCVD V NCPNLTS+ALRGFKL D K+RIL+KGFRKLKYVDFSTSYSITG FLRNLG
Sbjct: 308 KSPTCVDLVTNCPNLTSLALRGFKLHDCKVRILVKGFRKLKYVDFSTSYSITGHFLRNLG 367

Query: 388 SGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLASEGDWYDRC 447
             +GGNLL            EVEVAR LTAVLTGDFK LRHLD+SNREGLASE DWY RC
Sbjct: 368 GSSGGNLL------------EVEVARLLTAVLTGDFKSLRHLDVSNREGLASESDWYHRC 415

Query: 448 FNSRIIPLKEVSEERPDICVLAEFPSEGSFIDIEQMVDSEFNSEISLPSQLSSRTSDDSL 507
           ++ R IP+K+V E RPD+C+LA+FP +GSFID+EQM+DSE NSE+SLPSQLSS TSD SL
Sbjct: 416 YSLRTIPVKQVLEARPDMCLLADFPPDGSFIDVEQMIDSELNSEVSLPSQLSSHTSDSSL 475

Query: 508 LMSCSESSYNSDHGSGNEEGQDSGYVIFEESSDEVDFLAI 547
            MS SESSYNSD  SGNEE +DS Y+++EESSDEVDFL +
Sbjct: 476 FMSTSESSYNSDQSSGNEESRDSAYIVYEESSDEVDFLGV 515

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296085205|emb|CBI28700.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147783780|emb|CAN61447.1| hypothetical protein VITISV_024140 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224062475|ref|XP_002300839.1| f-box family protein [Populus trichocarpa] gi|222842565|gb|EEE80112.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449458488|ref|XP_004146979.1| PREDICTED: F-box protein SKIP17-like [Cucumis sativus] gi|449491486|ref|XP_004158913.1| PREDICTED: F-box protein SKIP17-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359479687|ref|XP_002272905.2| PREDICTED: F-box protein SKIP17 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356572196|ref|XP_003554256.1| PREDICTED: F-box protein SKIP17-like [Glycine max] Back     alignment and taxonomy information
>gi|224085473|ref|XP_002307587.1| predicted protein [Populus trichocarpa] gi|222857036|gb|EEE94583.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|294463610|gb|ADE77333.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|79461446|ref|NP_192183.2| F-box protein SKIP17 [Arabidopsis thaliana] gi|122223794|sp|Q0WRC9.1|SKI17_ARATH RecName: Full=F-box protein SKIP17; AltName: Full=SKP1-interacting partner 17 gi|110736714|dbj|BAF00320.1| hypothetical protein [Arabidopsis thaliana] gi|332656823|gb|AEE82223.1| F-box protein SKIP17 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
TAIR|locus:1009023375301 AT4G02733 "AT4G02733" [Arabido 0.502 0.913 0.405 7.9e-46
TAIR|locus:2140225479 AT4G02740 [Arabidopsis thalian 0.630 0.720 0.361 1.6e-45
WB|WBGene00015350466 C02F5.7 [Caenorhabditis elegan 0.129 0.152 0.380 1.6e-07
UNIPROTKB|Q0VD31621 FBXL4 "F-box/LRR-repeat protei 0.188 0.165 0.284 7.6e-05
UNIPROTKB|A6H779423 FBXL2 "F-box/LRR-repeat protei 0.557 0.721 0.217 0.00015
UNIPROTKB|D2ST34621 FBXL4 "F-box and leucine-rich 0.188 0.165 0.284 0.00043
MGI|MGI:1919444436 Fbxl20 "F-box and leucine-rich 0.568 0.713 0.195 0.00071
MGI|MGI:2442569161 Fbxo48 "F-box protein 48" [Mus 0.100 0.341 0.428 0.00085
UNIPROTKB|E2R1T6621 FBXL4 "Uncharacterized protein 0.188 0.165 0.266 0.00089
UNIPROTKB|Q58DG6436 FBXL20 "F-box/LRR-repeat prote 0.568 0.713 0.195 0.00091
TAIR|locus:1009023375 AT4G02733 "AT4G02733" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 481 (174.4 bits), Expect = 7.9e-46, P = 7.9e-46
 Identities = 120/296 (40%), Positives = 180/296 (60%)

Query:    39 TSQNPNITAKLNPSM-------DNLLETLLNLADSPPSLSIDVSFERLLDS--APGDED- 88
             +++NPN ++ L+ S+       D+++ +L+   DSP SLSI  SF+R+LD   + GD   
Sbjct:     3 STENPN-SSPLSDSLEFNERHLDSIISSLVTFPDSP-SLSISSSFDRVLDHLLSSGDVSV 60

Query:    89 QSHLIDRAIKVSSLLLESAKRSARKRASHHNFLAWPLPPDLTIKVFSMLDTQSLCHAAAT 148
             Q  L+DR ++  SLLL+S KR ++KRA+ HN ++W LP +LT+KVFSM+DT+SL  A+A 
Sbjct:    61 QDQLVDRTLERFSLLLQSTKRCSQKRATLHNSISWFLPSELTVKVFSMVDTKSLMQASAC 120

Query:   149 CSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTAS-PWS 207
             C+MFN  AMDPLCY +IDL      V++ V+ T+++R+GK L+SLKLG V  P      S
Sbjct:   121 CTMFNNCAMDPLCYFHIDLTKAFKHVDDRVLRTLLNRSGKQLRSLKLGRVDAPGCLFRSS 180

Query:   208 CQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNI 267
             C   +    N+   +     D     G  S + TRSC +PL       G+LL  LH+Y++
Sbjct:   181 CLPPLILYGNNARRALKLGRDPP---GLGS-LFTRSCFDPLK----LTGNLLTSLHIYSL 232

Query:   268 ERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGR 323
               M+  S    LSAC +L DL+IVG++V L   L  ++ +C L+E LF ++   G+
Sbjct:   233 GFMNMNSFLDPLSACSNLTDLKIVGVNVLLEPILELLARNCCLIEHLFLDNCSQGK 288
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2140225 AT4G02740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00015350 C02F5.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VD31 FBXL4 "F-box/LRR-repeat protein 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D2ST34 FBXL4 "F-box and leucine-rich repeat protein 4" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2442569 Fbxo48 "F-box protein 48" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1T6 FBXL4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
pfam1293747 pfam12937, F-box-like, F-box-like 1e-06
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information 
 Score = 44.8 bits (107), Expect = 1e-06
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 125 LPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLR 168
           LP ++ +++FS LD + L   A  C  + + A D   +  + LR
Sbjct: 4   LPDEILLQIFSYLDPRDLLRLALVCRRWRELASDDSLWRRLCLR 47

This is an F-box-like family. Length = 47

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 547
KOG4341483 consensus F-box protein containing LRR [General fu 100.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.94
KOG4341483 consensus F-box protein containing LRR [General fu 99.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.42
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.39
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.37
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.24
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.17
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.14
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.75
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.72
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.67
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.67
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.66
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.52
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.38
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.37
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.31
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.99
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.9
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.73
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.73
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.65
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.63
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.51
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.45
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.32
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.29
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.28
KOG2997366 consensus F-box protein FBX9 [General function pre 97.26
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.99
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.95
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.88
KOG4308478 consensus LRR-containing protein [Function unknown 96.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.77
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.76
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.69
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.31
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.29
PLN03150623 hypothetical protein; Provisional 96.26
PLN03150623 hypothetical protein; Provisional 96.24
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.1
KOG4237498 consensus Extracellular matrix protein slit, conta 96.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.84
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.75
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.51
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.49
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 95.48
KOG0472 565 consensus Leucine-rich repeat protein [Function un 95.35
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.26
KOG4308478 consensus LRR-containing protein [Function unknown 95.23
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 95.21
PRK15386 426 type III secretion protein GogB; Provisional 94.92
KOG0617264 consensus Ras suppressor protein (contains leucine 94.87
KOG0617264 consensus Ras suppressor protein (contains leucine 94.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 94.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 94.29
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 94.05
PRK15386 426 type III secretion protein GogB; Provisional 93.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.84
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.76
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.73
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 92.82
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 92.12
KOG0472565 consensus Leucine-rich repeat protein [Function un 90.95
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.61
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 88.43
KOG4237498 consensus Extracellular matrix protein slit, conta 87.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 87.8
PF13013109 F-box-like_2: F-box-like domain 87.7
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 87.5
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 84.77
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 83.2
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 80.88
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 80.73
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1e-44  Score=358.43  Aligned_cols=394  Identities=29%  Similarity=0.408  Sum_probs=321.9

Q ss_pred             ChhHHHHHHHHhhcCCCCCCccccchhhhhhccC-----CCCcchhhHHHHHHHHhhhHHHHhhhhhhhhhccCCCCCCC
Q 042559           50 NPSMDNLLETLLNLADSPPSLSIDVSFERLLDSA-----PGDEDQSHLIDRAIKVSSLLLESAKRSARKRASHHNFLAWP  124 (547)
Q Consensus        50 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~-----~~~~~~~~~~~~~~~~~~~l~e~~~~~~~~~~~~~~~~~~~  124 (547)
                      +.++|-++.+|..++|+- .++++.|++|.++.+     +++.+|+...++...+.+.|.   +|    |+..++...+.
T Consensus         3 ~sh~dl~iss~~s~sdss-~~S~~~S~dr~l~~~~~~~~~~e~~q~~~~~rtl~~a~~l~---~r----ra~~~~~~~~~   74 (483)
T KOG4341|consen    3 ESHVDLAISSFLSVSDSS-PLSIGASSDRVLDSAQADSSSDELDQDREGDRTLSLASLLG---TR----RAADNNSISRS   74 (483)
T ss_pred             ccccccccccceecccCC-CccccCccccccchhhcccccCcccchhhcChhhhcccchh---hh----hhhhccccccc
Confidence            457899999999999966 999999999999864     566778888888888877776   22    55667777899


Q ss_pred             CChHhHHHhccCCCHHHHHHHHHHhHHHHHHhcCCCCccccccccccccchHHHHHHHHHHhcCCccEEEecccCCCCCC
Q 042559          125 LPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTAS  204 (547)
Q Consensus       125 LP~elL~~IFs~L~~~dl~~~a~VCk~W~~l~~d~~lw~~vdL~~~~~~~~~~~l~~l~~r~~~~L~~L~L~~~~~~~~~  204 (547)
                      ||+|++.+||++|+.+.++++|+||+.|+.+|+|...|+++|+++++.++++.+++.+++|++.++|.|.+++|....+ 
T Consensus        75 LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r~v~~-  153 (483)
T KOG4341|consen   75 LPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCRAVGD-  153 (483)
T ss_pred             CCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccccccCCc-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999998866554 


Q ss_pred             CccchhHHHHHhcCcccceeecCCCcccCCchhHHHHhhCCCCCccCcCcCCCCccEEEEeCCCCCCHHHHHHHHhcCCC
Q 042559          205 PWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPS  284 (547)
Q Consensus       205 ~~~c~~l~~~~~~c~~l~~Lsl~~~~~~~~~~~~~l~~~c~~~l~~~~~~~~~~L~~L~L~~c~~lt~~~L~~l~~~~~~  284 (547)
                          ..+.....+|+++++|.++++...++.....++++|+            +|++|+|..|..+|+..++.++..|++
T Consensus       154 ----sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~------------~l~~l~L~~c~~iT~~~Lk~la~gC~k  217 (483)
T KOG4341|consen  154 ----SSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCR------------KLRHLNLHSCSSITDVSLKYLAEGCRK  217 (483)
T ss_pred             ----chhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcc------------hhhhhhhcccchhHHHHHHHHHHhhhh
Confidence                2455677899999999888877777777788999999            699999999999999999999999999


Q ss_pred             ccEEEEecCCCCCHHHHHHHHhcCCCccEEEecCCCCCC--------------------------CCcC-----------
Q 042559          285 LLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGR--------------------------DDSL-----------  327 (547)
Q Consensus       285 L~~L~Ls~c~~i~~~~l~~l~~~~~~L~~L~L~~c~~l~--------------------------~~~l-----------  327 (547)
                      |++|+++||+.++..+++.+.++|..++.+.+.||....                          |..+           
T Consensus       218 L~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq  297 (483)
T KOG4341|consen  218 LKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQ  297 (483)
T ss_pred             HHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhh
Confidence            999999999999998888888888777777666654333                          3221           


Q ss_pred             ----------CCcchHHHhcCCCCcceEEeecc-CCCHHHHHHHHhcCCCCcEEeccCCCCCCHHHHHHHHc-CCCCCCc
Q 042559          328 ----------KSPTCVDFVNNCPNLTSMALRGF-KLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGS-GTGGNLL  395 (547)
Q Consensus       328 ----------~~~~l~~~~~~~~~L~~L~L~~~-~ltd~~l~~l~~~~~~L~~L~Ls~c~~lt~~~l~~L~~-~~~l~~L  395 (547)
                                ....+.++..+|++|+.|.+.+| +++|.++..++.+|+.|+.+++.+|..+++..+..++. |+   .|
T Consensus       298 ~l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~---~l  374 (483)
T KOG4341|consen  298 VLCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCP---RL  374 (483)
T ss_pred             hhcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCCc---hh
Confidence                      01123445566666777777766 56666666677777777777777776666666666665 44   48


Q ss_pred             cEEeeeCCCCCCHHHHHHHHHHhhcCCCCCccEEeeeCCCCCcc-chhhhccCCCCCcc-----------chhhhhhcCC
Q 042559          396 EVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLAS-EGDWYDRCFNSRII-----------PLKEVSEERP  463 (547)
Q Consensus       396 ~~L~Ls~C~~L~~~~l~~~l~~~l~~~~~~L~~L~Ls~c~~l~~-~~~~l~~c~~L~~l-----------~l~~l~~~~~  463 (547)
                      ++|.|+.|..++|+++..+-..  ......|+.|.+++|+.+++ ..+++..|++|+++           +++....++|
T Consensus       375 r~lslshce~itD~gi~~l~~~--~c~~~~l~~lEL~n~p~i~d~~Le~l~~c~~Leri~l~~~q~vtk~~i~~~~~~lp  452 (483)
T KOG4341|consen  375 RVLSLSHCELITDEGIRHLSSS--SCSLEGLEVLELDNCPLITDATLEHLSICRNLERIELIDCQDVTKEAISRFATHLP  452 (483)
T ss_pred             ccCChhhhhhhhhhhhhhhhhc--cccccccceeeecCCCCchHHHHHHHhhCcccceeeeechhhhhhhhhHHHHhhCc
Confidence            8999999999999988554332  23567899999999999999 77889999999987           5567788999


Q ss_pred             CcEEEeecCC
Q 042559          464 DICVLAEFPS  473 (547)
Q Consensus       464 ~l~~~~~~p~  473 (547)
                      ++++.++|.+
T Consensus       453 ~i~v~a~~a~  462 (483)
T KOG4341|consen  453 NIKVHAYFAP  462 (483)
T ss_pred             cceehhhccC
Confidence            9999999855

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-05
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 2e-06
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 2e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score = 70.3 bits (172), Expect = 2e-13
 Identities = 49/311 (15%), Positives = 101/311 (32%), Gaps = 43/311 (13%)

Query: 125 LPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIH 184
           LP +L + +FS L    L   +  C  + + A D   +  +DL     K  +  V+  + 
Sbjct: 12  LPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLT---GKNLHPDVTGRLL 68

Query: 185 RAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSC 244
             G          +  P A  +S   + +   ++  +   +              +   C
Sbjct: 69  SQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTL-----------HGILSQC 117

Query: 245 LNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSV 304
                         L+ L L  + R+ +  ++  L+   +L+ L + G        L ++
Sbjct: 118 SK------------LQNLSLEGL-RLSDPIVN-TLAKNSNLVRLNLSGCSGFSEFALQTL 163

Query: 305 SMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCPNLTSMALRG--FKLPDYKIRILLK 362
             SC  L+ L         +  ++    V   +    +T + L G    L    +  L++
Sbjct: 164 LSSCSRLDELNLSWCFDFTEKHVQ----VAVAHVSETITQLNLSGYRKNLQKSDLSTLVR 219

Query: 363 GFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGD 422
               L ++D S S  +     +          L+ L L  C  +    +         G+
Sbjct: 220 RCPNLVHLDLSDSVMLKNDCFQEFFQLNY---LQHLSLSRCYDIIPETLLEL------GE 270

Query: 423 FKFLRHLDISN 433
              L+ L +  
Sbjct: 271 IPTLKTLQVFG 281
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.95
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.69
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.58
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.36
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.29
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.22
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.19
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.1
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.05
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.03
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.02
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.99
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.99
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.99
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.95
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.95
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.95
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.84
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.83
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.83
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.82
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.81
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.81
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.77
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.73
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.73
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.72
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.71
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.7
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.7
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.64
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.64
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.61
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.55
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.47
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.4
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.38
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.34
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.32
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.25
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.21
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.18
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.16
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.03
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.02
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.98
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.96
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.94
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.9
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.87
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.84
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.71
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.34
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.92
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.84
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.83
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.76
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.72
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.51
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 95.49
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 95.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.25
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.98
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 89.33
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 84.99
4gt6_A394 Cell surface protein; leucine rich repeats, putati 84.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 83.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 82.08
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.95  E-value=7.3e-28  Score=245.82  Aligned_cols=273  Identities=16%  Similarity=0.219  Sum_probs=183.9

Q ss_pred             CCCCCCChHhHHHhccCCCHHHHHHHHHHhHHHHHHhcCCCCccccccccccccchHHHHHHHHHHhcCCccEEEecccC
Q 042559          120 FLAWPLPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDPLCYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVP  199 (547)
Q Consensus       120 ~~~~~LP~elL~~IFs~L~~~dl~~~a~VCk~W~~l~~d~~lw~~vdL~~~~~~~~~~~l~~l~~r~~~~L~~L~L~~~~  199 (547)
                      ..|..||+|++.+||+||+.+|++++++|||+|+.++.++..|+++++...  .+.+..+..+   ....++.|++++..
T Consensus         7 ~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~--~~~~~~~~~~---~~~~l~~L~l~~n~   81 (336)
T 2ast_B            7 VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGK--NLHPDVTGRL---LSQGVIAFRCPRSF   81 (336)
T ss_dssp             CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTC--BCCHHHHHHH---HHTTCSEEECTTCE
T ss_pred             CChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccc--cCCHHHHHhh---hhccceEEEcCCcc
Confidence            458999999999999999999999999999999999999999999998764  3334444333   23578899887432


Q ss_pred             CCCCCCccchhHHHHHhcCcccceeecCCCcccCCchhHHHHhhCCCCCccCcCcCCCCccEEEEeCCCCCCHHHHHHHH
Q 042559          200 GPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFILTRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMAL  279 (547)
Q Consensus       200 ~~~~~~~~c~~l~~~~~~c~~l~~Lsl~~~~~~~~~~~~~l~~~c~~~l~~~~~~~~~~L~~L~L~~c~~lt~~~L~~l~  279 (547)
                      -....+.        +..+.+++.|.+.+.. ..+.........|+            +|++|+|++| .+++.....+ 
T Consensus        82 l~~~~~~--------~~~~~~L~~L~L~~~~-l~~~~~~~~~~~~~------------~L~~L~L~~~-~l~~~~~~~l-  138 (336)
T 2ast_B           82 MDQPLAE--------HFSPFRVQHMDLSNSV-IEVSTLHGILSQCS------------KLQNLSLEGL-RLSDPIVNTL-  138 (336)
T ss_dssp             ECSCCCS--------CCCCBCCCEEECTTCE-ECHHHHHHHHTTBC------------CCSEEECTTC-BCCHHHHHHH-
T ss_pred             ccccchh--------hccCCCCCEEEccCCC-cCHHHHHHHHhhCC------------CCCEEeCcCc-ccCHHHHHHH-
Confidence            1111100        2235666666665432 11111122334444            6777887777 4565544444 


Q ss_pred             hcCCCccEEEEecCCCCCHHHHHHHHhcCCCccEEEecCCCCCCCCcCCCcchHHHhcCCC-CcceEEeecc--CCCHHH
Q 042559          280 SACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSKTGRDDSLKSPTCVDFVNNCP-NLTSMALRGF--KLPDYK  356 (547)
Q Consensus       280 ~~~~~L~~L~Ls~c~~i~~~~l~~l~~~~~~L~~L~L~~c~~l~~~~l~~~~l~~~~~~~~-~L~~L~L~~~--~ltd~~  356 (547)
                      ..+++|++|+|++|..+++.++..+..++++|++|++++|..+++..+.     ..+..++ +|++|++++|  .+++..
T Consensus       139 ~~~~~L~~L~L~~~~~l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~-----~~~~~l~~~L~~L~l~~~~~~~~~~~  213 (336)
T 2ast_B          139 AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQ-----VAVAHVSETITQLNLSGYRKNLQKSD  213 (336)
T ss_dssp             TTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHH-----HHHHHSCTTCCEEECCSCGGGSCHHH
T ss_pred             hcCCCCCEEECCCCCCCCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHH-----HHHHhcccCCCEEEeCCCcccCCHHH
Confidence            4477788888877767777777776677777888887777445443322     4566677 7888888777  677777


Q ss_pred             HHHHHhcCCCCcEEeccCCCCCCHHHHHHHHcCCCCCCccEEeeeCCCCCCHHHHHHHHHHhhcCCCCCccEEeeeCC
Q 042559          357 IRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVLILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNR  434 (547)
Q Consensus       357 l~~l~~~~~~L~~L~Ls~c~~lt~~~l~~L~~~~~l~~L~~L~Ls~C~~L~~~~l~~~l~~~l~~~~~~L~~L~Ls~c  434 (547)
                      +..+...+++|++|+|++|..+++..+..++.+++   |++|+|++|..+++.++..      .+.+++|++|+|++|
T Consensus       214 l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~l~~---L~~L~l~~~~~~~~~~~~~------l~~~~~L~~L~l~~~  282 (336)
T 2ast_B          214 LSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNY---LQHLSLSRCYDIIPETLLE------LGEIPTLKTLQVFGI  282 (336)
T ss_dssp             HHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTT---CCEEECTTCTTCCGGGGGG------GGGCTTCCEEECTTS
T ss_pred             HHHHHhhCCCCCEEeCCCCCcCCHHHHHHHhCCCC---CCEeeCCCCCCCCHHHHHH------HhcCCCCCEEeccCc
Confidence            76666667778888887774477776666666654   7778887777666665411      124777788887777
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 547
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 2e-05
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 7e-05
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 2e-04
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.6 bits (93), Expect = 2e-05
 Identities = 10/35 (28%), Positives = 16/35 (45%)

Query: 125 LPPDLTIKVFSMLDTQSLCHAAATCSMFNKFAMDP 159
           LP +L + +FS L    L   +  C  + + A D 
Sbjct: 4   LPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDE 38
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.86
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.8
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.33
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.3
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.17
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.93
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.81
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.78
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.69
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.56
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.51
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.51
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.49
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.46
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.42
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.33
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.2
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.18
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.14
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.98
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.86
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.86
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.82
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 95.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.19
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=1.1e-21  Score=193.75  Aligned_cols=247  Identities=13%  Similarity=0.179  Sum_probs=180.2

Q ss_pred             CccccccccccccchHHHHHHHHHHhcCCccEEEecccCCCCCCCccchhHHHHHhcCcccceeecCCCcccCCchhHHH
Q 042559          161 CYANIDLRTVVPKVNNAVVSTMIHRAGKSLQSLKLGIVPGPTASPWSCQSLVYTIRNSVDVSSFSWNDKKTRQGKESFIL  240 (547)
Q Consensus       161 lw~~vdL~~~~~~~~~~~l~~l~~r~~~~L~~L~L~~~~~~~~~~~~c~~l~~~~~~c~~l~~Lsl~~~~~~~~~~~~~l  240 (547)
                      +|+++|+...  .+.+.++..++.+.   +..+.+...... .....       .....+++.|++.+.. ..+.....+
T Consensus         1 LW~~lDLs~~--~l~~~~l~~l~~~~---~~~lrl~~~~~~-~~~~~-------~~~~~~L~~LdLs~~~-i~~~~l~~l   66 (284)
T d2astb2           1 LWQTLDLTGK--NLHPDVTGRLLSQG---VIAFRCPRSFMD-QPLAE-------HFSPFRVQHMDLSNSV-IEVSTLHGI   66 (284)
T ss_dssp             TSSEEECTTC--BCCHHHHHHHHHTT---CSEEECTTCEEC-SCCCS-------CCCCBCCCEEECTTCE-ECHHHHHHH
T ss_pred             CcCEEECCCC--CCCchHHHHHHhcc---ceEeeccccccc-cchhh-------hccCCCCCEEECCCCc-cCHHHHHHH
Confidence            6999999753  45566776665542   334444321100 00000       1123566777665432 122223346


Q ss_pred             HhhCCCCCccCcCcCCCCccEEEEeCCCCCCHHHHHHHHhcCCCccEEEEecCCCCCHHHHHHHHhcCCCccEEEecCCC
Q 042559          241 TRSCLNPLSGESGAAGSLLRRLHLYNIERMDNASLSMALSACPSLLDLEIVGLHVELRQTLMSVSMSCPLLERLFFESSK  320 (547)
Q Consensus       241 ~~~c~~~l~~~~~~~~~~L~~L~L~~c~~lt~~~L~~l~~~~~~L~~L~Ls~c~~i~~~~l~~l~~~~~~L~~L~L~~c~  320 (547)
                      ...|+            +|++|+|.+| .+++..+..++ .+++|++|++++|..+++.++..++.+|++|++|++++|.
T Consensus        67 ~~~c~------------~L~~L~L~~~-~l~~~~~~~l~-~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~  132 (284)
T d2astb2          67 LSQCS------------KLQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCF  132 (284)
T ss_dssp             HTTBC------------CCSEEECTTC-BCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCT
T ss_pred             HHhCC------------Cccccccccc-CCCcHHHHHHh-cCCCCcCccccccccccccccchhhHHHHhcccccccccc
Confidence            67787            7999999999 67888777664 5899999999999999999999999999999999999998


Q ss_pred             CCCCCcCCCcchHHHhcCCCCcceEEeecc--CCCHHHHHHHHhcCCCCcEEeccCCCCCCHHHHHHHHcCCCCCCccEE
Q 042559          321 TGRDDSLKSPTCVDFVNNCPNLTSMALRGF--KLPDYKIRILLKGFRKLKYVDFSTSYSITGAFLRNLGSGTGGNLLEVL  398 (547)
Q Consensus       321 ~l~~~~l~~~~l~~~~~~~~~L~~L~L~~~--~ltd~~l~~l~~~~~~L~~L~Ls~c~~lt~~~l~~L~~~~~l~~L~~L  398 (547)
                      .+++..+..    .+...+++|++|++.++  .+++.++..++.+||+|++|++++|..+++.++..++.+++   |++|
T Consensus       133 ~~~~~~~~~----~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~---L~~L  205 (284)
T d2astb2         133 DFTEKHVQV----AVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNY---LQHL  205 (284)
T ss_dssp             TCCHHHHHH----HHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTT---CCEE
T ss_pred             ccccccchh----hhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCc---CCEE
Confidence            777665432    34556789999999986  68999999999999999999999998999999988888776   9999


Q ss_pred             eeeCCCCCCHHHHHHHHHHhhcCCCCCccEEeeeCCCCCcc-chhhh-ccCCCC
Q 042559          399 ILRDCMHLKEVEVARFLTAVLTGDFKFLRHLDISNREGLAS-EGDWY-DRCFNS  450 (547)
Q Consensus       399 ~Ls~C~~L~~~~l~~~l~~~l~~~~~~L~~L~Ls~c~~l~~-~~~~l-~~c~~L  450 (547)
                      +|++|.++++.++..+      +++++|+.|++++|  +++ ....+ ..||+|
T Consensus       206 ~L~~C~~i~~~~l~~L------~~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L  251 (284)
T d2astb2         206 SLSRCYDIIPETLLEL------GEIPTLKTLQVFGI--VPDGTLQLLKEALPHL  251 (284)
T ss_dssp             ECTTCTTCCGGGGGGG------GGCTTCCEEECTTS--SCTTCHHHHHHHSTTS
T ss_pred             ECCCCCCCChHHHHHH------hcCCCCCEEeeeCC--CCHHHHHHHHHhCccc
Confidence            9999999998877332      36899999999998  344 33333 456665
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure