Citrus Sinensis ID: 042815
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| 357519199 | 515 | Pentatricopeptide repeat protein [Medica | 0.770 | 0.130 | 0.550 | 9e-12 | |
| 296088887 | 575 | unnamed protein product [Vitis vinifera] | 0.540 | 0.081 | 0.638 | 2e-10 | |
| 357466867 | 629 | Pentatricopeptide repeat protein [Medica | 0.770 | 0.106 | 0.536 | 2e-10 | |
| 356544269 | 522 | PREDICTED: pentatricopeptide repeat-cont | 0.701 | 0.116 | 0.557 | 5e-10 | |
| 296085643 | 848 | unnamed protein product [Vitis vinifera] | 0.528 | 0.054 | 0.630 | 7e-10 | |
| 255580411 | 392 | pentatricopeptide repeat-containing prot | 0.574 | 0.127 | 0.6 | 5e-09 | |
| 356498888 | 552 | PREDICTED: putative pentatricopeptide re | 0.597 | 0.094 | 0.461 | 3e-05 | |
| 125555946 | 530 | hypothetical protein OsI_23585 [Oryza sa | 0.574 | 0.094 | 0.46 | 3e-05 | |
| 115468780 | 530 | Os06g0597500 [Oryza sativa Japonica Grou | 0.574 | 0.094 | 0.46 | 3e-05 | |
| 218198170 | 563 | hypothetical protein OsI_22944 [Oryza sa | 0.724 | 0.111 | 0.375 | 4e-05 |
| >gi|357519199|ref|XP_003629888.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355523910|gb|AET04364.1| Pentatricopeptide repeat protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 74.3 bits (181), Expect = 9e-12, Method: Composition-based stats.
Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 2/69 (2%)
Query: 2 MPPRDATTSSAMMLGLAKNGKNGMGVELFMSIEKRGPRPNAVTFVGVLTAYGKIKIFGVT 61
MP +D T SAM+LGLA NG N M +ELF +EK GP+PN VTFVGVLTA +FG +
Sbjct: 283 MPVKDVATWSAMILGLAINGNNKMALELFEKMEKVGPKPNEVTFVGVLTACNHKSLFGES 342
Query: 62 --LMGIQPQ 68
L GI +
Sbjct: 343 ARLFGIMSE 351
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296088887|emb|CBI38431.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357466867|ref|XP_003603718.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355492766|gb|AES73969.1| Pentatricopeptide repeat protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356544269|ref|XP_003540576.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296085643|emb|CBI29442.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255580411|ref|XP_002531032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529385|gb|EEF31349.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356498888|ref|XP_003518279.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|125555946|gb|EAZ01552.1| hypothetical protein OsI_23585 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|115468780|ref|NP_001057989.1| Os06g0597500 [Oryza sativa Japonica Group] gi|50725579|dbj|BAD33047.1| PPR-repeat protein-like [Oryza sativa Japonica Group] gi|113596029|dbj|BAF19903.1| Os06g0597500 [Oryza sativa Japonica Group] gi|125597760|gb|EAZ37540.1| hypothetical protein OsJ_21869 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|218198170|gb|EEC80597.1| hypothetical protein OsI_22944 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| TAIR|locus:2045580 | 559 | AT2G42920 [Arabidopsis thalian | 0.563 | 0.087 | 0.408 | 6.9e-05 | |
| TAIR|locus:2054131 | 697 | SLO2 "AT2G13600" [Arabidopsis | 0.597 | 0.074 | 0.384 | 0.00015 | |
| TAIR|locus:2206164 | 570 | AT1G31430 [Arabidopsis thalian | 0.540 | 0.082 | 0.425 | 0.00019 | |
| TAIR|locus:2049562 | 584 | AT2G01510 "AT2G01510" [Arabido | 0.574 | 0.085 | 0.42 | 0.0002 | |
| TAIR|locus:2056794 | 630 | REME1 "required for efficiency | 0.574 | 0.079 | 0.44 | 0.00022 | |
| TAIR|locus:2195980 | 467 | AT1G77170 "AT1G77170" [Arabido | 0.574 | 0.107 | 0.42 | 0.00024 | |
| TAIR|locus:2090444 | 820 | AT3G22150 "AT3G22150" [Arabido | 0.540 | 0.057 | 0.382 | 0.00038 |
| TAIR|locus:2045580 AT2G42920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 105 (42.0 bits), Expect = 6.9e-05, P = 6.9e-05
Identities = 20/49 (40%), Positives = 33/49 (67%)
Query: 3 PPRDATTSSAMMLGLAKNGKNGMGVELFMSIEKRGPRPNAVTFVGVLTA 51
P + + ++M+LGLA NG ++LF +E+ G P++V+F+GVLTA
Sbjct: 320 PKKQLSCWNSMILGLANNGFEERAMDLFSELERSGLEPDSVSFIGVLTA 368
|
|
| TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2206164 AT1G31430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2049562 AT2G01510 "AT2G01510" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056794 REME1 "required for efficiency of mitochondrial editing 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195980 AT1G77170 "AT1G77170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090444 AT3G22150 "AT3G22150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 87 | |||
| PLN03077 | 857 | PLN03077, PLN03077, Protein ECB2; Provisional | 6e-05 | |
| PLN03081 | 697 | PLN03081, PLN03081, pentatricopeptide (PPR) repeat | 8e-05 | |
| pfam13041 | 50 | pfam13041, PPR_2, PPR repeat family | 2e-04 |
| >gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional | Back alignment and domain information |
|---|
Score = 39.1 bits (91), Expect = 6e-05
Identities = 16/50 (32%), Positives = 28/50 (56%)
Query: 5 RDATTSSAMMLGLAKNGKNGMGVELFMSIEKRGPRPNAVTFVGVLTAYGK 54
+D + + ++ G +GK M VELF + + G P+ VTF+ +L A +
Sbjct: 552 KDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSR 601
|
Length = 857 |
| >gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| PF13041 | 50 | PPR_2: PPR repeat family | 99.88 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.86 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.82 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.82 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.81 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.76 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.76 | |
| PF12854 | 34 | PPR_1: PPR repeat | 99.49 | |
| PF13041 | 50 | PPR_2: PPR repeat family | 99.48 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 99.45 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 99.31 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 99.25 | |
| PF12854 | 34 | PPR_1: PPR repeat | 99.19 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 98.89 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 98.5 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 98.47 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 98.42 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 98.2 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 97.97 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 97.92 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 97.81 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 97.81 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 97.64 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 97.61 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.54 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 97.42 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.42 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 97.09 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.97 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.92 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 96.64 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 96.55 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 96.42 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.39 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.02 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 95.88 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 95.75 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.56 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 95.53 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 95.52 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 95.27 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.04 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 94.69 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 94.65 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 94.54 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.31 | |
| PF11663 | 140 | Toxin_YhaV: Toxin with endonuclease activity YhaV; | 94.19 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 94.18 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 93.99 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 93.64 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 93.53 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 93.52 | |
| PRK10564 | 303 | maltose regulon periplasmic protein; Provisional | 93.29 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 93.19 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 93.09 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 92.94 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 92.88 | |
| PF14689 | 62 | SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do | 92.82 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 92.58 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 92.56 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 92.51 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 92.35 | |
| cd00923 | 103 | Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. | 92.32 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 92.16 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 91.83 | |
| PF02284 | 108 | COX5A: Cytochrome c oxidase subunit Va; InterPro: | 91.81 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 91.42 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 91.39 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 90.9 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 90.87 | |
| PF13762 | 145 | MNE1: Mitochondrial splicing apparatus component | 90.79 | |
| PF10366 | 108 | Vps39_1: Vacuolar sorting protein 39 domain 1; Int | 90.76 | |
| PF02607 | 79 | B12-binding_2: B12 binding domain; InterPro: IPR00 | 90.53 | |
| PF11848 | 48 | DUF3368: Domain of unknown function (DUF3368); Int | 90.47 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 90.28 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 90.23 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 90.02 | |
| KOG4570 | 418 | consensus Uncharacterized conserved protein [Funct | 89.91 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 89.85 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 89.79 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 89.64 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 89.48 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 88.89 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 88.87 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 88.71 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 88.33 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 88.17 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 88.15 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 87.99 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 87.52 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 87.5 | |
| PF09205 | 161 | DUF1955: Domain of unknown function (DUF1955); Int | 87.3 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 87.24 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 87.16 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 87.04 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 86.74 | |
| PF07443 | 55 | HARP: HepA-related protein (HARP); InterPro: IPR01 | 86.67 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 86.47 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 85.92 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 85.8 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 85.67 | |
| PF13170 | 297 | DUF4003: Protein of unknown function (DUF4003) | 85.67 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 85.15 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 85.03 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 84.89 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 84.76 | |
| cd07153 | 116 | Fur_like Ferric uptake regulator(Fur) and related | 84.51 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 84.37 | |
| PF02847 | 113 | MA3: MA3 domain; InterPro: IPR003891 This entry re | 83.94 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 83.88 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 83.82 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 83.66 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 83.56 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 83.38 | |
| COG4003 | 98 | Uncharacterized protein conserved in archaea [Func | 83.17 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 83.07 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 82.99 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 82.83 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 82.83 | |
| KOG4077 | 149 | consensus Cytochrome c oxidase, subunit Va/COX6 [E | 82.72 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 80.95 | |
| PF01475 | 120 | FUR: Ferric uptake regulator family; InterPro: IPR | 80.86 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 80.38 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 80.23 |
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
Probab=99.88 E-value=1.1e-22 Score=97.26 Aligned_cols=50 Identities=28% Similarity=0.482 Sum_probs=49.1
Q ss_pred CcHhHHHHHHHHHHhcCCchhHHHHHHHHHHcCCCCCHhhHHHHHHHHcc
Q 042815 5 RDATTSSAMMLGLAKNGKNGMGVELFMSIEKRGPRPNAVTFVGVLTAYGK 54 (87)
Q Consensus 5 ~~~~~~~~li~~~~~~g~~~~a~~l~~~m~~~g~~pd~~t~~~ll~~~~~ 54 (87)
||+++||+||.+|++.|++++|.++|++|.+.|+.||..||+++|++||+
T Consensus 1 P~~~~yn~li~~~~~~~~~~~a~~l~~~M~~~g~~P~~~Ty~~li~~~~k 50 (50)
T PF13041_consen 1 PDVVTYNTLISGYCKAGKFEEALKLFKEMKKRGIKPDSYTYNILINGLCK 50 (50)
T ss_pred CchHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHcC
Confidence 89999999999999999999999999999999999999999999999986
|
|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10564 maltose regulon periplasmic protein; Provisional | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF13762 MNE1: Mitochondrial splicing apparatus component | Back alignment and domain information |
|---|
| >PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF02607 B12-binding_2: B12 binding domain; InterPro: IPR003759 Cobalamin-dependent methionine synthase (2 | Back alignment and domain information |
|---|
| >PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG4570 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF07443 HARP: HepA-related protein (HARP); InterPro: IPR010003 This entry represents a conserved region approximately 60 residues long within eukaryotic HepA-related protein (HARP) | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF13170 DUF4003: Protein of unknown function (DUF4003) | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4003 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.87 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.86 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.83 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.8 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.61 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.36 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.27 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.19 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.1 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.06 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.05 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.02 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 96.91 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 96.84 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 96.78 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.62 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.58 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.5 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 96.47 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.39 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.36 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 96.29 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.29 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.29 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.28 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.26 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.25 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 96.22 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.15 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 96.15 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.13 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 96.13 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.12 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.01 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.99 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.97 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 95.97 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.96 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 95.93 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 95.9 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.86 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 95.85 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.83 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.82 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 95.82 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.77 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 95.77 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 95.76 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 95.73 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 95.71 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.71 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 95.7 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.69 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.67 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.65 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.62 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.59 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.58 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 95.5 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.47 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.43 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 95.42 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 95.42 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 95.42 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.38 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.37 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 95.36 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 95.32 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 95.28 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 95.24 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.22 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 95.07 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 95.05 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 94.99 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 94.95 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 94.95 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 94.86 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 94.78 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 94.69 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.56 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 94.55 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 94.51 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 94.48 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 94.27 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 94.23 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 94.22 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 94.2 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.12 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 94.05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 93.89 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 93.82 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 93.82 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 93.78 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 93.7 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 93.69 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 93.68 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 93.45 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 93.45 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 93.29 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 93.24 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 93.22 | |
| 1v54_E | 109 | Cytochrome C oxidase polypeptide VA; oxidoreductas | 93.18 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 93.13 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 93.12 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 93.03 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 92.79 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 92.77 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 92.7 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 92.7 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 92.41 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 92.36 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 92.32 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 92.2 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 92.12 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 92.01 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 91.99 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 91.97 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 91.89 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 91.85 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 91.81 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 91.77 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 91.46 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 91.15 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 91.13 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 90.87 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 90.63 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 90.58 | |
| 2y69_E | 152 | Cytochrome C oxidase subunit 5A; electron transpor | 90.53 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 90.52 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 90.38 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 90.34 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 90.01 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 89.99 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 89.71 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 89.52 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 89.43 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 88.94 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 88.81 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 88.75 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 88.68 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 88.33 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 88.29 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 87.69 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 87.56 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 87.51 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 87.44 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 87.24 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 86.97 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 86.89 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 86.88 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 86.83 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 86.71 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 86.67 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 86.54 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 86.33 | |
| 2b7e_A | 59 | PRE-mRNA processing protein PRP40; structural prot | 86.25 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 86.2 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 86.15 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 86.13 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 85.49 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 85.07 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 84.95 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 84.7 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 84.67 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 83.79 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 83.75 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 83.65 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 83.27 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 82.59 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 81.65 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 81.08 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 80.61 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 80.31 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 80.23 |
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.87 E-value=2.6e-22 Score=139.14 Aligned_cols=80 Identities=18% Similarity=0.174 Sum_probs=75.4
Q ss_pred CCcHhHHHHHHHHHHhcCCchhHHHHHHHHHHcCCCCCHhhHHHHHHHHcccchh-HH--HHHHhchhcccccccchhhh
Q 042815 4 PRDATTSSAMMLGLAKNGKNGMGVELFMSIEKRGPRPNAVTFVGVLTAYGKIKIF-GV--TLMGIQPQNLWYYIDGQIDA 80 (87)
Q Consensus 4 ~~~~~~~~~li~~~~~~g~~~~a~~l~~~m~~~g~~pd~~t~~~ll~~~~~~~~~-~~--~~~~~m~~~~~~g~~~~~~~ 80 (87)
.||++|||+||.|||+.|++++|.++|++|.+.|+.||.+||+++|.++|+.|.. +. ++|+.|..+ |+.||..+
T Consensus 162 ~PdvvTYNtLI~Glck~G~~~eA~~Lf~eM~~~G~~PDvvTYntLI~glcK~G~~~e~A~~Ll~EM~~k---G~~PD~vt 238 (1134)
T 3spa_A 162 LLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQE---GLKLQALF 238 (1134)
T ss_dssp TCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHH---TCCSHHHH
T ss_pred CCCHhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCcHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHc---CCCCChhh
Confidence 5899999999999999999999999999999999999999999999999999985 44 899999998 99999999
Q ss_pred hhcccc
Q 042815 81 WQAACQ 86 (87)
Q Consensus 81 ~~~~~~ 86 (87)
|++++.
T Consensus 239 Y~~ll~ 244 (1134)
T 3spa_A 239 TAVLLS 244 (1134)
T ss_dssp HHSCCC
T ss_pred cccccC
Confidence 998763
|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2b7e_A PRE-mRNA processing protein PRP40; structural protein; NMR {Saccharomyces cerevisiae} SCOP: a.159.2.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.24 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 95.68 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.51 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.43 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.4 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 95.09 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 94.77 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 94.69 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 94.3 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 94.28 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 94.16 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 94.09 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.01 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 93.99 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 93.95 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 93.48 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 93.1 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 92.68 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 92.59 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 92.57 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 92.4 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 92.12 | |
| d1v54e_ | 105 | Cytochrome c oxidase subunit E {Cow (Bos taurus) [ | 91.83 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 91.22 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 90.84 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 89.89 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 89.51 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 88.54 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 88.47 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 88.14 | |
| d1wy6a1 | 161 | Hypothetical protein ST1625 {Archaeon Sulfolobus t | 87.91 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 87.74 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 86.91 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 83.96 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 82.66 | |
| d1peqa1 | 162 | R1 subunit of ribonucleotide reductase, N-terminal | 81.19 | |
| d1u9pa1 | 36 | Arc repressor {Salmonella bacteriophage P22 [TaxId | 80.19 |
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: BTAD-like domain: Probable regulatory protein EmbR, middle domain species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=97.24 E-value=0.0011 Score=36.70 Aligned_cols=72 Identities=10% Similarity=-0.100 Sum_probs=58.0
Q ss_pred hHHHHHHHHHHhcCCchhHHHHHHHHHHcCCCCCHhhHHHHHHHHcccchhHH--HHHHhchhc--ccccccchhhh
Q 042815 8 TTSSAMMLGLAKNGKNGMGVELFMSIEKRGPRPNAVTFVGVLTAYGKIKIFGV--TLMGIQPQN--LWYYIDGQIDA 80 (87)
Q Consensus 8 ~~~~~li~~~~~~g~~~~a~~l~~~m~~~g~~pd~~t~~~ll~~~~~~~~~~~--~~~~~m~~~--~~~g~~~~~~~ 80 (87)
..|..+...+.+.|++++|+..+++..... .-|...|..++.++...|+..+ ..|++.... ...|++|+..+
T Consensus 68 ~a~~~la~~~~~~g~~~~Al~~~~~al~~~-P~~e~~~~~l~~al~~~Gr~~eAl~~y~~~~~~L~~eLG~~P~~~l 143 (179)
T d2ff4a2 68 LAHTAKAEAEIACGRASAVIAELEALTFEH-PYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTL 143 (179)
T ss_dssp HHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHSCCCCHHH
T ss_pred HHHHHHHHHHHHCCCchHHHHHHHHHHHhC-CccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhCCCcCHHH
Confidence 467889999999999999999999998764 2378899999999999999998 777775332 11488887654
|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1peqa1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1u9pa1 a.43.1.1 (A:72-107) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]} | Back information, alignment and structure |
|---|