Citrus Sinensis ID: 042991


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFDVRTIYSREIPVVIMSPEIILVRIDRYLEDGAEDSETCQMWARLRD
cccHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHcccccccccHHHHHHHHHccccEEEEcccccHHHHHHHHHcccccHHHHHHHHHHcc
ccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHccccccccccccEEccccccccEEEEEccccHHHHHHHHHccccccHHHHHHHHHcc
LNDSFVDRKVIERLLTISSsrdlycscsgrralqflgldeeqsangfdvrtiysreipvvimspeIILVRIDRyledgaedseTCQMWARLRD
LNDSFVDRKVIERLltisssrdlycSCSGRRALQflgldeeqsangfdvrtiysreipvvimspeIILVRIDRYledgaedsetcqmwarlrd
LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFDVRTIYSREIPVVIMSPEIILVRIDRYLEDGAEDSETCQMWARLRD
*****VDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFDVRTIYSREIPVVIMSPEIILVRIDRYLEDG***************
LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFDVRTIYSREIPVVIMSPEIILVRIDRYLEDGAEDSETCQMWARLR*
LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFDVRTIYSREIPVVIMSPEIILVRIDRYLEDGAEDSETCQMWARLRD
**DSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFDVRTIYSREIPVVIMSPEIILVRIDRYLEDGAEDSETCQMWARLR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFDVRTIYSREIPVVIMSPEIILVRIDRYLEDGAEDSETCQMWARLRD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q9ZWS6186 Two-component response re yes no 0.860 0.430 0.462 2e-12
Q9SB04184 Two-component response re no no 0.860 0.434 0.476 6e-12
O82798 259 Two-component response re no no 0.860 0.308 0.443 3e-11
Q9ZWS9231 Two-component response re no no 0.860 0.346 0.433 3e-11
Q7G8V2206 Two-component response re no no 0.860 0.388 0.424 3e-10
Q9ZWS7206 Two-component response re no no 0.860 0.388 0.433 5e-10
O80366234 Two-component response re no no 0.860 0.341 0.344 3e-06
O80365225 Two-component response re no no 0.860 0.355 0.359 5e-06
Q9FPR6153 Two-component response re no no 0.849 0.516 0.320 6e-06
Q9SHC2164 Two-component response re no no 0.849 0.481 0.333 2e-05
>sp|Q9ZWS6|ARR6_ARATH Two-component response regulator ARR6 OS=Arabidopsis thaliana GN=ARR6 PE=1 SV=2 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 61/106 (57%), Gaps = 26/106 (24%)

Query: 1   LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFD------VRTIYS 54
           ++DS VDRK IERLL +SS + +    S  RALQ+LGLD E+ + GF+      + T YS
Sbjct: 30  VDDSHVDRKFIERLLRVSSCK-VTVVDSATRALQYLGLDVEEKSVGFEDLKVNLIMTDYS 88

Query: 55  -------------------REIPVVIMSPEIILVRIDRYLEDGAED 81
                              RE+PVVIMS E IL RIDR LE+GAED
Sbjct: 89  MPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAED 134




Functions as response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SB04|ARR5_ARATH Two-component response regulator ARR5 OS=Arabidopsis thaliana GN=ARR5 PE=1 SV=2 Back     alignment and function description
>sp|O82798|ARR4_ARATH Two-component response regulator ARR4 OS=Arabidopsis thaliana GN=ARR4 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWS9|ARR3_ARATH Two-component response regulator ARR3 OS=Arabidopsis thaliana GN=ARR3 PE=2 SV=1 Back     alignment and function description
>sp|Q7G8V2|ARR15_ARATH Two-component response regulator ARR15 OS=Arabidopsis thaliana GN=ARR15 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWS7|ARR7_ARATH Two-component response regulator ARR7 OS=Arabidopsis thaliana GN=ARR7 PE=1 SV=1 Back     alignment and function description
>sp|O80366|ARR9_ARATH Two-component response regulator ARR9 OS=Arabidopsis thaliana GN=ARR9 PE=1 SV=1 Back     alignment and function description
>sp|O80365|ARR8_ARATH Two-component response regulator ARR8 OS=Arabidopsis thaliana GN=ARR8 PE=1 SV=1 Back     alignment and function description
>sp|Q9FPR6|ARR17_ARATH Two-component response regulator ARR17 OS=Arabidopsis thaliana GN=ARR17 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHC2|ARR16_ARATH Two-component response regulator ARR16 OS=Arabidopsis thaliana GN=ARR16 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
297733851 296 unnamed protein product [Vitis vinifera] 0.860 0.270 0.5 7e-14
224135725192 type-a arp3-like response regulator [Pop 0.860 0.416 0.509 9e-14
224135721 223 type-a response regulator [Populus trich 0.860 0.358 0.509 9e-14
296086487 221 unnamed protein product [Vitis vinifera] 0.860 0.361 0.509 1e-13
147768948 210 hypothetical protein VITISV_026384 [Viti 0.860 0.380 0.509 1e-13
33330864 254 type-A response regulator [Catharanthus 0.860 0.314 0.5 2e-13
255558348 258 two-component sensor protein histidine p 0.860 0.310 0.495 3e-13
255540813 221 two-component sensor protein histidine p 0.860 0.361 0.5 3e-13
225457164 222 PREDICTED: two-component response regula 0.860 0.360 0.5 6e-13
357477303 214 Two-component response regulator ARR5 [M 0.860 0.373 0.509 8e-13
>gi|297733851|emb|CBI15098.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 53/106 (50%), Positives = 64/106 (60%), Gaps = 26/106 (24%)

Query: 1   LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFD------VRTIYS 54
           ++DS VDRKVIERLL ISS + +    SG RALQFLGLD E+++ GFD      + T YS
Sbjct: 108 VDDSHVDRKVIERLLKISSCK-VTAVESGTRALQFLGLDGEENSVGFDGLKVNLIMTDYS 166

Query: 55  -------------------REIPVVIMSPEIILVRIDRYLEDGAED 81
                              R+IPVVIMS E IL RIDR LE+GAE+
Sbjct: 167 MPGMTGYELLKKIKESKAFRKIPVVIMSSENILTRIDRCLEEGAEE 212




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224135725|ref|XP_002322145.1| type-a arp3-like response regulator [Populus trichocarpa] gi|222869141|gb|EEF06272.1| type-a arp3-like response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224135721|ref|XP_002322144.1| type-a response regulator [Populus trichocarpa] gi|222869140|gb|EEF06271.1| type-a response regulator [Populus trichocarpa] gi|309951242|emb|CBX43991.1| putative A-type response regulator 10 [Populus x canadensis] Back     alignment and taxonomy information
>gi|296086487|emb|CBI32076.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147768948|emb|CAN69259.1| hypothetical protein VITISV_026384 [Vitis vinifera] Back     alignment and taxonomy information
>gi|33330864|gb|AAQ10675.1| type-A response regulator [Catharanthus roseus] Back     alignment and taxonomy information
>gi|255558348|ref|XP_002520201.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] gi|223540693|gb|EEF42256.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255540813|ref|XP_002511471.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] gi|223550586|gb|EEF52073.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225457164|ref|XP_002283787.1| PREDICTED: two-component response regulator ARR5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357477303|ref|XP_003608937.1| Two-component response regulator ARR5 [Medicago truncatula] gi|355509992|gb|AES91134.1| Two-component response regulator ARR5 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
TAIR|locus:2170723186 ARR6 "response regulator 6" [A 0.505 0.252 0.520 2.8e-15
TAIR|locus:2097870184 RR5 "response regulator 5" [Ar 0.505 0.255 0.530 6.7e-15
TAIR|locus:2025911 231 ARR3 "response regulator 3" [A 0.505 0.203 0.541 3.4e-14
TAIR|locus:2194584 259 ARR4 "response regulator 4" [A 0.505 0.181 0.541 4.8e-14
TAIR|locus:2027237206 ARR15 "response regulator 15" 0.483 0.218 0.565 7.3e-13
TAIR|locus:2011286206 ARR7 "response regulator 7" [A 0.473 0.213 0.577 1.4e-12
UNIPROTKB|Q4GZK2201 rr9 "Type A response regulator 0.451 0.208 0.522 3.9e-10
TAIR|locus:2080590 234 ARR9 "response regulator 9" [A 0.473 0.188 0.466 5.8e-10
TAIR|locus:2102509153 RR17 "response regulator 17" [ 0.473 0.287 0.4 1.4e-09
UNIPROTKB|Q4GZK7232 rr4 "Type A response regulator 0.290 0.116 0.629 2e-09
TAIR|locus:2170723 ARR6 "response regulator 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 109 (43.4 bits), Expect = 2.8e-15, Sum P(2) = 2.8e-15
 Identities = 25/48 (52%), Positives = 33/48 (68%)

Query:     1 LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSANGFD 48
             ++DS VDRK IERLL +SS +      S  RALQ+LGLD E+ + GF+
Sbjct:    30 VDDSHVDRKFIERLLRVSSCKVTVVD-SATRALQYLGLDVEEKSVGFE 76


GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS;TAS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA;TAS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;TAS
GO:0009735 "response to cytokinin stimulus" evidence=IEP
GO:0009736 "cytokinin mediated signaling pathway" evidence=RCA;IMP;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0007623 "circadian rhythm" evidence=RCA
TAIR|locus:2097870 RR5 "response regulator 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025911 ARR3 "response regulator 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2194584 ARR4 "response regulator 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027237 ARR15 "response regulator 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011286 ARR7 "response regulator 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4GZK2 rr9 "Type A response regulator 9" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
TAIR|locus:2080590 ARR9 "response regulator 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102509 RR17 "response regulator 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4GZK7 rr4 "Type A response regulator 4" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
ARR3
type-a response regulator (193 aa)
(Populus trichocarpa)
Predicted Functional Partners:
GA2ox7
gibberellin 2-oxidase (322 aa)
       0.510
eugene3.00140701
response regulator (144 aa)
       0.508
GA2ox5
gibberellin 2-oxidase (306 aa)
       0.508
GA2ox2
gibberellin 2-oxidase (322 aa)
       0.507
GA2ox4
gibberellin 2-oxidase (322 aa)
       0.506
GA2ox3
gibberellin 2-oxidase (332 aa)
       0.506
GA2ox1
hypothetical protein (332 aa)
       0.504
GA2ox6
gibberellin 2-oxidase (332 aa)
       0.504
gw1.XIII.1446.1
serine/threonine protein kinase (574 aa)
       0.502
eugene3.00180913
serine/threonine protein kinase (637 aa)
       0.502

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
PLN03029222 PLN03029, PLN03029, type-a response regulator prot 3e-12
>gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional Back     alignment and domain information
 Score = 59.3 bits (143), Expect = 3e-12
 Identities = 40/115 (34%), Positives = 57/115 (49%), Gaps = 35/115 (30%)

Query: 1   LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQSAN--------------- 45
           ++DS +DRK+IE+LL  SS + +    SG +AL+FLGL E+  +N               
Sbjct: 14  VDDSLIDRKLIEKLLKTSSYQ-VTTVDSGSKALKFLGLHEDDRSNPDTPSVSPNSHQEVE 72

Query: 46  --------------GFDV-----RTIYSREIPVVIMSPEIILVRIDRYLEDGAED 81
                         G+D+      +   R IPVVIMS E +  RI R LE+GAE+
Sbjct: 73  VNLIITDYCMPGMTGYDLLKKIKESSSLRNIPVVIMSSENVPSRITRCLEEGAEE 127


Length = 222

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
COG0745 229 OmpR Response regulators consisting of a CheY-like 99.76
COG4566202 TtrR Response regulator [Signal transduction mecha 99.74
COG2204 464 AtoC Response regulator containing CheY-like recei 99.64
COG4567182 Response regulator consisting of a CheY-like recei 99.54
PF00072112 Response_reg: Response regulator receiver domain; 99.54
COG4753 475 Response regulator containing CheY-like receiver d 99.5
COG3437 360 Response regulator containing a CheY-like receiver 99.44
COG4565 224 CitB Response regulator of citrate/malate metaboli 99.42
COG3706 435 PleD Response regulator containing a CheY-like rec 99.35
PRK09836 227 DNA-binding transcriptional activator CusR; Provis 99.28
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provis 99.27
PRK10529 225 DNA-binding transcriptional activator KdpE; Provis 99.26
PRK11173 237 two-component response regulator; Provisional 99.25
PRK10766 221 DNA-binding transcriptional regulator TorR; Provis 99.25
PLN03029222 type-a response regulator protein; Provisional 99.24
PRK10841924 hybrid sensory kinase in two-component regulatory 99.22
PRK09468 239 ompR osmolarity response regulator; Provisional 99.21
COG2197211 CitB Response regulator containing a CheY-like rec 99.21
KOG0519786 consensus Sensory transduction histidine kinase [S 99.2
PRK10046 225 dpiA two-component response regulator DpiA; Provis 99.2
PRK10701 240 DNA-binding transcriptional regulator RstA; Provis 99.19
PRK10161 229 transcriptional regulator PhoB; Provisional 99.19
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 99.18
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 99.18
PRK10336 219 DNA-binding transcriptional regulator QseB; Provis 99.18
PRK13856 241 two-component response regulator VirG; Provisional 99.18
TIGR03787 227 marine_sort_RR proteobacterial dedicated sortase s 99.18
PRK10643 222 DNA-binding transcriptional regulator BasR; Provis 99.17
PRK15347 921 two component system sensor kinase SsrA; Provision 99.16
TIGR01387 218 cztR_silR_copR heavy metal response regulator. Mem 99.15
PRK11083 228 DNA-binding response regulator CreB; Provisional 99.14
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory 99.13
PRK11517 223 transcriptional regulatory protein YedW; Provision 99.13
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 99.12
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provis 99.1
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 99.1
PRK15115 444 response regulator GlrR; Provisional 99.09
CHL00148 240 orf27 Ycf27; Reviewed 99.09
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 99.09
PRK11466 914 hybrid sensory histidine kinase TorS; Provisional 99.09
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.08
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 99.08
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 99.07
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 99.04
PRK10840216 transcriptional regulator RcsB; Provisional 99.03
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 99.03
PRK10365 441 transcriptional regulatory protein ZraR; Provision 99.02
PRK10430 239 DNA-binding transcriptional activator DcuR; Provis 99.02
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provis 98.98
PRK09581 457 pleD response regulator PleD; Reviewed 98.95
PRK13558 665 bacterio-opsin activator; Provisional 98.95
PRK09483 217 response regulator; Provisional 98.94
PRK15479 221 transcriptional regulatory protein TctD; Provision 98.94
PRK09581 457 pleD response regulator PleD; Reviewed 98.94
COG3947 361 Response regulator containing CheY-like receiver a 98.94
PRK11091 779 aerobic respiration control sensor protein ArcB; P 98.93
PRK09935210 transcriptional regulator FimZ; Provisional 98.87
TIGR02875 262 spore_0_A sporulation transcription factor Spo0A. 98.85
PRK09390202 fixJ response regulator FixJ; Provisional 98.84
PRK13837828 two-component VirA-like sensor kinase; Provisional 98.83
PRK12555 337 chemotaxis-specific methylesterase; Provisional 98.8
PRK11475 207 DNA-binding transcriptional activator BglJ; Provis 98.78
PRK14084 246 two-component response regulator; Provisional 98.78
COG3707194 AmiR Response regulator with putative antiterminat 98.7
COG2201 350 CheB Chemotaxis response regulator containing a Ch 98.69
PRK00742 354 chemotaxis-specific methylesterase; Provisional 98.68
PRK11697 238 putative two-component response-regulatory protein 98.65
PRK10610129 chemotaxis regulatory protein CheY; Provisional 98.62
PRK10651216 transcriptional regulator NarL; Provisional 98.61
PRK15369211 two component system sensor kinase SsrB; Provision 98.6
PRK10403215 transcriptional regulator NarP; Provisional 98.58
PRK13435145 response regulator; Provisional 98.51
PRK10693 303 response regulator of RpoS; Provisional 98.47
cd00156113 REC Signal receiver domain; originally thought to 98.46
PRK13557540 histidine kinase; Provisional 98.37
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 98.27
PRK09191261 two-component response regulator; Provisional 98.24
PRK15411207 rcsA colanic acid capsular biosynthesis activation 98.04
PRK15029 755 arginine decarboxylase; Provisional 97.6
COG3279 244 LytT Response regulator of the LytR/AlgR family [T 97.1
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 96.63
PF03709115 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal 93.55
TIGR03815 322 CpaE_hom_Actino helicase/secretion neighborhood Cp 91.91
smart0044855 REC cheY-homologous receiver domain. CheY regulate 91.1
COG3706 435 PleD Response regulator containing a CheY-like rec 90.79
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 90.76
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 90.45
PRK00208250 thiG thiazole synthase; Reviewed 89.05
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 87.34
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 86.09
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 84.51
PRK12704 520 phosphodiesterase; Provisional 84.5
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 81.13
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
Probab=99.76  E-value=1.4e-17  Score=102.09  Aligned_cols=86  Identities=15%  Similarity=0.144  Sum_probs=74.6

Q ss_pred             CCCcHHHHHHHHHHHhhcCCCceEEeCCHHHHHHHhccCccc---------CCCchHHHhhhh----cCCcEEEEcCCCC
Q 042991            1 LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQ---------SANGFDVRTIYS----REIPVVIMSPEII   67 (93)
Q Consensus         1 vdd~~~~~~~l~~~l~~~~~~~v~~~~~~~~a~~~~~~~~~~---------~~~~~d~l~~~~----~~~pii~lt~~~~   67 (93)
                      |||++..+..+..+|+..||+ +.++.++.+|++.+... ++         +++|++++..+.    ..+|||++|+.++
T Consensus         6 veDd~~i~~~l~~~L~~~g~~-v~~~~~~~~a~~~~~~~-~dlviLD~~lP~~dG~~~~~~iR~~~~~~~PIi~Lta~~~   83 (229)
T COG0745           6 VEDDPELAELLKEYLEEEGYE-VDVAADGEEALEAAREQ-PDLVLLDLMLPDLDGLELCRRLRAKKGSGPPIIVLTARDD   83 (229)
T ss_pred             EcCCHHHHHHHHHHHHHCCCE-EEEECCHHHHHHHHhcC-CCEEEEECCCCCCCHHHHHHHHHhhcCCCCcEEEEECCCc
Confidence            689999999999999999999 99999999999998754 32         345666644333    7789999999999


Q ss_pred             HHHHHHHHHcCCcceeeccch
Q 042991           68 LVRIDRYLEDGAEDSETCQMW   88 (93)
Q Consensus        68 ~~~~~~~~~~ga~d~l~kP~~   88 (93)
                      ..+.+.+++.|||||++|||+
T Consensus        84 ~~d~v~gl~~GADDYl~KPf~  104 (229)
T COG0745          84 EEDRVLGLEAGADDYLTKPFS  104 (229)
T ss_pred             HHHHHHHHhCcCCeeeeCCCC
Confidence            999999999999999999998



>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.82
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.69
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.65
3rqi_A184 Response regulator protein; structural genomics, s 99.64
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.64
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.6
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.6
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.59
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.59
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.58
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.58
2lpm_A123 Two-component response regulator; transcription re 99.58
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.58
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 99.57
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.57
3gt7_A154 Sensor protein; structural genomics, signal receiv 99.57
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 99.56
3r0j_A 250 Possible two component system response transcript 99.56
3snk_A135 Response regulator CHEY-like protein; P-loop conta 99.55
3lua_A140 Response regulator receiver protein; two-component 99.54
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.54
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.54
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.54
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.53
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.53
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.53
1xhf_A123 DYE resistance, aerobic respiration control protei 99.53
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.53
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.53
3jte_A143 Response regulator receiver protein; structural ge 99.52
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.52
3hdg_A137 Uncharacterized protein; two-component sensor acti 99.52
3luf_A259 Two-component system response regulator/ggdef doma 99.52
3eq2_A 394 Probable two-component response regulator; adaptor 99.52
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 99.51
3heb_A152 Response regulator receiver domain protein (CHEY); 99.51
1mb3_A124 Cell division response regulator DIVK; signal tran 99.51
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 99.51
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.51
3hdv_A136 Response regulator; PSI-II, structural genomics, P 99.51
1yio_A208 Response regulatory protein; transcription regulat 99.5
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 99.5
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.5
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.5
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 99.49
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.49
3f6c_A134 Positive transcription regulator EVGA; structural 99.49
3i42_A127 Response regulator receiver domain protein (CHEY- 99.48
3q9s_A 249 DNA-binding response regulator; DNA binding protei 99.48
1mvo_A136 PHOP response regulator; phosphate regulon, transc 99.48
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.48
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 99.48
3grc_A140 Sensor protein, kinase; protein structure initiati 99.48
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 99.48
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 99.48
1w25_A 459 Stalked-cell differentiation controlling protein; 99.47
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 99.47
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 99.46
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 99.46
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-bindin 99.46
2hqr_A 223 Putative transcriptional regulator; phosporylation 99.46
2rjn_A154 Response regulator receiver:metal-dependent phosph 99.46
1dz3_A130 Stage 0 sporulation protein A; response regulator, 99.45
2pln_A137 HP1043, response regulator; signaling protein; 1.8 99.45
2qxy_A142 Response regulator; regulation of transcription, N 99.45
3c3m_A138 Response regulator receiver protein; structural ge 99.45
2qr3_A140 Two-component system response regulator; structura 99.44
3cnb_A143 DNA-binding response regulator, MERR family; signa 99.44
3h5i_A140 Response regulator/sensory box protein/ggdef domai 99.44
3lte_A132 Response regulator; structural genomics, PSI, prot 99.44
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 99.43
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 99.43
3a10_A116 Response regulator; phosphoacceptor, signaling pro 99.43
3eul_A152 Possible nitrate/nitrite response transcriptional 99.43
2zay_A147 Response regulator receiver protein; structural ge 99.43
1s8n_A205 Putative antiterminator; RV1626, structural genomi 99.43
3cz5_A153 Two-component response regulator, LUXR family; str 99.42
3nhm_A133 Response regulator; protein structure initiative I 99.42
4dad_A146 Putative pilus assembly-related protein; response 99.41
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 99.41
2oqr_A 230 Sensory transduction protein REGX3; response regul 99.41
3cg0_A140 Response regulator receiver modulated diguanylate 99.41
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 99.4
1ys7_A 233 Transcriptional regulatory protein PRRA; response 99.4
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 99.39
2gwr_A 238 DNA-binding response regulator MTRA; two-component 99.38
3cg4_A142 Response regulator receiver domain protein (CHEY-; 99.37
3n53_A140 Response regulator receiver modulated diguanylate; 99.37
2qsj_A154 DNA-binding response regulator, LUXR family; struc 99.36
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 99.35
3bre_A 358 Probable two-component response regulator; protein 99.35
3c3w_A 225 Two component transcriptional regulatory protein; 99.35
2gkg_A127 Response regulator homolog; social motility, recei 99.35
3luf_A 259 Two-component system response regulator/ggdef doma 99.34
3eqz_A135 Response regulator; structural genomics, unknown f 99.32
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription 99.32
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 99.27
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 99.26
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 99.26
2rdm_A132 Response regulator receiver protein; structural ge 99.23
2qv0_A143 Protein MRKE; structural genomics, transcription, 99.22
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 99.21
3c97_A140 Signal transduction histidine kinase; structural g 99.18
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 99.18
3klo_A 225 Transcriptional regulator VPST; REC domain, HTH do 99.15
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.15
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 99.14
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 99.12
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; 97.95
1w25_A 459 Stalked-cell differentiation controlling protein; 97.67
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 96.08
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 95.63
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 93.06
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 90.02
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 89.17
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
Probab=99.82  E-value=1.8e-19  Score=101.73  Aligned_cols=89  Identities=18%  Similarity=0.192  Sum_probs=75.0

Q ss_pred             CCCcHHHHHHHHHHHhhcCCCceEEeCCHHHHHHHhccCcc---------cCCCchHHHhhh-----hcCCcEEEEcCCC
Q 042991            1 LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEE---------QSANGFDVRTIY-----SREIPVVIMSPEI   66 (93)
Q Consensus         1 vdd~~~~~~~l~~~l~~~~~~~v~~~~~~~~a~~~~~~~~~---------~~~~~~d~l~~~-----~~~~pii~lt~~~   66 (93)
                      |||++..+..++.+|+..||+.+..+.+|.+|++.++..++         ++++|++++..+     .+++|||++|+..
T Consensus        18 VDD~~~~r~~l~~~L~~~G~~~v~~a~~g~~al~~~~~~~~DlillD~~MP~mdG~el~~~ir~~~~~~~ipvI~lTa~~   97 (134)
T 3to5_A           18 VDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEA   97 (134)
T ss_dssp             ECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHHHCCSEEEEESCCSSSCHHHHHHHHHHSTTTTTCCEEEEESSC
T ss_pred             EeCCHHHHHHHHHHHHHcCCcEEEEECCHHHHHHHHHhCCCCEEEEcCCCCCCCHHHHHHHHHhCCCCCCCeEEEEECCC
Confidence            68999999999999999998647789999999999875443         245677764332     2789999999999


Q ss_pred             CHHHHHHHHHcCCcceeeccchh
Q 042991           67 ILVRIDRYLEDGAEDSETCQMWA   89 (93)
Q Consensus        67 ~~~~~~~~~~~ga~d~l~kP~~~   89 (93)
                      +.+...+++++|+++|+.||++.
T Consensus        98 ~~~~~~~~~~~Ga~~yl~KP~~~  120 (134)
T 3to5_A           98 KREQIIEAAQAGVNGYIVKPFTA  120 (134)
T ss_dssp             CHHHHHHHHHTTCCEEEESSCCH
T ss_pred             CHHHHHHHHHCCCCEEEECCCCH
Confidence            99999999999999999999973



>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.83
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.83
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.83
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.82
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.82
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.82
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.82
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.81
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.81
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.81
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.81
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.8
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.8
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.8
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.79
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.79
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.78
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.78
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.77
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.76
d1s8na_190 Probable two-component system transcriptional regu 99.76
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.76
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.76
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.75
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.75
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.75
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.74
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.7
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.69
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.68
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.66
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.6
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.6
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.57
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 85.18
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 80.33
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 80.22
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: Transcriptional regulatory protein DctD, receiver domain
species: Sinorhizobium meliloti [TaxId: 382]
Probab=99.83  E-value=3.7e-20  Score=103.84  Aligned_cols=87  Identities=17%  Similarity=0.189  Sum_probs=76.5

Q ss_pred             CCCcHHHHHHHHHHHhhcCCCceEEeCCHHHHHHHhccCccc---------CCCchHH---HhhhhcCCcEEEEcCCCCH
Q 042991            1 LNDSFVDRKVIERLLTISSSRDLYCSCSGRRALQFLGLDEEQ---------SANGFDV---RTIYSREIPVVIMSPEIIL   68 (93)
Q Consensus         1 vdd~~~~~~~l~~~l~~~~~~~v~~~~~~~~a~~~~~~~~~~---------~~~~~d~---l~~~~~~~pii~lt~~~~~   68 (93)
                      |||++..+..++.+|+..||. +..+.|+.+|++.++...++         +++|+++   ++...+++|||++|++++.
T Consensus         6 VDDd~~~~~~l~~~L~~~g~~-v~~~~~~~~al~~l~~~~~dlil~D~~mP~~~G~el~~~lr~~~~~~pvI~lT~~~~~   84 (140)
T d1qkka_           6 IDDDRDLRKAMQQTLELAGFT-VSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILALDPDLPMILVTGHGDI   84 (140)
T ss_dssp             ECSCHHHHHHHHHHHHHTTCE-EEEESCHHHHHHTCCTTCCSEEEEESCCSSSCHHHHHHHHHHHCTTSCEEEEECGGGH
T ss_pred             EECCHHHHHHHHHHHHHCCCE-EEEeCChHHHHHHHhccCcchHHHhhccCCCCHHHHHHHHHHhCCCCcEEEEECCCCH
Confidence            689999999999999999999 99999999999999765432         4567776   3344489999999999999


Q ss_pred             HHHHHHHHcCCcceeeccch
Q 042991           69 VRIDRYLEDGAEDSETCQMW   88 (93)
Q Consensus        69 ~~~~~~~~~ga~d~l~kP~~   88 (93)
                      +...+|++.||+|||.||+.
T Consensus        85 ~~~~~a~~~Ga~dyl~KP~~  104 (140)
T d1qkka_          85 PMAVQAIQDGAYDFIAKPFA  104 (140)
T ss_dssp             HHHHHHHHTTCCEEEESSCC
T ss_pred             HHHHHHHHcCCCEeecCCCC
Confidence            99999999999999999986



>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure