Citrus Sinensis ID: 043110
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| 255571988 | 603 | dead box ATP-dependent RNA helicase, put | 0.898 | 0.470 | 0.756 | 1e-122 | |
| 225444645 | 600 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.952 | 0.501 | 0.728 | 1e-121 | |
| 224145000 | 594 | predicted protein [Populus trichocarpa] | 0.895 | 0.476 | 0.766 | 1e-120 | |
| 297738524 | 584 | unnamed protein product [Vitis vinifera] | 0.905 | 0.489 | 0.708 | 1e-116 | |
| 297824007 | 609 | hypothetical protein ARALYDRAFT_483128 [ | 0.958 | 0.497 | 0.633 | 1e-108 | |
| 357472211 | 613 | DEAD-box ATP-dependent RNA helicase [Med | 0.927 | 0.477 | 0.665 | 1e-108 | |
| 356558435 | 591 | PREDICTED: LOW QUALITY PROTEIN: DEAD-box | 0.898 | 0.480 | 0.683 | 1e-107 | |
| 356530461 | 596 | PREDICTED: LOW QUALITY PROTEIN: DEAD-box | 0.892 | 0.473 | 0.693 | 1e-105 | |
| 15226735 | 609 | DEAD-box ATP-dependent RNA helicase 17 [ | 0.958 | 0.497 | 0.616 | 1e-105 | |
| 218195957 | 591 | hypothetical protein OsI_18162 [Oryza sa | 0.914 | 0.489 | 0.634 | 1e-103 |
| >gi|255571988|ref|XP_002526935.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223533687|gb|EEF35422.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 443 bits (1140), Expect = e-122, Method: Compositional matrix adjust.
Identities = 217/287 (75%), Positives = 244/287 (85%), Gaps = 3/287 (1%)
Query: 30 EIFASCCFSSLGLDSTLCDQLRERLGFEAPTKVQAQAIPVILSGRDVLVNAATGTGKTVA 89
E+FASC F +LGL TLCDQLRER+GFEAPT VQAQAIPV+LSGR VLVNAATGTGKTVA
Sbjct: 26 EMFASCSFLNLGLHPTLCDQLRERMGFEAPTTVQAQAIPVVLSGRHVLVNAATGTGKTVA 85
Query: 90 YLAPIINHLQSYSPRIDRSSGTFALVLVPTSELCLLVYEILQKLLHRFRWIVPGYVMGGG 149
YLAPII+HLQSYSPRI+R+ GTFALVLVPT ELCL VYEILQ LLHRF WIVPGY+MGG
Sbjct: 86 YLAPIIHHLQSYSPRIERAHGTFALVLVPTRELCLQVYEILQGLLHRFHWIVPGYIMGGE 145
Query: 150 NRSKEKARLRKGISILVATPGHLLDHLKHTSSFLHTNLRWIIFDEADRILELGFGKEIEE 209
+RSKEKARLRKGISILVATPG LLDHLK+TSSF HTNLRWIIFDEADRILELGFGKEIE+
Sbjct: 146 SRSKEKARLRKGISILVATPGRLLDHLKNTSSFSHTNLRWIIFDEADRILELGFGKEIED 205
Query: 210 ILDILGSRNIASIGEGNE---VSNVKRQNLLLSATLNEKVNHLTKISLETPVLIGLDEKK 266
ILD+LGSR S+G+GN +SN +RQNLLLSATLNEKVNHL ISLE PV+IGLD++K
Sbjct: 206 ILDLLGSRLTRSVGKGNRDSSISNYQRQNLLLSATLNEKVNHLANISLENPVMIGLDDEK 265
Query: 267 FPEDKSNVHFGSLESDVKEEVEHPNTTLSSSTEDFMLPAKLVQRYVK 313
+ H SL+SD +E+EHP+ L ST DF +P +LVQ+YVK
Sbjct: 266 MQPEPLLEHTKSLKSDADDELEHPSKVLKPSTGDFKVPVQLVQKYVK 312
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225444645|ref|XP_002277600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 17-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224145000|ref|XP_002325490.1| predicted protein [Populus trichocarpa] gi|222862365|gb|EEE99871.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297738524|emb|CBI27769.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297824007|ref|XP_002879886.1| hypothetical protein ARALYDRAFT_483128 [Arabidopsis lyrata subsp. lyrata] gi|297325725|gb|EFH56145.1| hypothetical protein ARALYDRAFT_483128 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357472211|ref|XP_003606390.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355507445|gb|AES88587.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356558435|ref|XP_003547512.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 17-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356530461|ref|XP_003533799.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 17-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15226735|ref|NP_181602.1| DEAD-box ATP-dependent RNA helicase 17 [Arabidopsis thaliana] gi|75327220|sp|Q7XJN0.1|RH17_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 17 gi|330254771|gb|AEC09865.1| DEAD-box ATP-dependent RNA helicase 17 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|218195957|gb|EEC78384.1| hypothetical protein OsI_18162 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| TAIR|locus:2064844 | 609 | AT2G40700 [Arabidopsis thalian | 0.892 | 0.463 | 0.652 | 1.8e-96 | |
| DICTYBASE|DDB_G0271708 | 908 | ddx31 "DEAD/DEAH box helicase" | 0.765 | 0.266 | 0.464 | 3.6e-54 | |
| UNIPROTKB|F8WAJ0 | 722 | DDX31 "Probable ATP-dependent | 0.734 | 0.321 | 0.483 | 3.8e-53 | |
| UNIPROTKB|Q9H8H2 | 851 | DDX31 "Probable ATP-dependent | 0.734 | 0.272 | 0.483 | 1.2e-52 | |
| RGD|1304895 | 682 | Ddx31 "DEAD (Asp-Glu-Ala-Asp) | 0.724 | 0.335 | 0.464 | 1.7e-50 | |
| UNIPROTKB|F1N5H8 | 736 | DDX31 "Uncharacterized protein | 0.708 | 0.304 | 0.481 | 5.8e-50 | |
| ZFIN|ZDB-GENE-030131-3973 | 739 | ddx31 "DEAD (Asp-Glu-Ala-Asp) | 0.712 | 0.304 | 0.466 | 1.4e-49 | |
| FB|FBgn0027602 | 975 | CG8611 [Drosophila melanogaste | 0.724 | 0.234 | 0.452 | 6e-49 | |
| UNIPROTKB|F1S0U0 | 784 | DDX31 "Uncharacterized protein | 0.844 | 0.340 | 0.414 | 8.5e-49 | |
| UNIPROTKB|F1NM06 | 690 | DDX31 "Uncharacterized protein | 0.854 | 0.391 | 0.414 | 1.8e-48 |
| TAIR|locus:2064844 AT2G40700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 959 (342.6 bits), Expect = 1.8e-96, P = 1.8e-96
Identities = 186/285 (65%), Positives = 234/285 (82%)
Query: 31 IFASCCFSSLGLDSTLCDQLRERLGFEAPTKVQAQAIPVILSGRDVLVNAATGTGKTVAY 90
+FASC FSSLGLD+ L DQL+ER+GFEAPT VQAQAIPVILSGRDVLVNA TGTGKT+AY
Sbjct: 25 LFASCSFSSLGLDTKLSDQLKERMGFEAPTLVQAQAIPVILSGRDVLVNAPTGTGKTIAY 84
Query: 91 LAPIINHLQSYSPRIDRSSGTFALVLVPTSELCLLVYEILQKLLHRFRWIVPGYVMGGGN 150
LAP+I+HLQ +SP++DRS GTFALV+VPT ELCL VYE L+KLLHRF WIVPGYVMGG
Sbjct: 85 LAPLIHHLQGHSPKVDRSHGTFALVIVPTRELCLQVYETLEKLLHRFHWIVPGYVMGGEK 144
Query: 151 RSKEKARLRKGISILVATPGHLLDHLKHTSSFLHTNLRWIIFDEADRILELGFGKEIEEI 210
++KEKARLRKGISIL+ATPG LLDHLK+T+SF+H NLRW+IFDEAD ILELG+GKEIE+I
Sbjct: 145 KAKEKARLRKGISILIATPGRLLDHLKNTASFVHKNLRWVIFDEADSILELGYGKEIEQI 204
Query: 211 LDILGSRNIASIGEGNEV--SNVKRQNLLLSATLNEKVNHLTKISLETPVLIGLDEKKFP 268
+ +LGS GE +++ +++QNLLLSATLN+KVN L K+SL+ PV+IGLD K
Sbjct: 205 IKLLGSGQNEQ-GEEDDIVPKGIQKQNLLLSATLNDKVNDLAKLSLDDPVMIGLDNTKLQ 263
Query: 269 EDKSNVHFGSLESDVKEEVEHPNTTLSSSTEDFMLPAKLVQRYVK 313
++ S + +SD ++ V H N + + +ED+ +P++LVQRY++
Sbjct: 264 QNLSIESPAAPDSDAEDMVIHVNKSANPLSEDYGIPSQLVQRYLR 308
|
|
| DICTYBASE|DDB_G0271708 ddx31 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8WAJ0 DDX31 "Probable ATP-dependent RNA helicase DDX31" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H8H2 DDX31 "Probable ATP-dependent RNA helicase DDX31" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1304895 Ddx31 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 31" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N5H8 DDX31 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3973 ddx31 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 31" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027602 CG8611 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S0U0 DDX31 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NM06 DDX31 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 5e-65 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 2e-57 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 5e-47 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 5e-40 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 1e-38 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 4e-37 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 2e-31 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 1e-30 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 1e-30 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 7e-30 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 8e-30 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 5e-28 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 2e-27 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-24 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 1e-17 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 1e-12 | |
| COG1201 | 814 | COG1201, Lhr, Lhr-like helicases [General function | 6e-12 | |
| PRK13767 | 876 | PRK13767, PRK13767, ATP-dependent helicase; Provis | 1e-05 | |
| COG1199 | 654 | COG1199, DinG, Rad3-related DNA helicases [Transcr | 2e-05 | |
| TIGR03817 | 742 | TIGR03817, DECH_helic, helicase/secretion neighbor | 3e-05 | |
| COG1204 | 766 | COG1204, COG1204, Superfamily II helicase [General | 4e-05 | |
| pfam04851 | 100 | pfam04851, ResIII, Type III restriction enzyme, re | 2e-04 | |
| TIGR04121 | 803 | TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA | 3e-04 |
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
Score = 203 bits (518), Expect = 5e-65
Identities = 87/224 (38%), Positives = 124/224 (55%), Gaps = 22/224 (9%)
Query: 37 FSSLGLDSTLCDQLRERLGFEAPTKVQAQAIPVILSGRDVLVNAATGTGKTVAYLAPIIN 96
F LGL L + LGFE PT +QA+AIP +LSGRDV+ A TG+GKT A+L PI+
Sbjct: 1 FEELGLSPELLRGIYA-LGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILE 59
Query: 97 HLQSYSPRIDRSSGTFALVLVPTSELCLLVYEILQKLLHRFRWIVPGYVMGGGNRSKEKA 156
L + G AL+L PT EL L + E+ +K L + + + GG + K+
Sbjct: 60 KLDPS----PKKDGPQALILAPTRELALQIAEVARK-LGKHTNLKVVVIYGGTSIDKQIR 114
Query: 157 RLRKGISILVATPGHLLDHLKHTSSFLHTNLRWIIFDEADRILELGFGKEIEEILDILGS 216
+L++G I+VATPG LLD L+ L +++++ DEADR+L++GF +I EIL +L
Sbjct: 115 KLKRGPHIVVATPGRLLDLLERGKLDLS-KVKYLVLDEADRMLDMGFEDQIREILKLL-- 171
Query: 217 RNIASIGEGNEVSNVKRQNLLLSATLNEKVNHLTKISLETPVLI 260
RQ LL SAT+ ++V L + L PV I
Sbjct: 172 -------------PKDRQTLLFSATMPKEVRDLARKFLRNPVRI 202
|
A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 100.0 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 100.0 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 100.0 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 100.0 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 100.0 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| PTZ00110 | 545 | helicase; Provisional | 100.0 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 100.0 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 100.0 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 100.0 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 100.0 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 100.0 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 100.0 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| PTZ00424 | 401 | helicase 45; Provisional | 100.0 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 100.0 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 100.0 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 100.0 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 100.0 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 100.0 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 100.0 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.98 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 99.97 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.97 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.96 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.96 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.96 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.95 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.95 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.95 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.95 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.95 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.95 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.94 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.94 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.94 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.93 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.93 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.93 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.93 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.92 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.91 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 99.91 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.9 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.89 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 99.89 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.89 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.89 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.89 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.87 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.85 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.84 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.83 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.83 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.82 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.82 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.81 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.79 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.78 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 99.78 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.78 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.78 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.77 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.77 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 99.77 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.76 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.76 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.74 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 99.74 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.74 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 99.72 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 99.7 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 99.7 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.69 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 99.69 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.63 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 99.62 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.61 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.6 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.6 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.59 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.57 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.56 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.55 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.53 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.48 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.45 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.43 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 99.43 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 99.42 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 99.39 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 99.38 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 99.35 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 99.33 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 99.33 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 99.29 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 99.27 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 99.27 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 99.26 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.26 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.24 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 99.22 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.2 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 99.2 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 99.19 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 99.08 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 99.06 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 99.06 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 99.06 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.03 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 98.99 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 98.98 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 98.97 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 98.91 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 98.91 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 98.82 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 98.78 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 98.77 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 98.76 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 98.75 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 98.68 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 98.66 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.59 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 98.5 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 98.47 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 98.45 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.45 | |
| KOG2340 | 698 | consensus Uncharacterized conserved protein [Funct | 98.42 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 98.42 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 98.4 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 98.4 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 98.33 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 98.32 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 98.31 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 98.3 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 98.29 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 98.26 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 98.22 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 98.22 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 98.14 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 98.12 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.12 | |
| KOG0392 | 1549 | consensus SNF2 family DNA-dependent ATPase domain- | 98.1 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 98.08 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 98.08 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 98.06 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 98.05 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 98.05 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 97.99 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 97.98 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 97.97 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.95 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 97.92 | |
| KOG1132 | 945 | consensus Helicase of the DEAD superfamily [Replic | 97.92 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 97.9 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 97.89 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 97.84 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.79 | |
| KOG0388 | 1185 | consensus SNF2 family DNA-dependent ATPase [Replic | 97.75 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.71 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 97.67 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 97.65 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 97.64 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 97.59 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 97.55 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.5 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 97.48 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 97.34 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 97.3 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.29 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 97.28 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.25 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 97.23 | |
| PRK06526 | 254 | transposase; Provisional | 97.21 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 97.18 | |
| PRK08181 | 269 | transposase; Validated | 97.17 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.15 | |
| PF14617 | 252 | CMS1: U3-containing 90S pre-ribosomal complex subu | 97.15 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 97.14 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.08 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.06 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 97.0 | |
| KOG0953 | 700 | consensus Mitochondrial RNA helicase SUV3, DEAD-bo | 96.82 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.78 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 96.77 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.76 | |
| KOG1131 | 755 | consensus RNA polymerase II transcription initiati | 96.76 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.72 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.72 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.71 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.68 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.67 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 96.57 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.54 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.54 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.5 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 96.5 | |
| PF03354 | 477 | Terminase_1: Phage Terminase ; InterPro: IPR005021 | 96.48 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.48 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 96.47 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 96.44 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.44 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.44 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 96.43 | |
| COG3421 | 812 | Uncharacterized protein conserved in bacteria [Fun | 96.35 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 96.32 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.31 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.31 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 96.28 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.24 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.24 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 96.21 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 96.18 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.18 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 96.17 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.17 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 96.15 | |
| PHA03333 | 752 | putative ATPase subunit of terminase; Provisional | 96.15 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.12 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 96.11 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 96.11 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.1 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 96.1 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 96.09 | |
| PHA03372 | 668 | DNA packaging terminase subunit 1; Provisional | 96.03 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.03 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.01 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 95.99 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 95.97 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 95.94 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 95.93 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.9 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 95.9 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 95.88 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 95.88 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 95.86 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.78 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 95.77 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.76 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.75 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.75 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.73 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.72 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.69 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 95.66 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 95.65 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.65 | |
| KOG1133 | 821 | consensus Helicase of the DEAD superfamily [Replic | 95.6 | |
| TIGR01547 | 396 | phage_term_2 phage terminase, large subunit, PBSX | 95.59 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.58 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 95.5 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.5 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 95.46 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.45 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.41 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 95.39 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.28 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 95.25 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 95.25 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 95.23 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 95.22 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.2 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 95.18 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.18 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 95.14 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.13 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 95.12 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 95.11 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.03 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 95.01 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 94.96 | |
| PF13173 | 128 | AAA_14: AAA domain | 94.95 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.92 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 94.9 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.89 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 94.87 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.86 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 94.85 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 94.83 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 94.81 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 94.78 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 94.75 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 94.71 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 94.67 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 94.63 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 94.61 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 94.6 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 94.56 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 94.52 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 94.51 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.51 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 94.5 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.47 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 94.44 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 94.35 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 94.33 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.3 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 94.3 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 94.28 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 94.26 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 94.24 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 94.23 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 94.14 | |
| KOG1015 | 1567 | consensus Transcription regulator XNP/ATRX, DEAD-b | 94.13 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 94.13 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 94.13 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 94.09 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 94.06 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.04 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 94.02 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 94.01 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 94.01 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 94.0 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 93.99 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 93.89 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 93.89 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 93.81 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 93.76 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 93.74 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 93.71 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 93.71 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 93.7 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.69 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 93.66 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 93.64 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 93.62 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 93.55 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 93.51 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 93.5 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 93.5 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 93.47 | |
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 93.45 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 93.37 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 93.33 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 93.29 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 93.25 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 93.21 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 93.19 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 93.17 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 93.13 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 93.07 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 93.07 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 93.06 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 92.99 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 92.93 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 92.89 | |
| PHA00012 | 361 | I assembly protein | 92.88 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 92.87 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.76 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 92.75 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 92.75 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 92.7 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 92.69 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 92.67 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 92.66 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 92.63 | |
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 92.59 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 92.59 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 92.51 | |
| PRK09087 | 226 | hypothetical protein; Validated | 92.45 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 92.38 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 92.37 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 92.36 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 92.33 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 92.32 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 92.29 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 92.27 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 92.26 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 92.22 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 92.22 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 92.2 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 92.13 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 92.12 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 92.12 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 92.03 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 91.97 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 91.96 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 91.89 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 91.79 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 91.76 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 91.76 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 91.74 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 91.72 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 91.72 | |
| PRK13764 | 602 | ATPase; Provisional | 91.69 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 91.69 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 91.59 | |
| COG4626 | 546 | Phage terminase-like protein, large subunit [Gener | 91.57 | |
| PTZ00293 | 211 | thymidine kinase; Provisional | 91.57 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 91.54 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 91.52 | |
| PF03237 | 384 | Terminase_6: Terminase-like family; InterPro: IPR0 | 91.5 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 91.49 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 91.48 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 91.44 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 91.35 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 91.32 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 91.24 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 91.2 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 91.01 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 90.98 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 90.98 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 90.97 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 90.83 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 90.81 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 90.78 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 90.71 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 90.71 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 90.67 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 90.66 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 90.65 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 90.62 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 90.57 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 90.55 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 90.51 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 90.51 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 90.5 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 90.39 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 90.37 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 90.33 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 90.24 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 90.24 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 90.21 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 90.06 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 90.02 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 89.96 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 89.96 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 89.95 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 89.95 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 89.84 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 89.83 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 89.77 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 89.63 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 89.52 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 89.37 | |
| KOG2036 | 1011 | consensus Predicted P-loop ATPase fused to an acet | 89.33 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 89.17 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 89.17 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 89.08 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 88.94 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 88.79 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 88.79 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 88.75 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 88.65 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 88.62 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 88.51 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 88.14 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 88.06 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 88.06 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 87.81 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 87.79 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 87.78 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 87.69 | |
| PRK13876 | 663 | conjugal transfer coupling protein TraG; Provision | 87.54 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 87.49 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 87.47 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 87.39 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 87.38 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 87.38 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 87.33 | |
| PRK13695 | 174 | putative NTPase; Provisional | 87.23 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 87.23 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 87.19 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 87.12 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 87.11 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 87.03 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 86.89 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 86.87 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 86.84 | |
| COG1674 | 858 | FtsK DNA segregation ATPase FtsK/SpoIIIE and relat | 86.84 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 86.82 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 86.75 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 86.74 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 86.73 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 86.71 | |
| COG2842 | 297 | Uncharacterized ATPase, putative transposase [Gene | 86.55 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 86.51 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 86.28 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 86.27 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 86.25 | |
| TIGR02767 | 623 | TraG-Ti Ti-type conjugative transfer system protie | 86.24 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 86.06 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 85.79 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 85.76 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 85.74 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 85.65 |
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-52 Score=373.58 Aligned_cols=273 Identities=48% Similarity=0.784 Sum_probs=235.3
Q ss_pred ccccccCCcccCCCCHHHHHHHHHHcCCCCCcHHHHHHHHHHhCCCcEEEEcCCCCchHHHHHHHHHHHhhhcCCCCCCC
Q 043110 29 KEIFASCCFSSLGLDSTLCDQLRERLGFEAPTKVQAQAIPVILSGRDVLVNAATGTGKTVAYLAPIINHLQSYSPRIDRS 108 (316)
Q Consensus 29 ~~~~~~~~f~~~~l~~~l~~~l~~~~g~~~p~~~Q~~~i~~il~g~d~li~a~TGsGKT~~~~lp~l~~l~~~~~~~~~~ 108 (316)
+.++..+.|..+||++.+...|..+|++..||.+|+++||.+++|+|+++.++||||||++|++|+++.+....++..+.
T Consensus 130 e~~fts~~f~~LGL~~~lv~~L~~~m~i~~pTsVQkq~IP~lL~grD~lV~aQTGSGKTLAYllPiVq~Lq~m~~ki~Rs 209 (708)
T KOG0348|consen 130 EAPFTSAAFASLGLHPHLVSHLNTKMKISAPTSVQKQAIPVLLEGRDALVRAQTGSGKTLAYLLPIVQSLQAMEPKIQRS 209 (708)
T ss_pred ccccccccchhcCCCHHHHHHHHHHhccCccchHhhcchhhhhcCcceEEEcCCCCcccHHHHHHHHHHHHhcCcccccc
Confidence 34588899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCeeEEEEeCChHHHHHHHHHHHHHHhhcCCceeEEeeCCCChHHHHHHHhcCCcEEEeCcHHHHHHHhcCCccccCcee
Q 043110 109 SGTFALVLVPTSELCLLVYEILQKLLHRFRWIVPGYVMGGGNRSKEKARLRKGISILVATPGHLLDHLKHTSSFLHTNLR 188 (316)
Q Consensus 109 ~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~IlV~Tp~~l~~~l~~~~~~~~~~l~ 188 (316)
.|+.|||++||||||.|+|+.++++...+.|++.++++||.....+..++++|++|+|+|||||++++.+...+.++.++
T Consensus 210 ~G~~ALVivPTREL~~Q~y~~~qKLl~~~hWIVPg~lmGGEkkKSEKARLRKGiNILIgTPGRLvDHLknT~~i~~s~LR 289 (708)
T KOG0348|consen 210 DGPYALVIVPTRELALQIYETVQKLLKPFHWIVPGVLMGGEKKKSEKARLRKGINILIGTPGRLVDHLKNTKSIKFSRLR 289 (708)
T ss_pred CCceEEEEechHHHHHHHHHHHHHHhcCceEEeeceeecccccccHHHHHhcCceEEEcCchHHHHHHhccchheeeeee
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEecchhhhcCCcHHHHHHHHHHhccCcccccCCCCccccccceEEEEeeecchhHHHHHHHhcCCCEEEEcCCCCCC
Q 043110 189 WIIFDEADRILELGFGKEIEEILDILGSRNIASIGEGNEVSNVKRQNLLLSATLNEKVNHLTKISLETPVLIGLDEKKFP 268 (316)
Q Consensus 189 ~lViDEad~l~~~~~~~~i~~i~~~l~~~~~~~~~~~~~~~~~~~q~i~~SAT~~~~v~~~~~~~l~~p~~i~~~~~~~~ 268 (316)
|||+||||++++.||..++..|++.+.+.. +..-.....+...|.+++|||+++.|.+++...|+||++|..+.....
T Consensus 290 wlVlDEaDrlleLGfekdit~Il~~v~~~~--~~e~~~~~lp~q~q~mLlSATLtd~V~rLa~~sLkDpv~I~ld~s~~~ 367 (708)
T KOG0348|consen 290 WLVLDEADRLLELGFEKDITQILKAVHSIQ--NAECKDPKLPHQLQNMLLSATLTDGVNRLADLSLKDPVYISLDKSHSQ 367 (708)
T ss_pred EEEecchhHHHhccchhhHHHHHHHHhhcc--chhcccccccHHHHhHhhhhhhHHHHHHHhhccccCceeeeccchhhh
Confidence 999999999999999999999999996421 111112223446899999999999999999999999999996554311
Q ss_pred CCCCCcccccccchhhhhhcCCCCC-CCCCCCccccCcceeeeEEee
Q 043110 269 EDKSNVHFGSLESDVKEEVEHPNTT-LSSSTEDFMLPAKLVQRYVKG 314 (316)
Q Consensus 269 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~q~~~~~ 314 (316)
. .+. .+ .+++.+.. -....+.|.+|..|.|+|+.+
T Consensus 368 ~---------~p~-~~-a~~ev~~~~~~~~l~~~~iPeqL~qry~vV 403 (708)
T KOG0348|consen 368 L---------NPK-DK-AVQEVDDGPAGDKLDSFAIPEQLLQRYTVV 403 (708)
T ss_pred c---------Ccc-hh-hhhhcCCcccccccccccCcHHhhhceEec
Confidence 1 111 11 11111222 112235689999999999875
|
|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG2340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >COG3421 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PHA03333 putative ATPase subunit of terminase; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PHA03372 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PHA00012 I assembly protein | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG4626 Phage terminase-like protein, large subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00293 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13876 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG1674 FtsK DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 316 | ||||
| 3ly5_A | 262 | Ddx18 Dead-Domain Length = 262 | 1e-36 | ||
| 3ber_A | 249 | Human Dead-Box Rna-Helicase Ddx47, Conserved Domain | 8e-32 | ||
| 2pl3_A | 236 | Human Dead-Box Rna Helicase Ddx10, Dead Domain In C | 2e-28 | ||
| 1wrb_A | 253 | Crystal Structure Of The N-Terminal Reca-Like Domai | 3e-26 | ||
| 3fe2_A | 242 | Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D | 7e-26 | ||
| 4a4d_A | 253 | Crystal Structure Of The N-Terminal Domain Of The H | 8e-26 | ||
| 2gxq_A | 207 | Hera N-Terminal Domain In Complex With Amp, Crystal | 1e-24 | ||
| 3mwj_A | 207 | Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap | 3e-24 | ||
| 3iuy_A | 228 | Crystal Structure Of Ddx53 Dead-Box Domain Length = | 3e-24 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 4e-24 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 2e-22 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 1e-21 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 2e-21 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 2e-21 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 6e-21 | ||
| 1vec_A | 206 | Crystal Structure Of The N-Terminal Domain Of RckP5 | 2e-20 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 9e-19 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 5e-17 | ||
| 1qde_A | 224 | Crystal Structure Of The Atpase Domain Of Translati | 6e-17 | ||
| 1qva_A | 223 | Yeast Initiation Factor 4a N-Terminal Domain Length | 6e-17 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 3e-16 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 3e-16 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 4e-16 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 4e-16 | ||
| 1q0u_A | 219 | Crystal Structure Of The Bstdead N-Terminal Domain | 6e-16 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 6e-16 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 1e-15 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 1e-15 | ||
| 3bor_A | 237 | Crystal Structure Of The Deadc Domain Of Human Tran | 2e-15 | ||
| 3dkp_A | 245 | Human Dead-Box Rna-Helicase Ddx52, Conserved Domain | 3e-15 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 3e-15 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 1e-14 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 2e-14 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 7e-14 | ||
| 2oxc_A | 230 | Human Dead-Box Rna Helicase Ddx20, Dead Domain In C | 1e-13 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 2e-13 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 2e-13 | ||
| 2g9n_A | 221 | Structure Of The Dead Domain Of Human Eukaryotic In | 1e-12 | ||
| 1t6n_A | 220 | Crystal Structure Of The N-Terminal Domain Of Human | 1e-12 | ||
| 2kbe_A | 226 | Solution Structure Of Amino-Terminal Domain Of Dbp5 | 4e-09 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 2e-08 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 2e-08 | ||
| 3fhc_B | 235 | Crystal Structure Of Human Dbp5 In Complex With Nup | 4e-08 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 5e-08 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 5e-08 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 5e-08 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 6e-08 | ||
| 3fmo_B | 300 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 7e-08 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 2e-06 |
| >pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 | Back alignment and structure |
|
| >pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 | Back alignment and structure |
| >pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 | Back alignment and structure |
| >pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 | Back alignment and structure |
| >pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 | Back alignment and structure |
| >pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 | Back alignment and structure |
| >pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 | Back alignment and structure |
| >pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 | Back alignment and structure |
| >pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 | Back alignment and structure |
| >pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 | Back alignment and structure |
| >pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 | Back alignment and structure |
| >pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 | Back alignment and structure |
| >pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 9e-74 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 3e-73 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 7e-66 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 7e-65 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 1e-63 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 2e-54 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 4e-53 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 7e-53 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 8e-53 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 1e-52 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 3e-52 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 2e-49 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 8e-49 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 4e-48 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 1e-47 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 2e-44 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 7e-44 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 2e-43 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 6e-43 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 2e-42 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 4e-42 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 6e-42 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 2e-41 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 4e-41 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 4e-40 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 2e-39 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 7e-39 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 4e-38 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 1e-37 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 3e-37 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 4e-37 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 3e-12 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 7e-10 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 1e-09 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 1e-09 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 2e-09 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 2e-09 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 2e-08 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 3e-07 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 9e-07 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 5e-06 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 2e-05 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 3e-05 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 7e-05 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 7e-05 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 2e-04 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 3e-04 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 5e-04 |
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
Score = 226 bits (579), Expect = 9e-74
Identities = 88/261 (33%), Positives = 146/261 (55%), Gaps = 22/261 (8%)
Query: 4 QPLNSQTISKKKKRNDKMSKKKETVKEIFASCCFSSLG--LDSTLCDQLRERLGFEAPTK 61
Q +N+ + ++ + F F+SL ++ ++E +GF T+
Sbjct: 21 QSMNNVEKPDNDEDESEVPSLPLGLTGAFEDTSFASLCNLVNENTLKAIKE-MGFTNMTE 79
Query: 62 VQAQAIPVILSGRDVLVNAATGTGKTVAYLAPIINHLQSYSPRIDRSSGTFALVLVPTSE 121
+Q ++I +L GRD+L A TG+GKT+A+L P + + R +GT L+L PT E
Sbjct: 80 IQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELI--VKLRFMPRNGTGVLILSPTRE 137
Query: 122 LCLLVYEILQKLLHRFRWIVPGYVMGGGNRSKEKARLRKGISILVATPGHLLDHLKHTSS 181
L + + +L++L+ G +MGG NRS E +L GI+I+VATPG LLDH+++T
Sbjct: 138 LAMQTFGVLKELM-THHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPG 196
Query: 182 FLHTNLRWIIFDEADRILELGFGKEIEEILDILGSRNIASIGEGNEVSNVKRQNLLLSAT 241
F++ NL+ ++ DEADRIL++GF +E+++I+ +L + +RQ +L SAT
Sbjct: 197 FMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPT---------------RRQTMLFSAT 241
Query: 242 LNEKVNHLTKISLE-TPVLIG 261
KV L +ISL+ P+ +G
Sbjct: 242 QTRKVEDLARISLKKEPLYVG 262
|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 100.0 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 100.0 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 100.0 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 100.0 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 100.0 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 100.0 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 100.0 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 100.0 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 100.0 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 100.0 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 100.0 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 100.0 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 100.0 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 100.0 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 100.0 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 100.0 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 100.0 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 100.0 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 100.0 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 100.0 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 100.0 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 100.0 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 100.0 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 100.0 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 100.0 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 100.0 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 100.0 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 100.0 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.98 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.96 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.96 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.96 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.95 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.95 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.95 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.95 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.95 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.94 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.94 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.94 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.94 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.93 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.93 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.93 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.93 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.93 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.93 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.93 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.92 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.92 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.92 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.91 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.91 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.9 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.89 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.89 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.89 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.89 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.87 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.86 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.85 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.84 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.83 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.81 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.8 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.8 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.8 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.78 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.77 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.77 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.75 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.74 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.72 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.65 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.62 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.61 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.53 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.46 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.44 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.43 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.33 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.12 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 98.28 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 98.25 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 98.24 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 98.18 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 98.14 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 98.03 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 97.58 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 97.37 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.11 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 97.07 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 97.0 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 96.93 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.69 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 96.69 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 96.68 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 96.67 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.58 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 96.48 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.4 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.38 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 96.36 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 96.29 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.09 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.09 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 96.04 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.02 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 96.01 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.01 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 95.93 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.7 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 95.66 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 95.57 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.46 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 95.44 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.43 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 95.4 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 95.26 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.24 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.22 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 95.15 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.08 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.98 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 94.94 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 94.86 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 94.81 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 94.58 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 94.55 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.37 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 94.33 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 94.25 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 94.25 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 94.15 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 94.14 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 94.14 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.13 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 94.04 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 94.04 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 94.02 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 93.98 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 93.64 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 93.54 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 93.4 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 93.39 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 93.31 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 92.97 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 92.58 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 92.24 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 92.21 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 92.0 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 91.47 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 91.28 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 91.13 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 91.11 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 91.06 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 90.76 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 90.68 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 90.63 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 90.07 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 90.04 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 89.22 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 89.13 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 88.89 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 88.48 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 88.27 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 88.14 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 87.98 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 87.87 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 87.54 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 87.11 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 87.04 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 86.75 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 86.63 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 86.61 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 86.59 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 86.49 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 86.46 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 86.4 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 86.27 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 86.26 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 86.2 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 86.18 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 86.17 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 86.11 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 86.07 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 86.03 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 85.94 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 85.89 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 85.88 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 85.8 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 85.65 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 85.55 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 85.39 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 85.33 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 85.27 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 85.16 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 85.11 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 85.1 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 85.1 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 84.8 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 84.7 | |
| 3hjh_A | 483 | Transcription-repair-coupling factor; MFD, mutatio | 84.68 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 84.67 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 84.61 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 84.3 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 83.96 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 83.49 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 83.4 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 83.37 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 83.34 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 83.16 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 83.09 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 82.76 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 82.27 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 82.03 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 82.0 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 81.88 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 81.85 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 81.63 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 81.55 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 81.4 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 81.3 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 81.04 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 80.65 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 80.4 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 80.29 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 80.21 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 80.05 |
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-41 Score=295.33 Aligned_cols=214 Identities=33% Similarity=0.538 Sum_probs=191.3
Q ss_pred ccCCcccCCCCHHHHHHHHHHcCCCCCcHHHHHHHHHHhCCCcEEEEcCCCCchHHHHHHHHHHHhhhcCCCCCCCCCee
Q 043110 33 ASCCFSSLGLDSTLCDQLRERLGFEAPTKVQAQAIPVILSGRDVLVNAATGTGKTVAYLAPIINHLQSYSPRIDRSSGTF 112 (316)
Q Consensus 33 ~~~~f~~~~l~~~l~~~l~~~~g~~~p~~~Q~~~i~~il~g~d~li~a~TGsGKT~~~~lp~l~~l~~~~~~~~~~~~~~ 112 (316)
...+|+++++++.+.+.+ .++||..|+++|.++++.+++|+|+++++|||+|||++|++|++..+..... .....+++
T Consensus 27 ~~~~f~~~~l~~~l~~~l-~~~g~~~~~~~Q~~~i~~~~~g~~~l~~apTGsGKT~~~~l~~l~~l~~~~~-~~~~~~~~ 104 (242)
T 3fe2_A 27 PVLNFYEANFPANVMDVI-ARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPF-LERGDGPI 104 (242)
T ss_dssp CCSSTTTTTCCHHHHHHH-HTTTCCSCCHHHHHHHHHHHHTCCEEEEECTTSCHHHHHHHHHHHHHHTSCC-CCTTCCCS
T ss_pred ccCCHhhcCCCHHHHHHH-HHCCCCCCCHHHHHHHHHHhCCCCEEEECCCcCHHHHHHHHHHHHHHHhccc-cccCCCCE
Confidence 446799999999999999 6789999999999999999999999999999999999999999999875332 22345778
Q ss_pred EEEEeCChHHHHHHHHHHHHHHhhcCCceeEEeeCCCChHHHHHHHhcCCcEEEeCcHHHHHHHhcCCccccCceeEEEE
Q 043110 113 ALVLVPTSELCLLVYEILQKLLHRFRWIVPGYVMGGGNRSKEKARLRKGISILVATPGHLLDHLKHTSSFLHTNLRWIIF 192 (316)
Q Consensus 113 ~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~IlV~Tp~~l~~~l~~~~~~~~~~l~~lVi 192 (316)
+||++||++|+.|+++.++.++...+ ......+||.....+...+..+++|+|+||+++.+++.. ....+.+++++|+
T Consensus 105 ~lil~Pt~~L~~Q~~~~~~~~~~~~~-~~~~~~~g~~~~~~~~~~~~~~~~I~v~Tp~~l~~~l~~-~~~~~~~~~~lVi 182 (242)
T 3fe2_A 105 CLVLAPTRELAQQVQQVAAEYCRACR-LKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEC-GKTNLRRTTYLVL 182 (242)
T ss_dssp EEEECSSHHHHHHHHHHHHHHHHHTT-CCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHH-TSCCCTTCCEEEE
T ss_pred EEEEeCcHHHHHHHHHHHHHHHhhcC-ceEEEEECCCChHHHHHHhcCCCCEEEECHHHHHHHHHc-CCCCcccccEEEE
Confidence 99999999999999999999987754 566778889888888888888999999999999999976 4456789999999
Q ss_pred ecchhhhcCCcHHHHHHHHHHhccCcccccCCCCccccccceEEEEeeecchhHHHHHHHhcCCCEEEEcCCC
Q 043110 193 DEADRILELGFGKEIEEILDILGSRNIASIGEGNEVSNVKRQNLLLSATLNEKVNHLTKISLETPVLIGLDEK 265 (316)
Q Consensus 193 DEad~l~~~~~~~~i~~i~~~l~~~~~~~~~~~~~~~~~~~q~i~~SAT~~~~v~~~~~~~l~~p~~i~~~~~ 265 (316)
||||++++++|...+..+++.++. .+|+++||||+|+.+.++++.++++|+.|.++..
T Consensus 183 DEah~l~~~~~~~~~~~i~~~~~~---------------~~q~~~~SAT~~~~~~~~~~~~l~~~~~i~~~~~ 240 (242)
T 3fe2_A 183 DEADRMLDMGFEPQIRKIVDQIRP---------------DRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 240 (242)
T ss_dssp TTHHHHHHTTCHHHHHHHHTTSCS---------------SCEEEEEESCCCHHHHHHHHHHCSSCEEEEECC-
T ss_pred eCHHHHhhhCcHHHHHHHHHhCCc---------------cceEEEEEeecCHHHHHHHHHHCCCCEEEEecCC
Confidence 999999999999999999988876 8899999999999999999999999999998765
|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 316 | ||||
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 3e-39 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 2e-38 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 2e-37 | |
| d1wrba1 | 238 | c.37.1.19 (A:164-401) putative ATP-dependent RNA h | 3e-35 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 3e-34 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 8e-34 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 7e-33 | |
| d1s2ma1 | 206 | c.37.1.19 (A:46-251) Putative ATP-dependent RNA he | 2e-29 | |
| d1oywa2 | 206 | c.37.1.19 (A:1-206) RecQ helicase domain {Escheric | 2e-27 | |
| d1q0ua_ | 209 | c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR | 2e-25 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 5e-25 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 2e-19 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 4e-13 | |
| d1wp9a1 | 200 | c.37.1.19 (A:1-200) putative ATP-dependent RNA hel | 1e-12 | |
| d2fz4a1 | 206 | c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc | 3e-04 | |
| d1yksa1 | 140 | c.37.1.14 (A:185-324) YFV helicase domain {Yellow | 4e-04 |
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Putative DEAD box RNA helicase species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Score = 135 bits (341), Expect = 3e-39
Identities = 63/225 (28%), Positives = 111/225 (49%), Gaps = 27/225 (12%)
Query: 37 FSSLGLDSTLCDQLRERLGFEAPTKVQAQAIPVILSGR-DVLVNAATGTGKTVAYLAPII 95
F+ L L + + +R GFE PT +Q + IP+ L+ +++ A TG+GKT ++ P+I
Sbjct: 6 FNELNLSDNILNAIRN-KGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 64
Query: 96 NHLQSYSPRIDRSSGTFALVLVPTSELCLLVYEILQKLLHRFRWIVPGYVMGGGNRSKEK 155
+ + G A++L PT EL + V + ++ L + + GG +
Sbjct: 65 ELVNENN-------GIEAIILTPTRELAIQVADEIESLKGNKNLKI--AKIYGGKAIYPQ 115
Query: 156 ARLRKGISILVATPGHLLDHLKHTSSFLHTNLRWIIFDEADRILELGFGKEIEEILDILG 215
+ K +I+V TPG +LDH+ + L N+++ I DEAD +L +GF K++E+IL+
Sbjct: 116 IKALKNANIVVGTPGRILDHINRGTLNLK-NVKYFILDEADEMLNMGFIKDVEKILNACN 174
Query: 216 SRNIASIGEGNEVSNVKRQNLLLSATLNEKVNHLTKISLETPVLI 260
++ LL SAT+ ++ +L K + I
Sbjct: 175 K---------------DKRILLFSATMPREILNLAKKYMGDYSFI 204
|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 100.0 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 100.0 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 100.0 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 100.0 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 100.0 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 100.0 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 100.0 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 100.0 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.97 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.96 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.96 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.93 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.83 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.81 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.8 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.75 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.74 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.74 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.63 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.19 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 99.11 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.06 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 99.03 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.4 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.87 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.56 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.15 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.9 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.8 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.65 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.61 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.58 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.55 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.47 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.4 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 96.37 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.27 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.91 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.69 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.64 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.53 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 95.48 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.3 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.46 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 94.19 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 93.71 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 93.68 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 93.53 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 93.37 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 93.16 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 92.89 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.4 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.39 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 92.11 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 91.78 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 91.63 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.25 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.21 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.18 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 91.13 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 91.03 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 90.72 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 90.15 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 89.45 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 88.89 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 88.69 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 88.25 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 88.1 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 87.9 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 87.8 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 86.97 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 86.48 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 85.72 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 85.72 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 85.67 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 85.5 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 85.47 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 85.39 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 85.32 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 85.08 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 85.06 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 84.87 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 84.65 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 84.4 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 84.34 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 84.26 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 83.84 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 83.73 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 83.18 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 82.59 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 82.46 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 82.43 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 81.86 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 81.37 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 80.99 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 80.51 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 80.1 |
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.5e-49 Score=334.47 Aligned_cols=211 Identities=29% Similarity=0.485 Sum_probs=192.1
Q ss_pred ccccccCCcccCCCCHHHHHHHHHHcCCCCCcHHHHHHHHHHhCCCcEEEEcCCCCchHHHHHHHHHHHhhhcCCCCCCC
Q 043110 29 KEIFASCCFSSLGLDSTLCDQLRERLGFEAPTKVQAQAIPVILSGRDVLVNAATGTGKTVAYLAPIINHLQSYSPRIDRS 108 (316)
Q Consensus 29 ~~~~~~~~f~~~~l~~~l~~~l~~~~g~~~p~~~Q~~~i~~il~g~d~li~a~TGsGKT~~~~lp~l~~l~~~~~~~~~~ 108 (316)
++.....+|+++||+++++++| +++||..|||+|+++||.+++|+|++++||||||||+||++|+++.+... .
T Consensus 11 ~~~~~~~sF~~l~L~~~l~~~L-~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~------~ 83 (222)
T d2j0sa1 11 EEVDVTPTFDTMGLREDLLRGI-YAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ------V 83 (222)
T ss_dssp TTCCCCCSGGGGCCCHHHHHHH-HHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT------S
T ss_pred CCCCCCCCHHHCCCCHHHHHHH-HHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccc------c
Confidence 3455667899999999999999 66799999999999999999999999999999999999999999988653 2
Q ss_pred CCeeEEEEeCChHHHHHHHHHHHHHHhhcCCceeEEeeCCCChHHHHHHHhcCCcEEEeCcHHHHHHHhcCCccccCcee
Q 043110 109 SGTFALVLVPTSELCLLVYEILQKLLHRFRWIVPGYVMGGGNRSKEKARLRKGISILVATPGHLLDHLKHTSSFLHTNLR 188 (316)
Q Consensus 109 ~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~IlV~Tp~~l~~~l~~~~~~~~~~l~ 188 (316)
..++++|++||+|||.|+++.++.++.... ..+...+||.....+...+..+++|+|+|||++.+++.. ....+++++
T Consensus 84 ~~~~~lil~PtreLa~Qi~~~~~~l~~~~~-i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~-~~~~~~~l~ 161 (222)
T d2j0sa1 84 RETQALILAPTRELAVQIQKGLLALGDYMN-VQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRR-RSLRTRAIK 161 (222)
T ss_dssp CSCCEEEECSSHHHHHHHHHHHHHHTTTTT-CCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHT-TSSCCTTCC
T ss_pred cCceeEEecchHHHHHHHHHHHHHHhCccc-eeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccc-cccccccce
Confidence 467799999999999999999999987644 677788899999888888999999999999999999877 566778999
Q ss_pred EEEEecchhhhcCCcHHHHHHHHHHhccCcccccCCCCccccccceEEEEeeecchhHHHHHHHhcCCCEEEEcC
Q 043110 189 WIIFDEADRILELGFGKEIEEILDILGSRNIASIGEGNEVSNVKRQNLLLSATLNEKVNHLTKISLETPVLIGLD 263 (316)
Q Consensus 189 ~lViDEad~l~~~~~~~~i~~i~~~l~~~~~~~~~~~~~~~~~~~q~i~~SAT~~~~v~~~~~~~l~~p~~i~~~ 263 (316)
++|+||||+|++.+|.+++..|++.+++ .+|+++||||+|+++.++++.+|++|+.|.+.
T Consensus 162 ~lVlDEaD~ll~~~f~~~i~~I~~~l~~---------------~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V~ 221 (222)
T d2j0sa1 162 MLVLDEADEMLNKGFKEQIYDVYRYLPP---------------ATQVVLISATLPHEILEMTNKFMTDPIRILVK 221 (222)
T ss_dssp EEEEETHHHHTSTTTHHHHHHHHTTSCT---------------TCEEEEEESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred eeeecchhHhhhcCcHHHHHHHHHhCCC---------------CCEEEEEEEeCCHHHHHHHHHHCCCCEEEEEe
Confidence 9999999999999999999999999987 89999999999999999999999999998764
|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|