Citrus Sinensis ID: 042872


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNNQANDNDNSREYIDILDDSPEPKRRPTLMELDSLSDTEDLDFTIPKQKDAILNLSSCPDGRSQIFTPSSVKHSSKSVDCKSGVSTSSASSVSNKKRSSLISDNEHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV
cccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEcccccccccccHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHccccHHccHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEccccc
cccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHccccccccHHHHHHHHHcccHHHHHccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHccccEEEEEccccccccHEcccEEEEcccEEEEEcHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccccEEEEEEcHHHHHccHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHEEEEEccccc
MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLygddgqdfisvehCGDDFIATLAETMQDSEEWDDLQAMESEACGALNNmfdkrvidnnqandndnsreyidilddspepkrrptlmeldslsdtedldftipkQKDAILnlsscpdgrsqiftpssvkhssksvdcksgvstssassvsnkkrsslisdnehgtlsfeelqalddmefANVVIFgnrafrplqhQACKAsvakqdcfvllptgggkslcyqDQIITLNlkfgipatflnsqQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCasrkdkpsckllyvtperivgnqSFSEVLKCLHrkgsirlkvlttdvvvlphtcqrqlagfvvdeahcv
MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNnqandndnsreyidilddspepkrrptlmeldslsdtedlDFTIPKQKDAILNLSSCPDGRSQIFtpssvkhssksvdcksgvstssassvsnkkrsslisdnehgtLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLyvtperivgnqsFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCqrqlagfvvdeAHCV
MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNNQANDNDNSREYIDILDDSPEPKRRPTlmeldslsdtedldFTIPKQKDAILNLSSCPDGRSQIFTPSSVKHSSKSVDCksgvstssassvsnkkrsslisDNEHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV
*****FEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETM****************CGALNNMFD*******************************************************************************************************************FEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDE****
*********KARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDL*A**********************************************************DL**************************************************************************ALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQ*************ASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV
MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNNQANDNDNSREYIDILDDSPEPKRRPTLMELDSLSDTEDLDFTIPKQKDAILNLSSCPDGRSQIF**********************************ISDNEHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV
****DFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGALNNMFDK*******************************************************************************************************************EELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNNQANDNDNSREYIDILDDSPEPKRRPTLMELDSLSDTEDLDFTIPKQKDAILNLSSCPDGRSQIFTPSSVKHSSKSVDCKSGVSTSSASSVSNKKRSSLISDNEHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query381 2.2.26 [Sep-21-2011]
Q9FT74 606 ATP-dependent DNA helicas yes no 0.805 0.506 0.490 6e-97
O88700 1416 Bloom syndrome protein ho yes no 0.307 0.082 0.329 3e-15
Q8L840 1188 ATP-dependent DNA helicas no no 0.356 0.114 0.308 1e-14
P54132 1417 Bloom syndrome protein OS yes no 0.307 0.082 0.324 2e-14
Q9FT70 1150 ATP-dependent DNA helicas no no 0.330 0.109 0.303 6e-14
Q9DEY9 1364 Bloom syndrome protein ho N/A no 0.304 0.085 0.322 7e-14
Q9VGI8 1487 Bloom syndrome protein ho yes no 0.519 0.133 0.278 5e-13
Q9FT72 713 ATP-dependent DNA helicas no no 0.304 0.162 0.296 8e-13
Q9I920 1142 Bloom syndrome protein ho yes no 0.307 0.102 0.307 9e-12
O18017 988 Bloom syndrome protein ho yes no 0.354 0.136 0.323 2e-11
>sp|Q9FT74|RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana GN=RECQL1 PE=2 SV=1 Back     alignment and function desciption
 Score =  354 bits (909), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 203/414 (49%), Positives = 250/414 (60%), Gaps = 107/414 (25%)

Query: 1   MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLA 60
           M   D E EK RL+SLA + GFD+DSA K L+R + LYGDDG+DFI+VE CGDDF+A LA
Sbjct: 1   MKDQDLELEKVRLISLATKLGFDEDSAKKCLDRFVDLYGDDGRDFITVELCGDDFLAALA 60

Query: 61  ETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNNQANDNDN----------SREYIDIL 110
           +  + +EEWDD+QA+ESEA G L  MFDK        N +DN          SR  + ++
Sbjct: 61  DFEEGTEEWDDIQAIESEAQGNLAEMFDK------STNPSDNGFDTDDDDDDSRVEVHVI 114

Query: 111 DDSPEPKRRPTLMELDSLSDTEDLD--FTIPKQKDAILNLSSCPDGRSQIFTPSSVKHSS 168
           +DSPEPK++P ++ELDS SD ED++  F +P+              RSQ          S
Sbjct: 115 EDSPEPKKKPEIVELDSSSDLEDVETRFKVPR--------------RSQT--------CS 152

Query: 169 KSVDCKSGVSTSSASSVSNKKRSSLISDNEHGTLSFEELQALDDMEFANVVIFGNRAFRP 228
           +S+D        S S++S +K S  IS+ +H T S+EELQALDD+EFAN+VIFGN+ FRP
Sbjct: 153 RSMDYSM---EDSVSTISGRKPSVQISNKDHETPSYEELQALDDLEFANLVIFGNKVFRP 209

Query: 229 LQHQACKASVAKQDCFVLLPTGGGKSLCY---------------------QDQIITLNLK 267
           LQHQAC+AS+ ++DCFVL+PTGGGKSLCY                     QDQI+ LNLK
Sbjct: 210 LQHQACRASMERKDCFVLMPTGGGKSLCYQLPATLKAGVTIVISPLLSLIQDQIVALNLK 269

Query: 268 FGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVT 327
           FGIPATFLNSQQT SQAAAVLQEL                       R+D PSCKLLYVT
Sbjct: 270 FGIPATFLNSQQTSSQAAAVLQEL-----------------------RRDNPSCKLLYVT 306

Query: 328 PERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV 381
           PE+I G+ SF E L+CL RKG                     LAGFVVDEAHCV
Sbjct: 307 PEKIAGSSSFLETLRCLDRKG--------------------LLAGFVVDEAHCV 340




3'-5' DNA helicase that may play a role in the repair of DNA.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 Back     alignment and function description
>sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 Back     alignment and function description
>sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 Back     alignment and function description
>sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 Back     alignment and function description
>sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 Back     alignment and function description
>sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=mus309 PE=1 SV=1 Back     alignment and function description
>sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 Back     alignment and function description
>sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
147783250 1640 hypothetical protein VITISV_005845 [Viti 0.887 0.206 0.562 1e-113
118489987 617 unknown [Populus trichocarpa x Populus d 0.850 0.525 0.571 1e-111
224123710 588 predicted protein [Populus trichocarpa] 0.776 0.503 0.540 1e-104
296089753 591 unnamed protein product [Vitis vinifera] 0.797 0.514 0.529 1e-102
255542856 586 DNA helicase hus2, putative [Ricinus com 0.808 0.525 0.536 1e-102
357441847 603 Bloom syndrome protein-like protein [Med 0.790 0.499 0.508 1e-99
225450636 602 PREDICTED: ATP-dependent DNA helicase Q- 0.826 0.523 0.534 1e-98
356533550 612 PREDICTED: LOW QUALITY PROTEIN: ATP-depe 0.808 0.503 0.513 1e-95
30679600 606 ATP-dependent DNA helicase Q-like 1 [Ara 0.805 0.506 0.490 4e-95
449454038 601 PREDICTED: ATP-dependent DNA helicase Q- 0.816 0.517 0.483 3e-93
>gi|147783250|emb|CAN73069.1| hypothetical protein VITISV_005845 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 226/402 (56%), Positives = 267/402 (66%), Gaps = 64/402 (15%)

Query: 1   MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLA 60
           MD HD E EKARLLSLAL+FGFD++SA K L+RL+ LYGDDGQDFI+VEHCGDDF+A L 
Sbjct: 95  MDGHDLEMEKARLLSLALDFGFDEESAMKCLDRLVHLYGDDGQDFITVEHCGDDFLAALV 154

Query: 61  ETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNNQANDNDNSREYIDILDDSPEPKRRP 120
           E+++DSE+WDDLQA+E+EACG LN+MFD  V+    ++       YI+  + S EP++  
Sbjct: 155 ESVEDSEDWDDLQAIETEACGTLNDMFDNDVLHGYGSDYGIYREGYINATEYSYEPQKHQ 214

Query: 121 TLMELDSLSDTEDLDFTIPKQKDAILNLSSCPDGRSQIFTPSSVKHSSKSVDCKSGVSTS 180
             ++LDS SD+ED  F I  +K A     S PDG S  FT SS+KH+S+SVD K  V   
Sbjct: 215 NFVQLDSSSDSEDSSFRILDKKGAAPTSPSWPDGSSSAFTQSSIKHASRSVDSKISVIQG 274

Query: 181 SASSVSNKKRSSLISDNEHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAK 240
           S SS+SNK+  S +S++E+GTLS+E L  LDD E ANVVIFGNR FRPLQHQACKASV K
Sbjct: 275 SVSSISNKRARSQMSEDENGTLSYEALLDLDDFELANVVIFGNRTFRPLQHQACKASVTK 334

Query: 241 QDCFVLLPTGGGKSLCY---------------------QDQIITLNLKFGIPATFLNSQQ 279
           +DCFVL+PTGGGKSLCY                     QDQIITLNL FGIPATFL+SQQ
Sbjct: 335 RDCFVLMPTGGGKSLCYQLPATLQPGVTVVVCPLLSLIQDQIITLNLNFGIPATFLSSQQ 394

Query: 280 TVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSE 339
           T SQAAAVL+EL                       RKDKPSCKLLYVTPERI GN +F E
Sbjct: 395 TASQAAAVLKEL-----------------------RKDKPSCKLLYVTPERIAGNSTFFE 431

Query: 340 VLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV 381
           +LK LH KG                    QLAGFVVDEAHCV
Sbjct: 432 ILKSLHWKG--------------------QLAGFVVDEAHCV 453




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118489987|gb|ABK96790.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224123710|ref|XP_002330189.1| predicted protein [Populus trichocarpa] gi|222871645|gb|EEF08776.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296089753|emb|CBI39572.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542856|ref|XP_002512491.1| DNA helicase hus2, putative [Ricinus communis] gi|223548452|gb|EEF49943.1| DNA helicase hus2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357441847|ref|XP_003591201.1| Bloom syndrome protein-like protein [Medicago truncatula] gi|355480249|gb|AES61452.1| Bloom syndrome protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225450636|ref|XP_002282715.1| PREDICTED: ATP-dependent DNA helicase Q-like 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356533550|ref|XP_003535326.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase Q-like 1-like [Glycine max] Back     alignment and taxonomy information
>gi|30679600|ref|NP_187225.2| ATP-dependent DNA helicase Q-like 1 [Arabidopsis thaliana] gi|75334309|sp|Q9FT74.1|RQL1_ARATH RecName: Full=ATP-dependent DNA helicase Q-like 1; AltName: Full=RecQ-like protein 1; Short=AtRecQ1; Short=AtRecQl1 gi|10944747|emb|CAC14163.1| DNA Helicase [Arabidopsis thaliana] gi|332640767|gb|AEE74288.1| ATP-dependent DNA helicase Q-like 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449454038|ref|XP_004144763.1| PREDICTED: ATP-dependent DNA helicase Q-like 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
TAIR|locus:2074429 606 RECQI1 "RECQ helicase l1" [Ara 0.829 0.521 0.346 3.2e-42
DICTYBASE|DDB_G0272384 973 DDB_G0272384 "Bloom syndrome-l 0.393 0.154 0.323 1.6e-09
TAIR|locus:2197394 1188 RECQ4A [Arabidopsis thaliana ( 0.338 0.108 0.328 5.2e-09
UNIPROTKB|F1RMJ3541 BLM "Uncharacterized protein" 0.322 0.227 0.312 8.9e-09
DICTYBASE|DDB_G0292130 1259 blm "Bloom syndrome protein" [ 0.383 0.115 0.337 9.2e-09
FB|FBgn0002906 1487 Blm "Bloom syndrome helicase o 0.328 0.084 0.348 3.2e-08
TAIR|locus:2127998 713 RecQl3 "AT4G35740" [Arabidopsi 0.328 0.175 0.348 3.4e-08
RGD|1311071 621 Recql "RecQ protein-like (DNA 0.367 0.225 0.313 7.7e-08
UNIPROTKB|Q6AYJ1 621 Recql "ATP-dependent DNA helic 0.367 0.225 0.313 7.7e-08
RGD|1308810 999 Blm "Bloom syndrome, RecQ heli 0.099 0.038 0.578 1.3e-07
TAIR|locus:2074429 RECQI1 "RECQ helicase l1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 404 (147.3 bits), Expect = 3.2e-42, Sum P(2) = 3.2e-42
 Identities = 116/335 (34%), Positives = 162/335 (48%)

Query:    23 DQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGA 82
             DQD   + + RLISL    G D  S + C D F+    +   D  ++  ++    +   A
Sbjct:     3 DQDLELEKV-RLISLATKLGFDEDSAKKCLDRFVDLYGD---DGRDFITVELCGDDFLAA 58

Query:    83 LNNMFD-KRVIDNNQANDNDNSREYIDILDDSPEPKRRPTXXXXXXXXXXXXXXFTI--- 138
             L +  +     D+ QA +++      ++ D S  P                         
Sbjct:    59 LADFEEGTEEWDDIQAIESEAQGNLAEMFDKSTNPSDNGFDTDDDDDDSRVEVHVIEDSP 118

Query:   139 -PKQKDAILNLSSCPDGRSQIFTPSSVKHSSKSVDCXXXXXXXXXXXXXXXXXXXXXXDN 197
              PK+K  I+ L S  D    + T   V   S++                          N
Sbjct:   119 EPKKKPEIVELDSSSD-LEDVETRFKVPRRSQTCSRSMDYSMEDSVSTISGRKPSVQISN 177

Query:   198 -EHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLC 256
              +H T S+EELQALDD+EFAN+VIFGN+ FRPLQHQAC+AS+ ++DCFVL+PTGGGKSLC
Sbjct:   178 KDHETPSYEELQALDDLEFANLVIFGNKVFRPLQHQACRASMERKDCFVLMPTGGGKSLC 237

Query:   257 YQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGL---VLSQHYFLHQLIFVLTCA 313
             YQ   +   LK G+    ++   ++ Q   V   L+ G+    L+      Q   VL   
Sbjct:   238 YQ---LPATLKAGVTIV-ISPLLSLIQDQIVALNLKFGIPATFLNSQQTSSQAAAVLQ-E 292

Query:   314 SRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKG 348
              R+D PSCKLLYVTPE+I G+ SF E L+CL RKG
Sbjct:   293 LRRDNPSCKLLYVTPEKIAGSSSFLETLRCLDRKG 327


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006310 "DNA recombination" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0042631 "cellular response to water deprivation" evidence=IEP
GO:0070417 "cellular response to cold" evidence=IEP
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
DICTYBASE|DDB_G0272384 DDB_G0272384 "Bloom syndrome-like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2197394 RECQ4A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMJ3 BLM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292130 blm "Bloom syndrome protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0002906 Blm "Bloom syndrome helicase ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2127998 RecQl3 "AT4G35740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1311071 Recql "RecQ protein-like (DNA helicase Q1-like)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AYJ1 Recql "ATP-dependent DNA helicase Q1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1308810 Blm "Bloom syndrome, RecQ helicase-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
TIGR00614 470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 5e-22
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 5e-21
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 4e-17
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 2e-16
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 2e-16
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 9e-06
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 0.001
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
 Score = 96.8 bits (241), Expect = 5e-22
 Identities = 58/182 (31%), Positives = 76/182 (41%), Gaps = 70/182 (38%)

Query: 221 FGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ---------------------D 259
           FG  +FRP+Q +   A +  +DCFV++PTGGGKSLCYQ                     D
Sbjct: 7   FGLSSFRPVQLEVINAVLLGRDCFVVMPTGGGKSLCYQLPALCSDGITLVISPLISLMED 66

Query: 260 QIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKP 319
           Q++ L    GIPATFLNS Q+  Q   VL +L+ G +                       
Sbjct: 67  QVLQLKA-SGIPATFLNSSQSKEQQKNVLTDLKDGKI----------------------- 102

Query: 320 SCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAH 379
             KLLYVTPE+   +    + L+   RKG                          VDEAH
Sbjct: 103 --KLLYVTPEKCSASNRLLQTLE--ERKGITL---------------------IAVDEAH 137

Query: 380 CV 381
           C+
Sbjct: 138 CI 139


All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 470

>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 381
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.89
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.89
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.88
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.86
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.86
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.86
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 99.84
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.83
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.82
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.81
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.8
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.79
PTZ00110 545 helicase; Provisional 99.79
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.79
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.78
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.78
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.77
KOG0340 442 consensus ATP-dependent RNA helicase [RNA processi 99.77
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 99.75
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.75
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.75
PTZ00424 401 helicase 45; Provisional 99.74
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 99.72
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 99.69
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.68
PRK14701 1638 reverse gyrase; Provisional 99.65
KOG0347 731 consensus RNA helicase [RNA processing and modific 99.65
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.64
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.62
PRK13767 876 ATP-dependent helicase; Provisional 99.62
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 99.61
KOG0333 673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.61
PRK02362 737 ski2-like helicase; Provisional 99.61
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.59
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 99.59
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 99.57
PRK00254 720 ski2-like helicase; Provisional 99.57
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 99.57
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.56
KOG0335 482 consensus ATP-dependent RNA helicase [RNA processi 99.56
KOG0346 569 consensus RNA helicase [RNA processing and modific 99.55
PRK09401 1176 reverse gyrase; Reviewed 99.55
KOG0350 620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.54
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.52
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.51
PRK01172 674 ski2-like helicase; Provisional 99.51
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.49
COG1205 851 Distinct helicase family with a unique C-terminal 99.47
KOG0328 400 consensus Predicted ATP-dependent RNA helicase FAL 99.46
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.46
KOG0341 610 consensus DEAD-box protein abstrakt [RNA processin 99.46
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.44
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.44
KOG4284 980 consensus DEAD box protein [Transcription] 99.43
PRK10689 1147 transcription-repair coupling factor; Provisional 99.42
KOG0326 459 consensus ATP-dependent RNA helicase [RNA processi 99.4
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.4
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 99.36
KOG0329 387 consensus ATP-dependent RNA helicase [RNA processi 99.3
PRK05580 679 primosome assembly protein PriA; Validated 99.26
COG1204 766 Superfamily II helicase [General function predicti 99.21
KOG0327 397 consensus Translation initiation factor 4F, helica 99.21
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.16
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.15
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.15
PHA02558 501 uvsW UvsW helicase; Provisional 99.14
smart00487201 DEXDc DEAD-like helicases superfamily. 99.14
PRK13766 773 Hef nuclease; Provisional 99.12
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.08
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.08
KOG0344 593 consensus ATP-dependent RNA helicase [RNA processi 99.01
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.98
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 98.95
KOG0354 746 consensus DEAD-box like helicase [General function 98.94
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 98.94
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 98.88
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.88
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.86
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.86
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.82
COG1202 830 Superfamily II helicase, archaea-specific [General 98.8
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.77
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.73
KOG0332 477 consensus ATP-dependent RNA helicase [RNA processi 98.72
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.67
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.66
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 98.63
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.56
PHA02653 675 RNA helicase NPH-II; Provisional 98.51
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 98.44
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.44
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.42
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.39
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.37
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.36
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.36
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.31
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.21
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 98.15
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.09
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 98.08
COG1198 730 PriA Primosomal protein N' (replication factor Y) 98.06
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.03
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.93
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 97.9
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.82
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.8
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 97.75
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.75
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 97.74
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 97.72
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.67
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 97.66
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 97.64
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 97.63
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 97.63
PRK09694 878 helicase Cas3; Provisional 97.62
COG4096 875 HsdR Type I site-specific restriction-modification 97.6
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.59
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.55
KOG1123 776 consensus RNA polymerase II transcription initiati 97.53
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 97.53
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 97.43
PRK04914 956 ATP-dependent helicase HepA; Validated 97.41
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 97.25
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.21
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 97.03
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 97.0
PRK15483 986 type III restriction-modification system StyLTI en 96.75
PRK14873 665 primosome assembly protein PriA; Provisional 96.75
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.72
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 96.65
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 96.63
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.62
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 96.56
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 96.42
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.33
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.27
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 96.26
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.23
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.15
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 96.01
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.98
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 95.95
COG4889 1518 Predicted helicase [General function prediction on 95.89
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 95.88
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 95.84
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.81
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.79
KOG0389 941 consensus SNF2 family DNA-dependent ATPase [Chroma 95.73
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.73
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 95.63
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.5
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 95.46
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 95.42
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.42
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.39
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.36
PRK10867 433 signal recognition particle protein; Provisional 95.34
TIGR00767 415 rho transcription termination factor Rho. Members 95.34
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 95.31
TIGR00959 428 ffh signal recognition particle protein. This mode 95.27
PRK00411 394 cdc6 cell division control protein 6; Reviewed 95.24
PRK14974336 cell division protein FtsY; Provisional 95.22
TIGR00064272 ftsY signal recognition particle-docking protein F 95.13
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.08
PTZ00112 1164 origin recognition complex 1 protein; Provisional 95.04
PRK06526254 transposase; Provisional 95.03
PRK10416318 signal recognition particle-docking protein FtsY; 95.03
PRK08727233 hypothetical protein; Validated 95.03
PRK00771 437 signal recognition particle protein Srp54; Provisi 95.02
smart00382148 AAA ATPases associated with a variety of cellular 94.96
PF00004132 AAA: ATPase family associated with various cellula 94.88
PRK04296190 thymidine kinase; Provisional 94.72
PRK10875 615 recD exonuclease V subunit alpha; Provisional 94.72
PRK08181269 transposase; Validated 94.71
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.69
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.65
COG0552340 FtsY Signal recognition particle GTPase [Intracell 94.64
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.62
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.6
PRK07952244 DNA replication protein DnaC; Validated 94.56
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.55
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 94.39
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 94.26
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.1
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 94.06
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 93.97
PRK13889 988 conjugal transfer relaxase TraA; Provisional 93.86
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.81
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.64
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 93.59
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.25
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 93.04
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 92.96
PRK08084235 DNA replication initiation factor; Provisional 92.93
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 92.9
PRK12377248 putative replication protein; Provisional 92.81
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 92.79
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 92.78
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 92.63
PRK06921266 hypothetical protein; Provisional 92.59
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.48
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 92.46
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 92.29
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 92.21
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 92.16
PRK06067234 flagellar accessory protein FlaH; Validated 92.16
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 92.11
PRK06893229 DNA replication initiation factor; Validated 91.96
TIGR00665434 DnaB replicative DNA helicase. This model describe 91.93
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 91.91
PRK10865 857 protein disaggregation chaperone; Provisional 91.82
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 91.74
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 91.69
cd01394218 radB RadB. The archaeal protein radB shares simila 91.33
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 91.32
PRK06835329 DNA replication protein DnaC; Validated 91.29
TIGR02688449 conserved hypothetical protein TIGR02688. Members 91.25
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 91.23
PRK09376 416 rho transcription termination factor Rho; Provisio 91.12
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 91.11
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 90.99
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 90.95
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 90.8
PRK12608 380 transcription termination factor Rho; Provisional 90.77
PF1324576 AAA_19: Part of AAA domain 90.76
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 90.73
KOG1805 1100 consensus DNA replication helicase [Replication, r 90.7
PF12846 304 AAA_10: AAA-like domain 90.65
PRK13826 1102 Dtr system oriT relaxase; Provisional 90.64
PRK00149 450 dnaA chromosomal replication initiation protein; R 90.61
PHA02244 383 ATPase-like protein 90.59
TIGR00376 637 DNA helicase, putative. The gene product may repre 90.59
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.56
PRK09361225 radB DNA repair and recombination protein RadB; Pr 90.54
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 90.54
PRK13833323 conjugal transfer protein TrbB; Provisional 90.27
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 90.15
PRK05973237 replicative DNA helicase; Provisional 90.13
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 90.0
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 89.97
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 89.94
COG0610 962 Type I site-specific restriction-modification syst 89.89
TIGR02533 486 type_II_gspE general secretory pathway protein E. 89.85
cd01393226 recA_like RecA is a bacterial enzyme which has rol 89.85
PRK04195 482 replication factor C large subunit; Provisional 89.79
cd00983 325 recA RecA is a bacterial enzyme which has roles in 89.79
PRK08939306 primosomal protein DnaI; Reviewed 89.78
CHL00095 821 clpC Clp protease ATP binding subunit 89.77
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 89.75
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 89.64
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 89.62
cd03115173 SRP The signal recognition particle (SRP) mediates 89.53
KOG4439 901 consensus RNA polymerase II transcription terminat 89.48
PRK10536262 hypothetical protein; Provisional 89.47
cd01128249 rho_factor Transcription termination factor rho is 89.38
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 89.38
PRK10436 462 hypothetical protein; Provisional 89.33
CHL00176 638 ftsH cell division protein; Validated 89.28
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 89.26
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 89.25
PRK08760 476 replicative DNA helicase; Provisional 89.24
PRK09354 349 recA recombinase A; Provisional 89.19
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 89.08
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 89.04
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 89.0
PRK08116268 hypothetical protein; Validated 88.99
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 88.97
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 88.89
PRK13894319 conjugal transfer ATPase TrbB; Provisional 88.86
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 88.72
PRK11823 446 DNA repair protein RadA; Provisional 88.7
CHL00181287 cbbX CbbX; Provisional 88.69
PHA02542 473 41 41 helicase; Provisional 88.67
PRK14087 450 dnaA chromosomal replication initiation protein; P 88.65
PRK09183259 transposase/IS protein; Provisional 88.55
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 88.44
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 88.42
PRK08533230 flagellar accessory protein FlaH; Reviewed 88.38
KOG0390 776 consensus DNA repair protein, SNF2 family [Replica 88.26
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 88.21
PRK09165 497 replicative DNA helicase; Provisional 88.14
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 88.07
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 88.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 87.97
KOG1803 649 consensus DNA helicase [Replication, recombination 87.94
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 87.93
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 87.87
KOG1131 755 consensus RNA polymerase II transcription initiati 87.85
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 87.79
PRK04328249 hypothetical protein; Provisional 87.66
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 87.66
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 87.63
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 87.63
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 87.59
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 87.45
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 87.43
PRK05595 444 replicative DNA helicase; Provisional 87.39
PLN03025 319 replication factor C subunit; Provisional 87.29
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 87.23
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 87.21
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 87.01
PRK03992389 proteasome-activating nucleotidase; Provisional 87.0
PRK08903227 DnaA regulatory inactivator Hda; Validated 86.96
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 86.96
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 86.93
PRK00440 319 rfc replication factor C small subunit; Reviewed 86.89
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 86.75
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 86.73
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 86.73
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 86.7
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 86.66
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 86.57
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 86.54
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 86.53
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 86.34
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 86.32
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 86.23
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 86.2
PRK05642234 DNA replication initiation factor; Validated 86.14
PRK13342 413 recombination factor protein RarA; Reviewed 86.13
PRK07004 460 replicative DNA helicase; Provisional 85.98
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 85.89
KOG1000 689 consensus Chromatin remodeling protein HARP/SMARCA 85.88
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 85.8
PRK08769 319 DNA polymerase III subunit delta'; Validated 85.78
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.77
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 85.73
PRK06321 472 replicative DNA helicase; Provisional 85.41
PRK05636505 replicative DNA helicase; Provisional 85.21
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 85.08
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 84.86
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 84.8
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 84.79
PHA02544 316 44 clamp loader, small subunit; Provisional 84.65
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 84.6
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 84.4
PRK09302509 circadian clock protein KaiC; Reviewed 84.31
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 84.24
PRK07773 886 replicative DNA helicase; Validated 84.15
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 84.05
PRK08506 472 replicative DNA helicase; Provisional 84.03
PRK05748 448 replicative DNA helicase; Provisional 83.95
PRK14088 440 dnaA chromosomal replication initiation protein; P 83.78
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 83.71
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 83.71
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 83.64
PF05872 502 DUF853: Bacterial protein of unknown function (DUF 83.61
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 83.53
PRK13851344 type IV secretion system protein VirB11; Provision 83.31
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 83.27
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 83.16
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 83.12
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 83.1
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 83.08
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 82.95
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 82.27
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 82.13
PRK12422 445 chromosomal replication initiation protein; Provis 82.12
PF00154 322 RecA: recA bacterial DNA recombination protein; In 82.08
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 82.08
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 82.0
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 81.81
KOG0346 569 consensus RNA helicase [RNA processing and modific 81.53
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 81.52
PF13173128 AAA_14: AAA domain 81.48
PHA00350 399 putative assembly protein 81.42
PRK13850 670 type IV secretion system protein VirD4; Provisiona 81.39
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 81.21
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 81.2
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 81.15
KOG0387 923 consensus Transcription-coupled repair protein CSB 81.11
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 80.86
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 80.82
PRK05707 328 DNA polymerase III subunit delta'; Validated 80.63
PRK09302 509 circadian clock protein KaiC; Reviewed 80.59
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 80.48
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 80.31
PRK13341 725 recombination factor protein RarA/unknown domain f 80.21
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
Probab=99.89  E-value=1.5e-23  Score=220.52  Aligned_cols=117  Identities=42%  Similarity=0.723  Sum_probs=107.7

Q ss_pred             HHHHHHHhCCCCCcHHHHHHHHHHHcCCCEEEECCCCCCchhhHH---------------------HHHHHHHhhcCCcE
Q 042872          214 EFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ---------------------DQIITLNLKFGIPA  272 (381)
Q Consensus       214 ~~~~~~~fG~~~fRpiQ~eAI~aiL~GrDvLviaPTGsGKTLaF~---------------------dQv~~L~~~~gI~a  272 (381)
                      ...+..+|||..|||.|+++|..+++|+|+|++||||+|||+|||                     ||+.+|. ..||+|
T Consensus         6 ~~~L~~~fGy~~FR~gQ~evI~~~l~g~d~lvvmPTGgGKSlCyQiPAll~~G~TLVVSPLiSLM~DQV~~l~-~~Gi~A   84 (590)
T COG0514           6 QQVLKQVFGYASFRPGQQEIIDALLSGKDTLVVMPTGGGKSLCYQIPALLLEGLTLVVSPLISLMKDQVDQLE-AAGIRA   84 (590)
T ss_pred             HHHHHHHhCccccCCCHHHHHHHHHcCCcEEEEccCCCCcchHhhhHHHhcCCCEEEECchHHHHHHHHHHHH-HcCcee
Confidence            355778899999999999999999999999999999999999999                     9999998 689999


Q ss_pred             EEEeCCCCHHHHHHHHHHHHhchhhhhhhhhhhhhhhhhhcccCCCCCccEEEECccccccCcchHHHHHHHHhcCCccc
Q 042872          273 TFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRL  352 (381)
Q Consensus       273 ~~l~g~~~~~e~~~il~~lr~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~aTPErL~~~~~f~~~L~~L~~~g~~~l  352 (381)
                      ..+++..+.+++..++..+.+|                         .+++||.+||+|. ++.|++.|..    .    
T Consensus        85 ~~lnS~l~~~e~~~v~~~l~~g-------------------------~~klLyisPErl~-~~~f~~~L~~----~----  130 (590)
T COG0514          85 AYLNSTLSREERQQVLNQLKSG-------------------------QLKLLYISPERLM-SPRFLELLKR----L----  130 (590)
T ss_pred             ehhhcccCHHHHHHHHHHHhcC-------------------------ceeEEEECchhhc-ChHHHHHHHh----C----
Confidence            9999999999999999999876                         6899999999998 5788887763    2    


Q ss_pred             cccccccccccccccCCccEEEEeccccC
Q 042872          353 KVLTTDVVVLPHTCQRQLAGFVVDEAHCV  381 (381)
Q Consensus       353 ~~~~~~~v~~~~~~~~~L~~lVIDEAHcI  381 (381)
                                      +|.+|||||||||
T Consensus       131 ----------------~i~l~vIDEAHCi  143 (590)
T COG0514         131 ----------------PISLVAIDEAHCI  143 (590)
T ss_pred             ----------------CCceEEechHHHH
Confidence                            8999999999997



>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05872 DUF853: Bacterial protein of unknown function (DUF853); InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
2v1x_A 591 Crystal Structure Of Human Recq-Like Dna Helicase L 4e-09
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 2e-08
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 2e-07
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 46/182 (25%), Positives = 68/182 (37%), Gaps = 65/182 (35%) Query: 220 IFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ--------------------- 258 +F FRPLQ + ++A ++ F+++PTGGGKSLCYQ Sbjct: 39 VFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLME 98 Query: 259 DQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDK 318 DQ++ L + GI AT LN+ + V E+ Sbjct: 99 DQLMVLK-QLGISATMLNASSSKEHVKWVHAEMVN-----------------------KN 134 Query: 319 PSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEA 378 KL+YVTPE+I ++ F L+ + R+ VDE Sbjct: 135 SELKLIYVTPEKIAKSKMFMSRLEKAYE--------------------ARRFTRIAVDEV 174 Query: 379 HC 380 HC Sbjct: 175 HC 176
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 2e-37
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 5e-28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
 Score =  141 bits (358), Expect = 2e-37
 Identities = 45/183 (24%), Positives = 67/183 (36%), Gaps = 65/183 (35%)

Query: 220 IFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ--------------------- 258
           +F    FRPLQ +    ++A ++ F+++PTGGGKSLCYQ                     
Sbjct: 39  VFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLME 98

Query: 259 DQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDK 318
           DQ++ L  + GI AT LN+  +      V  E+                           
Sbjct: 99  DQLMVLK-QLGISATMLNASSSKEHVKWVHAEMVNK-----------------------N 134

Query: 319 PSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEA 378
              KL+YVTPE+I  ++ F   L+  +                       +     VDE 
Sbjct: 135 SELKLIYVTPEKIAKSKMFMSRLEKAYEAR--------------------RFTRIAVDEV 174

Query: 379 HCV 381
           HC 
Sbjct: 175 HCC 177


>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.85
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.84
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.83
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.82
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.81
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.81
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.8
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.79
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.79
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.79
3bor_A237 Human initiation factor 4A-II; translation initiat 99.78
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.78
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.78
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.77
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.77
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.77
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.77
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.76
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.75
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.75
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.74
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.73
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.73
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.72
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.72
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.72
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.7
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.7
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.69
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.67
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.66
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.65
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.63
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.62
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.62
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.61
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.59
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.56
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.55
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.55
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.55
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.54
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.53
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.52
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.52
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.51
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.5
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.5
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.49
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.43
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.42
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.4
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.4
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.36
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.35
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.34
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.33
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.32
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.29
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.27
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.25
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.25
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.16
3h1t_A 590 Type I site-specific restriction-modification syst 99.05
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.04
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.98
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.96
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.94
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.94
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.88
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.84
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.82
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.74
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.66
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.63
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.6
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.57
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.57
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.53
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.22
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.8
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.55
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 96.55
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.54
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.43
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.21
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.04
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.88
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.8
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 94.59
3bos_A242 Putative DNA replication factor; P-loop containing 94.39
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.38
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 94.37
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 94.05
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 93.86
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 93.83
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 93.81
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.58
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.5
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 93.4
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.35
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.16
2r6a_A 454 DNAB helicase, replicative helicase; replication, 92.97
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.93
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.82
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 92.79
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 92.52
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 92.51
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.37
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 92.25
1u94_A 356 RECA protein, recombinase A; homologous recombinat 92.11
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 92.11
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 91.92
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.87
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 91.85
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 91.69
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 91.65
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 91.63
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.14
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 91.07
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 90.91
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 90.77
1vma_A306 Cell division protein FTSY; TM0570, structural gen 90.68
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 90.67
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 90.63
2cvh_A220 DNA repair and recombination protein RADB; filamen 90.62
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 90.5
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 90.42
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 90.35
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 90.31
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 90.28
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 90.22
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.1
2xxa_A 433 Signal recognition particle protein; protein trans 90.1
1xp8_A 366 RECA protein, recombinase A; recombination, radior 90.06
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 90.03
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 90.02
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 89.56
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 89.56
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 89.5
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 89.42
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 89.26
2chq_A 319 Replication factor C small subunit; DNA-binding pr 89.26
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 89.23
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 89.17
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 89.1
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 89.07
3pvs_A 447 Replication-associated recombination protein A; ma 88.91
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 88.89
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 88.45
2z43_A324 DNA repair and recombination protein RADA; archaea 88.25
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 88.19
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 88.12
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 88.12
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 88.1
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 87.86
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 87.81
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 87.72
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 87.63
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 87.53
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 87.4
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 87.39
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 87.23
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 86.64
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 86.34
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 85.68
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 84.97
3co5_A143 Putative two-component system transcriptional RES 84.87
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 84.76
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 84.33
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 84.17
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 83.84
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 83.28
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 83.18
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 83.07
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 82.29
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 82.22
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 82.17
4a74_A231 DNA repair and recombination protein RADA; hydrola 82.15
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 82.02
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 81.78
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 81.43
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 81.17
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 81.17
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 81.08
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 80.91
2bzb_A62 Conserved domain protein; transferase, phosphatase 80.87
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 80.86
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 80.46
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 80.24
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
Probab=99.85  E-value=1.3e-21  Score=204.27  Aligned_cols=126  Identities=36%  Similarity=0.624  Sum_probs=105.8

Q ss_pred             HHHHHHHHHhCCCCCcHHHHHHHHHHHcCCCEEEECCCCCCchhhHH---------------------HHHHHHHhhcCC
Q 042872          212 DMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ---------------------DQIITLNLKFGI  270 (381)
Q Consensus       212 ~l~~~~~~~fG~~~fRpiQ~eAI~aiL~GrDvLviaPTGsGKTLaF~---------------------dQv~~L~~~~gI  270 (381)
                      .+...+.+.|||..|||+|.++|++++.|+|+|++||||+|||+||+                     +|+..|. .+|+
T Consensus        31 ~l~~~L~~~fg~~~~rp~Q~~~i~~il~g~d~lv~~pTGsGKTl~~~lpal~~~g~~lVisP~~~L~~q~~~~l~-~~gi  109 (591)
T 2v1x_A           31 KVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLK-QLGI  109 (591)
T ss_dssp             HHHHHHHHTSCCCSCCTTHHHHHHHHHTTCCEEEECCTTSCTTHHHHHHHHTSSSEEEEECSCHHHHHHHHHHHH-HHTC
T ss_pred             HHHHHHHHHhCCCCCCHHHHHHHHHHHcCCCEEEEECCCChHHHHHHHHHHHcCCcEEEEeCHHHHHHHHHHHHH-hcCC
Confidence            35566777799999999999999999999999999999999999998                     6778887 5799


Q ss_pred             cEEEEeCCCCHHHHHHHHHHHHhchhhhhhhhhhhhhhhhhhcccCCCCCccEEEECccccccCcchHHHHHHHHhcCCc
Q 042872          271 PATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSI  350 (381)
Q Consensus       271 ~a~~l~g~~~~~e~~~il~~lr~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~aTPErL~~~~~f~~~L~~L~~~g~~  350 (381)
                      ++..++|+.+..++..++..+.                       ...+.++|||+|||+|..+..|...+......+  
T Consensus       110 ~~~~l~~~~~~~~~~~~~~~l~-----------------------~~~~~~~Ilv~Tpe~L~~~~~~~~~l~~~~~~~--  164 (591)
T 2v1x_A          110 SATMLNASSSKEHVKWVHAEMV-----------------------NKNSELKLIYVTPEKIAKSKMFMSRLEKAYEAR--  164 (591)
T ss_dssp             CEEECCSSCCHHHHHHHHHHHH-----------------------CTTCCCCEEEECHHHHHSCHHHHHHHHHHHHTT--
T ss_pred             cEEEEeCCCCHHHHHHHHHHhh-----------------------cccCCCCEEEEChhHhhccHHHHHHHHhhhhcc--
Confidence            9999999999888877777763                       223478999999999986567777766554333  


Q ss_pred             cccccccccccccccccCCccEEEEeccccC
Q 042872          351 RLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV  381 (381)
Q Consensus       351 ~l~~~~~~~v~~~~~~~~~L~~lVIDEAHcI  381 (381)
                                        ++.+|||||||||
T Consensus       165 ------------------~i~~iViDEAH~i  177 (591)
T 2v1x_A          165 ------------------RFTRIAVDEVHCC  177 (591)
T ss_dssp             ------------------CEEEEEEETGGGG
T ss_pred             ------------------CCcEEEEECcccc
Confidence                              8999999999996



>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2bzb_A Conserved domain protein; transferase, phosphatase, phosphorylation, sporulation, antithetical, negative, regulator, spine; NMR {Bacillus anthracis} SCOP: a.30.7.1 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 381
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 7e-06
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-04
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 7e-04
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]
 Score = 44.2 bits (103), Expect = 7e-06
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 220 IFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQI 261
            FG + FRP Q +     ++ +DC V++PTGGGKSLCYQ   
Sbjct: 20  TFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPA 61


>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.88
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.86
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.85
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.84
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.84
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.84
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.81
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.8
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.8
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.8
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.69
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.54
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.51
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.11
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.07
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.01
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.98
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.87
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 98.82
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.47
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.3
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.16
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.08
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.93
d1okkd2207 GTPase domain of the signal recognition particle r 97.13
d2qy9a2211 GTPase domain of the signal recognition particle r 97.03
d1vmaa2213 GTPase domain of the signal recognition particle r 96.95
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.73
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.02
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.01
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.71
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.61
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.92
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.58
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.27
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.48
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.33
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.12
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 92.06
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 91.89
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.71
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.31
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 91.06
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 90.89
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.83
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.33
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 90.3
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.13
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 89.9
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.36
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 89.34
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.3
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 88.94
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.72
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.21
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.95
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.89
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 87.76
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.69
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 87.34
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 87.2
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 87.13
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 86.73
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.71
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 86.5
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 86.46
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 86.35
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 85.9
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.83
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 85.31
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 84.88
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 83.95
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 83.57
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 83.54
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 81.82
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 81.45
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 80.69
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 80.48
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=6.9e-23  Score=187.92  Aligned_cols=127  Identities=19%  Similarity=0.275  Sum_probs=101.1

Q ss_pred             CCCCHHHHhhchHHHHHHHHHhCCCCCcHHHHHHHHHHHcCCCEEEECCCCCCchhhHH---------------------
Q 042872          200 GTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ---------------------  258 (381)
Q Consensus       200 ~~~~fe~L~~l~~l~~~~~~~fG~~~fRpiQ~eAI~aiL~GrDvLviaPTGsGKTLaF~---------------------  258 (381)
                      ...+|+.|..-+++..++.+ .||+.|+|+|.+|||.+++|+|+++.+|||||||+||+                     
T Consensus        15 ~~~sF~~l~L~~~l~~~L~~-~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~P   93 (222)
T d2j0sa1          15 VTPTFDTMGLREDLLRGIYA-YGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAP   93 (222)
T ss_dssp             CCCSGGGGCCCHHHHHHHHH-HTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECS
T ss_pred             CCCCHHHCCCCHHHHHHHHH-CCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecc
Confidence            34568888777777777755 89999999999999999999999999999999999998                     


Q ss_pred             ---------HHHHHHHhhcCCcEEEEeCCCCHHHHHHHHHHHHhchhhhhhhhhhhhhhhhhhcccCCCCCccEEEECcc
Q 042872          259 ---------DQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPE  329 (381)
Q Consensus       259 ---------dQv~~L~~~~gI~a~~l~g~~~~~e~~~il~~lr~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~aTPE  329 (381)
                               +.+..+....++++..+.|+.....+...++.                             +++|||+||+
T Consensus        94 treLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~-----------------------------~~~Ilv~TPg  144 (222)
T d2j0sa1          94 TRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDY-----------------------------GQHVVAGTPG  144 (222)
T ss_dssp             SHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHH-----------------------------CCSEEEECHH
T ss_pred             hHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhcc-----------------------------CCeEEeCCCC
Confidence                     33455555567888888888887765544433                             5799999999


Q ss_pred             ccccCcchHHHHHHHHhcCCccccccccccccccccccCCccEEEEeccccC
Q 042872          330 RIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV  381 (381)
Q Consensus       330 rL~~~~~f~~~L~~L~~~g~~~l~~~~~~~v~~~~~~~~~L~~lVIDEAHcI  381 (381)
                      ||..          +...+.+.++               ++.+|||||||++
T Consensus       145 rl~~----------~~~~~~~~~~---------------~l~~lVlDEaD~l  171 (222)
T d2j0sa1         145 RVFD----------MIRRRSLRTR---------------AIKMLVLDEADEM  171 (222)
T ss_dssp             HHHH----------HHHTTSSCCT---------------TCCEEEEETHHHH
T ss_pred             cHHh----------cccccccccc---------------cceeeeecchhHh
Confidence            9962          3345556666               9999999999963



>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure