Citrus Sinensis ID: 042872
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 381 | ||||||
| 147783250 | 1640 | hypothetical protein VITISV_005845 [Viti | 0.887 | 0.206 | 0.562 | 1e-113 | |
| 118489987 | 617 | unknown [Populus trichocarpa x Populus d | 0.850 | 0.525 | 0.571 | 1e-111 | |
| 224123710 | 588 | predicted protein [Populus trichocarpa] | 0.776 | 0.503 | 0.540 | 1e-104 | |
| 296089753 | 591 | unnamed protein product [Vitis vinifera] | 0.797 | 0.514 | 0.529 | 1e-102 | |
| 255542856 | 586 | DNA helicase hus2, putative [Ricinus com | 0.808 | 0.525 | 0.536 | 1e-102 | |
| 357441847 | 603 | Bloom syndrome protein-like protein [Med | 0.790 | 0.499 | 0.508 | 1e-99 | |
| 225450636 | 602 | PREDICTED: ATP-dependent DNA helicase Q- | 0.826 | 0.523 | 0.534 | 1e-98 | |
| 356533550 | 612 | PREDICTED: LOW QUALITY PROTEIN: ATP-depe | 0.808 | 0.503 | 0.513 | 1e-95 | |
| 30679600 | 606 | ATP-dependent DNA helicase Q-like 1 [Ara | 0.805 | 0.506 | 0.490 | 4e-95 | |
| 449454038 | 601 | PREDICTED: ATP-dependent DNA helicase Q- | 0.816 | 0.517 | 0.483 | 3e-93 |
| >gi|147783250|emb|CAN73069.1| hypothetical protein VITISV_005845 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 415 bits (1066), Expect = e-113, Method: Compositional matrix adjust.
Identities = 226/402 (56%), Positives = 267/402 (66%), Gaps = 64/402 (15%)
Query: 1 MDCHDFEFEKARLLSLALEFGFDQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLA 60
MD HD E EKARLLSLAL+FGFD++SA K L+RL+ LYGDDGQDFI+VEHCGDDF+A L
Sbjct: 95 MDGHDLEMEKARLLSLALDFGFDEESAMKCLDRLVHLYGDDGQDFITVEHCGDDFLAALV 154
Query: 61 ETMQDSEEWDDLQAMESEACGALNNMFDKRVIDNNQANDNDNSREYIDILDDSPEPKRRP 120
E+++DSE+WDDLQA+E+EACG LN+MFD V+ ++ YI+ + S EP++
Sbjct: 155 ESVEDSEDWDDLQAIETEACGTLNDMFDNDVLHGYGSDYGIYREGYINATEYSYEPQKHQ 214
Query: 121 TLMELDSLSDTEDLDFTIPKQKDAILNLSSCPDGRSQIFTPSSVKHSSKSVDCKSGVSTS 180
++LDS SD+ED F I +K A S PDG S FT SS+KH+S+SVD K V
Sbjct: 215 NFVQLDSSSDSEDSSFRILDKKGAAPTSPSWPDGSSSAFTQSSIKHASRSVDSKISVIQG 274
Query: 181 SASSVSNKKRSSLISDNEHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAK 240
S SS+SNK+ S +S++E+GTLS+E L LDD E ANVVIFGNR FRPLQHQACKASV K
Sbjct: 275 SVSSISNKRARSQMSEDENGTLSYEALLDLDDFELANVVIFGNRTFRPLQHQACKASVTK 334
Query: 241 QDCFVLLPTGGGKSLCY---------------------QDQIITLNLKFGIPATFLNSQQ 279
+DCFVL+PTGGGKSLCY QDQIITLNL FGIPATFL+SQQ
Sbjct: 335 RDCFVLMPTGGGKSLCYQLPATLQPGVTVVVCPLLSLIQDQIITLNLNFGIPATFLSSQQ 394
Query: 280 TVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSE 339
T SQAAAVL+EL RKDKPSCKLLYVTPERI GN +F E
Sbjct: 395 TASQAAAVLKEL-----------------------RKDKPSCKLLYVTPERIAGNSTFFE 431
Query: 340 VLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV 381
+LK LH KG QLAGFVVDEAHCV
Sbjct: 432 ILKSLHWKG--------------------QLAGFVVDEAHCV 453
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118489987|gb|ABK96790.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|224123710|ref|XP_002330189.1| predicted protein [Populus trichocarpa] gi|222871645|gb|EEF08776.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296089753|emb|CBI39572.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255542856|ref|XP_002512491.1| DNA helicase hus2, putative [Ricinus communis] gi|223548452|gb|EEF49943.1| DNA helicase hus2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357441847|ref|XP_003591201.1| Bloom syndrome protein-like protein [Medicago truncatula] gi|355480249|gb|AES61452.1| Bloom syndrome protein-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225450636|ref|XP_002282715.1| PREDICTED: ATP-dependent DNA helicase Q-like 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356533550|ref|XP_003535326.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase Q-like 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30679600|ref|NP_187225.2| ATP-dependent DNA helicase Q-like 1 [Arabidopsis thaliana] gi|75334309|sp|Q9FT74.1|RQL1_ARATH RecName: Full=ATP-dependent DNA helicase Q-like 1; AltName: Full=RecQ-like protein 1; Short=AtRecQ1; Short=AtRecQl1 gi|10944747|emb|CAC14163.1| DNA Helicase [Arabidopsis thaliana] gi|332640767|gb|AEE74288.1| ATP-dependent DNA helicase Q-like 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449454038|ref|XP_004144763.1| PREDICTED: ATP-dependent DNA helicase Q-like 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 381 | ||||||
| TAIR|locus:2074429 | 606 | RECQI1 "RECQ helicase l1" [Ara | 0.829 | 0.521 | 0.346 | 3.2e-42 | |
| DICTYBASE|DDB_G0272384 | 973 | DDB_G0272384 "Bloom syndrome-l | 0.393 | 0.154 | 0.323 | 1.6e-09 | |
| TAIR|locus:2197394 | 1188 | RECQ4A [Arabidopsis thaliana ( | 0.338 | 0.108 | 0.328 | 5.2e-09 | |
| UNIPROTKB|F1RMJ3 | 541 | BLM "Uncharacterized protein" | 0.322 | 0.227 | 0.312 | 8.9e-09 | |
| DICTYBASE|DDB_G0292130 | 1259 | blm "Bloom syndrome protein" [ | 0.383 | 0.115 | 0.337 | 9.2e-09 | |
| FB|FBgn0002906 | 1487 | Blm "Bloom syndrome helicase o | 0.328 | 0.084 | 0.348 | 3.2e-08 | |
| TAIR|locus:2127998 | 713 | RecQl3 "AT4G35740" [Arabidopsi | 0.328 | 0.175 | 0.348 | 3.4e-08 | |
| RGD|1311071 | 621 | Recql "RecQ protein-like (DNA | 0.367 | 0.225 | 0.313 | 7.7e-08 | |
| UNIPROTKB|Q6AYJ1 | 621 | Recql "ATP-dependent DNA helic | 0.367 | 0.225 | 0.313 | 7.7e-08 | |
| RGD|1308810 | 999 | Blm "Bloom syndrome, RecQ heli | 0.099 | 0.038 | 0.578 | 1.3e-07 |
| TAIR|locus:2074429 RECQI1 "RECQ helicase l1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 404 (147.3 bits), Expect = 3.2e-42, Sum P(2) = 3.2e-42
Identities = 116/335 (34%), Positives = 162/335 (48%)
Query: 23 DQDSANKSLNRLISLYGDDGQDFISVEHCGDDFIATLAETMQDSEEWDDLQAMESEACGA 82
DQD + + RLISL G D S + C D F+ + D ++ ++ + A
Sbjct: 3 DQDLELEKV-RLISLATKLGFDEDSAKKCLDRFVDLYGD---DGRDFITVELCGDDFLAA 58
Query: 83 LNNMFD-KRVIDNNQANDNDNSREYIDILDDSPEPKRRPTXXXXXXXXXXXXXXFTI--- 138
L + + D+ QA +++ ++ D S P
Sbjct: 59 LADFEEGTEEWDDIQAIESEAQGNLAEMFDKSTNPSDNGFDTDDDDDDSRVEVHVIEDSP 118
Query: 139 -PKQKDAILNLSSCPDGRSQIFTPSSVKHSSKSVDCXXXXXXXXXXXXXXXXXXXXXXDN 197
PK+K I+ L S D + T V S++ N
Sbjct: 119 EPKKKPEIVELDSSSD-LEDVETRFKVPRRSQTCSRSMDYSMEDSVSTISGRKPSVQISN 177
Query: 198 -EHGTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLC 256
+H T S+EELQALDD+EFAN+VIFGN+ FRPLQHQAC+AS+ ++DCFVL+PTGGGKSLC
Sbjct: 178 KDHETPSYEELQALDDLEFANLVIFGNKVFRPLQHQACRASMERKDCFVLMPTGGGKSLC 237
Query: 257 YQDQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGL---VLSQHYFLHQLIFVLTCA 313
YQ + LK G+ ++ ++ Q V L+ G+ L+ Q VL
Sbjct: 238 YQ---LPATLKAGVTIV-ISPLLSLIQDQIVALNLKFGIPATFLNSQQTSSQAAAVLQ-E 292
Query: 314 SRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKG 348
R+D PSCKLLYVTPE+I G+ SF E L+CL RKG
Sbjct: 293 LRRDNPSCKLLYVTPEKIAGSSSFLETLRCLDRKG 327
|
|
| DICTYBASE|DDB_G0272384 DDB_G0272384 "Bloom syndrome-like protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197394 RECQ4A [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RMJ3 BLM "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0292130 blm "Bloom syndrome protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002906 Blm "Bloom syndrome helicase ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127998 RecQl3 "AT4G35740" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|1311071 Recql "RecQ protein-like (DNA helicase Q1-like)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6AYJ1 Recql "ATP-dependent DNA helicase Q1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1308810 Blm "Bloom syndrome, RecQ helicase-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 381 | |||
| TIGR00614 | 470 | TIGR00614, recQ_fam, ATP-dependent DNA helicase, R | 5e-22 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 5e-21 | |
| TIGR01389 | 591 | TIGR01389, recQ, ATP-dependent DNA helicase RecQ | 4e-17 | |
| PLN03137 | 1195 | PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 | 2e-16 | |
| PRK11057 | 607 | PRK11057, PRK11057, ATP-dependent DNA helicase Rec | 2e-16 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 9e-06 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 0.001 |
| >gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
Score = 96.8 bits (241), Expect = 5e-22
Identities = 58/182 (31%), Positives = 76/182 (41%), Gaps = 70/182 (38%)
Query: 221 FGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ---------------------D 259
FG +FRP+Q + A + +DCFV++PTGGGKSLCYQ D
Sbjct: 7 FGLSSFRPVQLEVINAVLLGRDCFVVMPTGGGKSLCYQLPALCSDGITLVISPLISLMED 66
Query: 260 QIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKP 319
Q++ L GIPATFLNS Q+ Q VL +L+ G +
Sbjct: 67 QVLQLKA-SGIPATFLNSSQSKEQQKNVLTDLKDGKI----------------------- 102
Query: 320 SCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAH 379
KLLYVTPE+ + + L+ RKG VDEAH
Sbjct: 103 --KLLYVTPEKCSASNRLLQTLE--ERKGITL---------------------IAVDEAH 137
Query: 380 CV 381
C+
Sbjct: 138 CI 139
|
All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 470 |
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.89 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 99.89 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.88 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.86 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 99.86 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.86 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 99.84 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.83 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.82 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.81 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.8 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.79 | |
| PTZ00110 | 545 | helicase; Provisional | 99.79 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.79 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.78 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.78 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.77 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 99.77 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 99.75 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 99.75 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.75 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.74 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 99.72 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 99.69 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.68 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.65 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 99.65 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.64 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.62 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.62 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 99.61 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 99.61 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.61 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.59 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 99.59 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 99.57 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.57 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 99.57 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 99.56 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 99.56 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.55 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.55 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 99.54 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 99.52 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.51 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.51 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.49 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.47 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 99.46 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.46 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 99.46 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.44 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.44 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.43 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.42 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 99.4 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.4 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.36 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 99.3 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.26 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.21 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.21 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.16 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.15 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.15 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.14 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.14 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.12 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.08 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 99.08 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.01 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 98.98 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 98.95 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 98.94 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 98.94 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 98.88 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 98.88 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.86 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 98.86 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 98.82 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 98.8 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 98.77 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 98.73 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 98.72 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.67 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 98.66 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 98.63 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.56 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 98.51 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 98.44 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 98.44 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 98.42 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.39 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 98.37 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 98.36 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.36 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.31 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 98.21 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 98.15 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 98.09 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 98.08 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 98.06 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 98.03 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.93 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.9 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.82 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 97.8 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 97.75 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 97.75 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 97.74 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 97.72 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 97.67 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 97.66 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 97.64 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 97.63 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 97.63 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 97.62 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 97.6 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 97.59 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 97.55 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 97.53 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 97.53 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 97.43 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 97.41 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 97.25 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.21 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 97.03 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.0 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 96.75 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.75 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 96.72 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 96.65 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 96.63 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.62 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 96.56 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 96.42 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.33 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 96.27 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 96.26 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 96.23 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.15 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 96.01 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.98 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 95.95 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 95.89 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 95.88 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 95.84 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.81 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.79 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 95.73 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.73 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 95.63 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.5 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.46 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 95.42 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 95.42 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 95.39 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 95.36 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.34 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 95.34 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.31 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.27 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.24 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.22 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.13 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.08 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 95.04 | |
| PRK06526 | 254 | transposase; Provisional | 95.03 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.03 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.03 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.02 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 94.96 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 94.88 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 94.72 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 94.72 | |
| PRK08181 | 269 | transposase; Validated | 94.71 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 94.69 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.65 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 94.64 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 94.62 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 94.6 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 94.56 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 94.55 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 94.39 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 94.26 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.1 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 94.06 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 93.97 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 93.86 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 93.81 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 93.64 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 93.59 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 93.25 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 93.04 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 92.96 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 92.93 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 92.9 | |
| PRK12377 | 248 | putative replication protein; Provisional | 92.81 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 92.79 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 92.78 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 92.63 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 92.59 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.48 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 92.46 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 92.29 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 92.21 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 92.16 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 92.16 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 92.11 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 91.96 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 91.93 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 91.91 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 91.82 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 91.74 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 91.69 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 91.33 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 91.32 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 91.29 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 91.25 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 91.23 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 91.12 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.11 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 90.99 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 90.95 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 90.8 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 90.77 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 90.76 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 90.73 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 90.7 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 90.65 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 90.64 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 90.61 | |
| PHA02244 | 383 | ATPase-like protein | 90.59 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 90.59 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 90.56 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 90.54 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 90.54 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 90.27 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 90.15 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 90.13 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 90.0 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 89.97 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 89.94 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 89.89 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 89.85 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 89.85 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 89.79 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 89.79 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 89.78 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.77 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 89.75 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 89.64 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 89.62 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 89.53 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 89.48 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 89.47 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 89.38 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 89.38 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 89.33 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 89.28 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 89.26 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 89.25 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 89.24 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 89.19 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 89.08 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 89.04 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 89.0 | |
| PRK08116 | 268 | hypothetical protein; Validated | 88.99 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 88.97 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 88.89 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 88.86 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 88.72 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 88.7 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 88.69 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 88.67 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 88.65 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 88.55 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 88.44 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 88.42 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 88.38 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 88.26 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 88.21 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 88.14 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 88.07 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 88.0 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 87.97 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 87.94 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 87.93 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 87.87 | |
| KOG1131 | 755 | consensus RNA polymerase II transcription initiati | 87.85 | |
| KOG1132 | 945 | consensus Helicase of the DEAD superfamily [Replic | 87.79 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 87.66 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 87.66 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 87.63 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 87.63 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 87.59 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 87.45 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 87.43 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 87.39 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 87.29 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 87.23 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 87.21 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 87.01 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 87.0 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 86.96 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 86.96 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 86.93 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 86.89 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 86.75 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 86.73 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 86.73 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 86.7 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 86.66 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 86.57 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 86.54 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 86.53 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 86.34 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 86.32 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 86.23 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 86.2 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 86.14 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 86.13 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 85.98 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 85.89 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 85.88 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 85.8 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 85.78 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 85.77 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 85.73 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 85.41 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 85.21 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 85.08 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 84.86 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 84.8 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 84.79 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 84.65 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 84.6 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 84.4 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 84.31 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 84.24 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 84.15 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 84.05 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 84.03 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 83.95 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 83.78 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 83.71 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 83.71 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 83.64 | |
| PF05872 | 502 | DUF853: Bacterial protein of unknown function (DUF | 83.61 | |
| KOG1133 | 821 | consensus Helicase of the DEAD superfamily [Replic | 83.53 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 83.31 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 83.27 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 83.16 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 83.12 | |
| PF14617 | 252 | CMS1: U3-containing 90S pre-ribosomal complex subu | 83.1 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 83.08 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 82.95 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 82.27 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 82.13 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 82.12 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 82.08 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 82.08 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 82.0 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 81.81 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 81.53 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 81.52 | |
| PF13173 | 128 | AAA_14: AAA domain | 81.48 | |
| PHA00350 | 399 | putative assembly protein | 81.42 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 81.39 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 81.21 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 81.2 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 81.15 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 81.11 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 80.86 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 80.82 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 80.63 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 80.59 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 80.48 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 80.31 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 80.21 |
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=99.89 E-value=1.5e-23 Score=220.52 Aligned_cols=117 Identities=42% Similarity=0.723 Sum_probs=107.7
Q ss_pred HHHHHHHhCCCCCcHHHHHHHHHHHcCCCEEEECCCCCCchhhHH---------------------HHHHHHHhhcCCcE
Q 042872 214 EFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ---------------------DQIITLNLKFGIPA 272 (381)
Q Consensus 214 ~~~~~~~fG~~~fRpiQ~eAI~aiL~GrDvLviaPTGsGKTLaF~---------------------dQv~~L~~~~gI~a 272 (381)
...+..+|||..|||.|+++|..+++|+|+|++||||+|||+||| ||+.+|. ..||+|
T Consensus 6 ~~~L~~~fGy~~FR~gQ~evI~~~l~g~d~lvvmPTGgGKSlCyQiPAll~~G~TLVVSPLiSLM~DQV~~l~-~~Gi~A 84 (590)
T COG0514 6 QQVLKQVFGYASFRPGQQEIIDALLSGKDTLVVMPTGGGKSLCYQIPALLLEGLTLVVSPLISLMKDQVDQLE-AAGIRA 84 (590)
T ss_pred HHHHHHHhCccccCCCHHHHHHHHHcCCcEEEEccCCCCcchHhhhHHHhcCCCEEEECchHHHHHHHHHHHH-HcCcee
Confidence 355778899999999999999999999999999999999999999 9999998 689999
Q ss_pred EEEeCCCCHHHHHHHHHHHHhchhhhhhhhhhhhhhhhhhcccCCCCCccEEEECccccccCcchHHHHHHHHhcCCccc
Q 042872 273 TFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRL 352 (381)
Q Consensus 273 ~~l~g~~~~~e~~~il~~lr~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~aTPErL~~~~~f~~~L~~L~~~g~~~l 352 (381)
..+++..+.+++..++..+.+| .+++||.+||+|. ++.|++.|.. .
T Consensus 85 ~~lnS~l~~~e~~~v~~~l~~g-------------------------~~klLyisPErl~-~~~f~~~L~~----~---- 130 (590)
T COG0514 85 AYLNSTLSREERQQVLNQLKSG-------------------------QLKLLYISPERLM-SPRFLELLKR----L---- 130 (590)
T ss_pred ehhhcccCHHHHHHHHHHHhcC-------------------------ceeEEEECchhhc-ChHHHHHHHh----C----
Confidence 9999999999999999999876 6899999999998 5788887763 2
Q ss_pred cccccccccccccccCCccEEEEeccccC
Q 042872 353 KVLTTDVVVLPHTCQRQLAGFVVDEAHCV 381 (381)
Q Consensus 353 ~~~~~~~v~~~~~~~~~L~~lVIDEAHcI 381 (381)
+|.+|||||||||
T Consensus 131 ----------------~i~l~vIDEAHCi 143 (590)
T COG0514 131 ----------------PISLVAIDEAHCI 143 (590)
T ss_pred ----------------CCceEEechHHHH
Confidence 8999999999997
|
|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05872 DUF853: Bacterial protein of unknown function (DUF853); InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold | Back alignment and domain information |
|---|
| >KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 381 | ||||
| 2v1x_A | 591 | Crystal Structure Of Human Recq-Like Dna Helicase L | 4e-09 | ||
| 1oyy_A | 523 | Structure Of The Recq Catalytic Core Bound To Atp-G | 2e-08 | ||
| 1oyw_A | 523 | Structure Of The Recq Catalytic Core Length = 523 | 2e-07 |
| >pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 | Back alignment and structure |
|
| >pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 | Back alignment and structure |
| >pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 381 | |||
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 2e-37 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 5e-28 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 |
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 | Back alignment and structure |
|---|
Score = 141 bits (358), Expect = 2e-37
Identities = 45/183 (24%), Positives = 67/183 (36%), Gaps = 65/183 (35%)
Query: 220 IFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ--------------------- 258
+F FRPLQ + ++A ++ F+++PTGGGKSLCYQ
Sbjct: 39 VFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLME 98
Query: 259 DQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDK 318
DQ++ L + GI AT LN+ + V E+
Sbjct: 99 DQLMVLK-QLGISATMLNASSSKEHVKWVHAEMVNK-----------------------N 134
Query: 319 PSCKLLYVTPERIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEA 378
KL+YVTPE+I ++ F L+ + + VDE
Sbjct: 135 SELKLIYVTPEKIAKSKMFMSRLEKAYEAR--------------------RFTRIAVDEV 174
Query: 379 HCV 381
HC
Sbjct: 175 HCC 177
|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.85 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.84 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.83 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.82 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.81 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.81 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.8 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.79 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.79 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.79 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.78 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.78 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.78 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.77 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.77 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.77 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.77 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.76 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.75 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.75 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.74 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.73 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.73 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.72 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.72 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.72 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.7 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.7 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.69 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.67 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.66 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.65 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.63 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.62 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.62 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.61 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.59 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.56 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.55 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.55 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.55 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.54 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.53 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.52 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.52 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.51 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.5 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.5 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.49 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.43 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.42 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.4 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.4 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.36 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.35 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.34 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.33 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.32 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.29 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.27 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.25 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.25 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.16 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.05 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.04 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 98.98 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 98.96 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 98.94 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.94 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 98.88 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 98.84 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 98.82 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 98.74 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 98.66 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 98.63 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 98.6 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 98.57 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 98.57 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 98.53 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 98.22 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 97.8 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 97.55 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.55 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.54 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.43 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.21 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 95.04 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.88 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 94.8 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 94.59 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 94.39 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.38 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.37 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 94.05 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 93.86 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 93.83 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 93.81 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.58 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 93.5 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 93.4 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 93.35 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.16 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 92.97 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 92.93 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 92.82 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 92.79 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 92.52 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 92.51 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 92.37 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 92.25 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 92.11 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 92.11 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 91.92 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 91.87 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 91.85 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 91.69 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 91.65 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 91.63 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 91.14 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 91.07 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 90.91 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 90.77 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 90.68 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 90.67 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 90.63 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 90.62 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 90.5 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 90.42 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 90.35 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 90.31 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 90.28 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 90.22 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 90.1 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 90.1 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 90.06 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.03 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 90.02 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 89.56 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 89.56 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 89.5 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 89.42 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 89.26 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 89.26 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 89.23 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 89.17 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 89.1 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 89.07 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 88.91 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 88.89 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 88.45 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 88.25 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 88.19 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 88.12 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 88.12 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 88.1 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 87.86 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 87.81 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 87.72 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 87.63 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 87.53 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 87.4 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 87.39 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 87.23 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 86.64 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 86.34 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 85.68 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 84.97 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 84.87 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 84.76 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 84.33 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 84.17 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 83.84 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 83.28 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 83.18 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 83.07 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 82.29 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 82.22 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 82.17 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 82.15 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 82.02 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 81.78 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 81.43 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 81.17 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 81.17 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 81.08 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 80.91 | |
| 2bzb_A | 62 | Conserved domain protein; transferase, phosphatase | 80.87 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 80.86 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 80.46 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 80.24 |
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
Probab=99.85 E-value=1.3e-21 Score=204.27 Aligned_cols=126 Identities=36% Similarity=0.624 Sum_probs=105.8
Q ss_pred HHHHHHHHHhCCCCCcHHHHHHHHHHHcCCCEEEECCCCCCchhhHH---------------------HHHHHHHhhcCC
Q 042872 212 DMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ---------------------DQIITLNLKFGI 270 (381)
Q Consensus 212 ~l~~~~~~~fG~~~fRpiQ~eAI~aiL~GrDvLviaPTGsGKTLaF~---------------------dQv~~L~~~~gI 270 (381)
.+...+.+.|||..|||+|.++|++++.|+|+|++||||+|||+||+ +|+..|. .+|+
T Consensus 31 ~l~~~L~~~fg~~~~rp~Q~~~i~~il~g~d~lv~~pTGsGKTl~~~lpal~~~g~~lVisP~~~L~~q~~~~l~-~~gi 109 (591)
T 2v1x_A 31 KVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLK-QLGI 109 (591)
T ss_dssp HHHHHHHHTSCCCSCCTTHHHHHHHHHTTCCEEEECCTTSCTTHHHHHHHHTSSSEEEEECSCHHHHHHHHHHHH-HHTC
T ss_pred HHHHHHHHHhCCCCCCHHHHHHHHHHHcCCCEEEEECCCChHHHHHHHHHHHcCCcEEEEeCHHHHHHHHHHHHH-hcCC
Confidence 35566777799999999999999999999999999999999999998 6778887 5799
Q ss_pred cEEEEeCCCCHHHHHHHHHHHHhchhhhhhhhhhhhhhhhhhcccCCCCCccEEEECccccccCcchHHHHHHHHhcCCc
Q 042872 271 PATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPERIVGNQSFSEVLKCLHRKGSI 350 (381)
Q Consensus 271 ~a~~l~g~~~~~e~~~il~~lr~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~aTPErL~~~~~f~~~L~~L~~~g~~ 350 (381)
++..++|+.+..++..++..+. ...+.++|||+|||+|..+..|...+......+
T Consensus 110 ~~~~l~~~~~~~~~~~~~~~l~-----------------------~~~~~~~Ilv~Tpe~L~~~~~~~~~l~~~~~~~-- 164 (591)
T 2v1x_A 110 SATMLNASSSKEHVKWVHAEMV-----------------------NKNSELKLIYVTPEKIAKSKMFMSRLEKAYEAR-- 164 (591)
T ss_dssp CEEECCSSCCHHHHHHHHHHHH-----------------------CTTCCCCEEEECHHHHHSCHHHHHHHHHHHHTT--
T ss_pred cEEEEeCCCCHHHHHHHHHHhh-----------------------cccCCCCEEEEChhHhhccHHHHHHHHhhhhcc--
Confidence 9999999999888877777763 223478999999999986567777766554333
Q ss_pred cccccccccccccccccCCccEEEEeccccC
Q 042872 351 RLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV 381 (381)
Q Consensus 351 ~l~~~~~~~v~~~~~~~~~L~~lVIDEAHcI 381 (381)
++.+|||||||||
T Consensus 165 ------------------~i~~iViDEAH~i 177 (591)
T 2v1x_A 165 ------------------RFTRIAVDEVHCC 177 (591)
T ss_dssp ------------------CEEEEEEETGGGG
T ss_pred ------------------CCcEEEEECcccc
Confidence 8999999999996
|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bzb_A Conserved domain protein; transferase, phosphatase, phosphorylation, sporulation, antithetical, negative, regulator, spine; NMR {Bacillus anthracis} SCOP: a.30.7.1 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 381 | ||||
| d1oywa2 | 206 | c.37.1.19 (A:1-206) RecQ helicase domain {Escheric | 7e-06 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 2e-04 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 7e-04 |
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: RecQ helicase domain species: Escherichia coli [TaxId: 562]
Score = 44.2 bits (103), Expect = 7e-06
Identities = 20/42 (47%), Positives = 27/42 (64%)
Query: 220 IFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQDQI 261
FG + FRP Q + ++ +DC V++PTGGGKSLCYQ
Sbjct: 20 TFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPA 61
|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.88 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.86 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.85 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.84 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.84 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.84 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.81 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.8 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.8 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.8 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.69 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.54 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.51 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.11 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.07 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.01 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.98 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.87 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.82 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.47 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 98.3 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 98.16 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 98.08 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 97.93 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.13 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.03 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.95 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.73 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 96.02 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.01 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.71 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.61 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 93.92 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.58 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.27 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 92.48 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 92.33 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 92.12 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 92.06 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.89 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 91.71 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 91.31 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.06 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.89 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 90.83 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 90.33 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 90.3 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 90.13 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 89.9 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 89.36 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 89.34 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 89.3 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 88.94 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 88.72 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 88.21 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 87.95 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 87.89 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 87.76 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 87.69 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 87.34 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 87.2 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 87.13 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 86.73 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 86.71 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 86.5 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 86.46 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 86.35 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 85.9 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 85.83 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 85.31 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 84.88 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 83.95 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 83.57 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 83.54 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 81.82 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 81.45 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 80.69 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 80.48 |
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=6.9e-23 Score=187.92 Aligned_cols=127 Identities=19% Similarity=0.275 Sum_probs=101.1
Q ss_pred CCCCHHHHhhchHHHHHHHHHhCCCCCcHHHHHHHHHHHcCCCEEEECCCCCCchhhHH---------------------
Q 042872 200 GTLSFEELQALDDMEFANVVIFGNRAFRPLQHQACKASVAKQDCFVLLPTGGGKSLCYQ--------------------- 258 (381)
Q Consensus 200 ~~~~fe~L~~l~~l~~~~~~~fG~~~fRpiQ~eAI~aiL~GrDvLviaPTGsGKTLaF~--------------------- 258 (381)
...+|+.|..-+++..++.+ .||+.|+|+|.+|||.+++|+|+++.+|||||||+||+
T Consensus 15 ~~~sF~~l~L~~~l~~~L~~-~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~P 93 (222)
T d2j0sa1 15 VTPTFDTMGLREDLLRGIYA-YGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAP 93 (222)
T ss_dssp CCCSGGGGCCCHHHHHHHHH-HTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECS
T ss_pred CCCCHHHCCCCHHHHHHHHH-CCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecc
Confidence 34568888777777777755 89999999999999999999999999999999999998
Q ss_pred ---------HHHHHHHhhcCCcEEEEeCCCCHHHHHHHHHHHHhchhhhhhhhhhhhhhhhhhcccCCCCCccEEEECcc
Q 042872 259 ---------DQIITLNLKFGIPATFLNSQQTVSQAAAVLQELRQGLVLSQHYFLHQLIFVLTCASRKDKPSCKLLYVTPE 329 (381)
Q Consensus 259 ---------dQv~~L~~~~gI~a~~l~g~~~~~e~~~il~~lr~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~IL~aTPE 329 (381)
+.+..+....++++..+.|+.....+...++. +++|||+||+
T Consensus 94 treLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~-----------------------------~~~Ilv~TPg 144 (222)
T d2j0sa1 94 TRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDY-----------------------------GQHVVAGTPG 144 (222)
T ss_dssp SHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHH-----------------------------CCSEEEECHH
T ss_pred hHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhcc-----------------------------CCeEEeCCCC
Confidence 33455555567888888888887765544433 5799999999
Q ss_pred ccccCcchHHHHHHHHhcCCccccccccccccccccccCCccEEEEeccccC
Q 042872 330 RIVGNQSFSEVLKCLHRKGSIRLKVLTTDVVVLPHTCQRQLAGFVVDEAHCV 381 (381)
Q Consensus 330 rL~~~~~f~~~L~~L~~~g~~~l~~~~~~~v~~~~~~~~~L~~lVIDEAHcI 381 (381)
||.. +...+.+.++ ++.+|||||||++
T Consensus 145 rl~~----------~~~~~~~~~~---------------~l~~lVlDEaD~l 171 (222)
T d2j0sa1 145 RVFD----------MIRRRSLRTR---------------AIKMLVLDEADEM 171 (222)
T ss_dssp HHHH----------HHHTTSSCCT---------------TCCEEEEETHHHH
T ss_pred cHHh----------cccccccccc---------------cceeeeecchhHh
Confidence 9962 3345556666 9999999999963
|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|