Citrus Sinensis ID: 043164


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------105
MDPGRYGLQQGWDNNSALEGYGAIHEPNFRVGGSYDERRFLDERYSRDNIYPRNAFQRENYPPPPVGLWPQSRRRNYEEDYSLDRESRRHEKPYIDSYHEMDAYCGHEIDSFPEFDKFRDGYRNIENYRDHGFERPPRFGGRDRDRDDYDDYDYRSRSSHQSREDSREGDCDFGRLSYDSDYDRGSRRDGSWRRHESRDRERDKRCLSRERELSPHRRHEHSASRSQSRSRSRGRDDRPRSRSPRGRSHGRSHREDSYDDGRYERIEKRRDREERRQREHYAVAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGSDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSILGPGSGMSASSQSSSLAAAAIEAAAFSQQYDAVGWAPKEYNPDDKQPTRGQEQRSDGDMVQKDGLALQSGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPCTDQNDNKTSGNGSEPSKQVDGGSKNRKVVISAPAATVSSVEKPASLPDAVQAAATAAIAAEKKGKEKSKEVKVVSKSTIVANKKKLNNATMWKQWSHDNQQSASADDRPGPAGQASKTKFKSDSAATKENNTFSSGAGAPTAIPQAVGLDSPVKSKPVSSTSGGTLMGVIRNSGRGFQPGSSGGLSASSTAPPSSAGSSSSVNSDTITAVTPFRTDASALGSYTPPVATGSGKRRFSEMPLPPATQKEQPQTTYRDRAAERRSLYGSSFSAGDDLPDVGSGDSNRDFALKKGSVDSMPFPPGVGGRGFTADSVQSYEVITADKAIDENNVGNRMLRSMGWHEGLGLGKDGSGMIEPVQAQAMDSRAGLGSQQKKVDPSLEVQAGDSYKTLIHKKALARFREMS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccEEEEEcccHHccHHHHHHHHHHccccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccccEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHccccccEEEEEEcccccccccEEEEEEccHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEcccccEEEEEEcccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHccccHHHHHccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccEEEEEcccccccHHHHHHHHHHccccEEEEEEEEcccccccEEEEEEcccHHHHHHHHHHHccccccccccEEEEEEccccccccccccHHHHccccccccccccccHHHHHHHcccccHcccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEcEEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccccccccEEEEEEEccccccccccccccccHHHHHccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEccccccEEEcccccEEEcccccEEEccccEEEEEccccEEEEEEcccccccHcccccccccccccccccccEEEEccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccHHcccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccHHHccccccccccHHHHHccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHccccccccccccHHHccccccccHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccEEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcc
mdpgryglqqgwdnnsalegygaihepnfrvggsyderrflderysrdniyprnafqrenyppppvglwpqsrrrnyeedysldresrrhekpyidsyhemdaycgheidsfpefdkfrdgyrnienyrdhgferpprfggrdrdrddyddydyrsrsshqsredsregdcdfgrlsydsdydrgsrrdgswrrhesrdreRDKRCLsrerelsphrrhehsasrsqsrsrsrgrddrprsrsprgrshgrshredsyddgryeRIEKRRDREERRQRehyavapsgtivvkglsqkttEEDLYQILAEWGPLRHVRVIkernsgvsrgfafidfpsvGAARAMMDrigddglvvDGRKLFfeysskptggsgghygqesamgarhsnhkstipcdwmcticgcvnfarrtscfqcneartddappaemnssnpiplgkkgsdtgptHVLVVRGLDEYADEEMLRYEfskhapikdlrlvrdkfthvsrgfAFLHFHSVEDASKAleatngttlekNGQILRVAYAKsilgpgsgmsassqSSSLAAAAIEAAAFSQQydavgwapkeynpddkqptrgqeqrsdgdmvqkdglalqsgfvwdeasgyyydaasgfyydgntglyydgnsgiwysydqqtqqyipctdqndnktsgngsepskqvdggsknrkvvisapaatvssvekpaslpDAVQAAATAAIAAEKKGKEKSKEVKVVSKSTIVANKKKLNNATMWKQwshdnqqsasaddrpgpagqasktkfksdsaatkenntfssgagaptaipqavgldspvkskpvsstsggtlmgvirnsgrgfqpgssgglsasstappssagssssvnsdtitavtpfrtdasalgsytppvatgsgkrrfsemplppatqkeqpqttyRDRAAERRslygssfsagddlpdvgsgdsnrdfalkkgsvdsmpfppgvggrgftadsVQSYEVITAdkaidennvgnRMLRsmgwheglglgkdgsgmiepVQAQAMdsraglgsqqkkvdpslevqagdsyKTLIHKKALARFREMS
mdpgryglQQGWDNNSALEGYGAihepnfrvggsyDERRFLDERysrdniyprnafqrenyppppvglwpqsrrRNYEedysldresrrhekPYIDSYHEMDAYCGHEIDSFPEFDKFRDGYRNIenyrdhgferpprfggrdrdrddyddydyrsrsshqsredsregdcdfgrlsydsdydrgsrrdgswrrhesrdrerdkrclsrerelsphrrhehsasrsqsrsrsrgrddrprsrsprgrshgrshredsyddgryeriekrrdreerrqrehyavapsgtivvkglsqkTTEEDLYQILaewgplrhvRVIKErnsgvsrgfafIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEysskptggsgGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEartddappaemNSSNPiplgkkgsdtgPTHVLVVRGLDEYADEEMLRYEfskhapikdlRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSILGPGSGMSASSQSSSLAAAAIEAAAFSQQYDAVGWAPKEYNPDDKQPTRGQEQRSDGDMVQKDGLALQSGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPCTDQNDNKTSGNgsepskqvdggsknrKVVISApaatvssvekpaSLPDAVQAAATAAIAaekkgkekskevkvvskstivankkklnnaTMWKQWSHDNQQSASADDRPGPAGQAsktkfksdsaATKEnntfssgagapTAIPQAVGLDSPVKSKPVSSTSGGTLMGVIRNSGRGFQPGSSGGLSASSTAPpssagssssvnsdTITAVTPfrtdasalgsytppvatgsgkrrfsemplppatqkeqpqttYRDRAAERRSLYgssfsagddlpdvgSGDSNRDFALKKGSVDSMPFPPGVGGRGFTADSVQSYEVITadkaidennvgNRMLRSMGWHEGLGLGKDGSGMIEPVQAQAMDSRAGlgsqqkkvdpslevqagdsyktliHKKALARFREMS
MDPGRYGLQQGWDNNSALEGYGAIHEPNFRVGGSYDERRFLDERYSRDNIYPRNAFQRENYPPPPVGLWPQSRRRNYEEDYSLDRESRRHEKPYIDSYHEMDAYCGHEIDSFPEFDKFRDGYRNIENYRDHGFERPPRFGGrdrdrddyddydyrsrssHQSREDSREGDCDFGRLsydsdydrgsrrdgswrrHESRDRERDKRCLSRERELsphrrhehsasrsqsrsrsrgrddrprsrsprgrshgrshredsYDDGryeriekrrdreerrqreHYAVAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGSDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSILGPGsgmsassqssslaaaaieaaafsQQYDAVGWAPKEYNPDDKQPTRGQEQRSDGDMVQKDGLALQSGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPCTDQNDNKTSGNGSEPSKQVDGGSKNRKVVISAPAATVSSVEKPASLPDAVQaaataaiaaekkgkekskevkvvsksTIVANKKKLNNATMWKQWSHDNQQSASADDRPGPAGQASKTKFKSDSAATKENNTFSSGAGAPTAIPQAVGLDspvkskpvsstsggtLMGVIRNSGRGFQpgssgglsasstappssagssssVNSDTITAVTPFRTDASALGSYTPPVATGSGKRRFSEMPLPPATQKEQPQTTYRDRAAERRSLYGSSFSAGDDLPDVGSGDSNRDFALKKGSVDSMPFPPGVGGRGFTADSVQSYEVITADKAIDENNVGNRMLRSMGWHEGLGLGKDGSGMIEPVQAQAMDSRAGLGSQQKKVDPSLEVQAGDSYKTLIHKKALARFREMS
***********WDNNSALEGYGAIHEPNFRVGGSYDERRFLDERYSRDNIYP*****************************************YIDSYHEMDAYCGHEIDSFPEFDKFRDGYRNIENYR*********************************************************************************************************************************************************VAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEY***************************TIPCDWMCTICGCVNFARRTSCFQCN*****************************THVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSIL*********************AAAFSQQYDAVGW****************************GLALQSGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPC*******************************************************************************************************************************************************************************************************************************************************************************************************************FTADSVQSYEVITADKAIDENNVGNRMLRSMGWHEGLG**********************************************************
*******************************************************************************************************************************************************************************************************************************************************************************************APSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEY*****************************PCDWMCTICGCVNFAR**********************************TGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSIL*********************AAAFSQQYDAVGWAP*****************SDGDMVQKDGLALQ***********YYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQY*************************************************************************************************************************************************************************************************************NSDTITAVTPFRTDA********************************************************************************************************************MLRSMGWHEGLGLGKDGSGMIEPVQAQAMD*************************TLIHKKALARFREM*
MDPGRYGLQQGWDNNSALEGYGAIHEPNFRVGGSYDERRFLDERYSRDNIYPRNAFQRENYPPPPVGLWPQSRRRNYEEDYSLDRESRRHEKPYIDSYHEMDAYCGHEIDSFPEFDKFRDGYRNIENYRDHGFERPPRFGGRDRDRDDYDDY******************CDFGRLSYDSD******************************************************************************DGRYERIEKR*********EHYAVAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEYSSKPTGGSGGHYGQ***********KSTIPCDWMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGSDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSILGP**************AAAIEAAAFSQQYDAVGWAPKEYNP*****************VQKDGLALQSGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPCTDQN*********************RKVVISAPAATVSSVEKPASLPD**************************SKSTIVANKKKLNNATMWKQW**************************************SSGAGAPTAIPQAVGLDSPVKSKPVSSTSGGTLMGVIRNSGRGFQ**************************DTITAVTPFRTDASALGSYTPPVATGSGKRRFSEM******************AAERRSLYGSSFSAGDDLPDVGSGDSNRDFALKKGSVDSMPFPPGVGGRGFTADSVQSYEVITADKAIDENNVGNRMLRSMGWHEGLGLGKDGSGMIEPVQAQAM*************DPSLEVQAGDSYKTLIHKKALARFREMS
****RYGLQQGWDNNSALEGYGAIHEPNFRVGGSYDERRFLDERYSRDNIYPRNAFQRENYPPPPVGLWPQSRRRNYEEDYSLDRESRRHEKPYIDSYHEMDAYCGHEIDSFPEFDKFRDGYRNI*NY*DHGFERPPRFGGRDRDRDDYDD***********************************************************************************************************************************VAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEA**********************SDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSILGPGSGMSASSQSSSLAAAAIEAAAFSQQYDAVGWAPK******************************SGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPCTD******************************PAAT********SLPDAVQAAATAA*********KSKEVKVVSKSTIVANKKKLNNATMWKQWS***********************************************P******************GGTLMGVIRNS*******************************DTITAVTPFRTDASALGSYTPPVA*************************YRDRAAERRSLYG*********************************************************AIDENNVGNRMLRSMGWHEGLGLGKDGSGMIEPVQAQAMDSRA*L***************GDSYKTLIHKKALARFREMS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPGRYGLQQGWDNNSALEGYGAIHEPNFRVGGSYDERRFLDERYSRDNIYPRNAFQRENYPPPPVGLWPQSRRRNYEEDYSLDRESRRHEKPYIDSYHEMDAYCGHEIDSFPEFDKFRDGYRNIENYRDHGFERPPRFGGRDRDRDDYDDYDYRSRSSHQSREDSREGDCDFGRLSYDSDYDRGSRRDGSWRRHESRDRERDKRCLSRERELSPHRRHEHSASRSQSRSRSRGRDDRPRSRSPRGRSHGRSHREDSYDDGRYERIEKRRDREERRQREHYAVAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGSDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSILGPGSGMSASSQSSSLAAAAIEAAAFSQQYDAVGWAPKEYNPDDKQPTRGQEQRSDGDMVQKDGLALQSGFVWDEASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPCTDQNDNKTSGNGSEPSKQVDGGSKNRKVVISAPAATVSSVEKPASLPDAVQAAATAAIAAEKKGKEKSKEVKVVSKSTIVANKKKLNNATMWKQWSHDNQQSASADDRPGPAGQASKTKFKSDSAATKENNTFSSGAGAPTAIPQAVGLDSPVKSKPVSSTSGGTLMGVIRNSGRGFQPGSSGGLSASSTAPPSSAGSSSSVNSDTITAVTPFRTDASALGSYTPPVATGSGKRRFSEMPLPPATQKEQPQTTYRDRAAERRSLYGSSFSAGDDLPDVGSGDSNRDFALKKGSVDSMPFPPGVGGRGFTADSVQSYEVITADKAIDENNVGNRMLRSMGWHEGLGLGKDGSGMIEPVQAQAMDSRAGLGSQQKKVDPSLEVQAGDSYKTLIHKKALARFREMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1049 2.2.26 [Sep-21-2011]
A4IGK4838 RNA-binding protein 5 OS= yes no 0.319 0.399 0.267 2e-25
Q6DDU9749 RNA-binding protein 5-B O N/A no 0.328 0.460 0.268 2e-25
P52756815 RNA-binding protein 5 OS= yes no 0.249 0.321 0.286 6e-21
Q91YE7815 RNA-binding protein 5 OS= yes no 0.249 0.321 0.286 6e-21
B2GV05815 RNA-binding protein 5 OS= yes no 0.249 0.321 0.286 1e-20
Q1RMU5815 RNA-binding protein 5 OS= yes no 0.249 0.321 0.286 1e-20
P98175930 RNA-binding protein 10 OS no no 0.252 0.284 0.245 4e-20
Q99KG3930 RNA-binding protein 10 OS no no 0.252 0.284 0.242 5e-20
A0JMV4833 RNA-binding protein 5-A O N/A no 0.224 0.283 0.290 8e-20
P70501852 RNA-binding protein 10 OS no no 0.225 0.278 0.239 2e-17
>sp|A4IGK4|RBM5_XENTR RNA-binding protein 5 OS=Xenopus tropicalis GN=rbm5 PE=2 SV=1 Back     alignment and function desciption
 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 121/453 (26%), Positives = 193/453 (42%), Gaps = 118/453 (26%)

Query: 286 SGTIVVKGLSQKTTEEDLYQILAEW-GPL-RHVRVIKERNSGVSRGFAFIDFPSVGAARA 343
           S TI+++GL     E D+ +++  + GP    VR++K R +G+SRGFAF++F  +  A  
Sbjct: 102 SKTIMLRGLPININENDIRELVESFEGPQPADVRLMK-RKTGLSRGFAFVEFYHLQDATR 160

Query: 344 MMDRIGDDGLVVDGRKLFFEYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICG 403
            M+      LV+ G+ +   YS                      N +     DW+C  CG
Sbjct: 161 WME-ANQKKLVIQGKTIAMHYS----------------------NPRPKFE-DWLCNKCG 196

Query: 404 CVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGSDTG-PTHVLVVRGLDEYADEE 462
             NF RR  CF+C  A+ +    A   SS+        SD+G  +  +++R +  +   +
Sbjct: 197 LYNFRRRLKCFRCGAAKAESDLEAPSGSSDAPQSTDYYSDSGYVSSAIILRNIGPHTVVD 256

Query: 463 MLRYEFSKHAP-----IKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEA--TNGTTLE 515
            +    S  AP     + ++RL++DK T  +RGFAF+   S  +AS+ L+   T    L+
Sbjct: 257 SI---LSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQTLHPPLK 313

Query: 516 KNGQILRVAYAKS-----ILGPGSGMSA-SSQSSSLAAAAIEAAAFSQQ----------- 558
            +G+ + V +AKS     +L  G  +SA S  S+++AAA   +   +QQ           
Sbjct: 314 IDGKTVGVDFAKSARKDLVLPDGHRVSAFSVASTAIAAAQWSSTQQAQQSGEGGEYAYLQ 373

Query: 559 -----YDAVGWAPKEYNPDDKQPTRGQEQ----RSDG----------------DMVQKDG 593
                Y   G   ++Y P  +  T   EQ    +++G                 M Q+ G
Sbjct: 374 PGQEGYANYGQCSQDYQPFYQAQTGAAEQSTAPQAEGSAPVPATTSAVVCQSPQMYQQPG 433

Query: 594 LALQSG------------------------------FVWDEASGYYYDAASGFYYDGNTG 623
              QSG                              +   + S Y YD +SG+YYD  TG
Sbjct: 434 SPTQSGTSTAANTTPASTTSTTEEAAPPNAVIPGVKYSVPDTSTYQYDESSGYYYDPQTG 493

Query: 624 LYYDGNSGIWYS--------YDQQTQQYIPCTD 648
           LYYD NS  +Y+        +D + Q Y+P  D
Sbjct: 494 LYYDPNSQYYYNSLTQQYLYWDGEKQTYLPAAD 526




Component of the spliceosome A complex. Regulates alternative splicing of a number of mRNAs. May modulate splice site pairing after recruitment of the U1 and U2 snRNPs to the 5' and 3' splice sites of the intron.
Xenopus tropicalis (taxid: 8364)
>sp|Q6DDU9|RBM5B_XENLA RNA-binding protein 5-B OS=Xenopus laevis GN=rbm5-b PE=2 SV=1 Back     alignment and function description
>sp|P52756|RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 Back     alignment and function description
>sp|Q91YE7|RBM5_MOUSE RNA-binding protein 5 OS=Mus musculus GN=Rbm5 PE=1 SV=1 Back     alignment and function description
>sp|B2GV05|RBM5_RAT RNA-binding protein 5 OS=Rattus norvegicus GN=Rbm5 PE=2 SV=1 Back     alignment and function description
>sp|Q1RMU5|RBM5_BOVIN RNA-binding protein 5 OS=Bos taurus GN=RBM5 PE=2 SV=1 Back     alignment and function description
>sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 Back     alignment and function description
>sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus GN=Rbm10 PE=1 SV=1 Back     alignment and function description
>sp|A0JMV4|RBM5A_XENLA RNA-binding protein 5-A OS=Xenopus laevis GN=rbm5-a PE=2 SV=1 Back     alignment and function description
>sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus GN=Rbm10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1049
3594744831105 PREDICTED: uncharacterized protein LOC10 0.972 0.923 0.757 0.0
2977421331029 unnamed protein product [Vitis vinifera] 0.953 0.971 0.743 0.0
1477745781070 hypothetical protein VITISV_013474 [Viti 0.948 0.929 0.740 0.0
4494623751048 PREDICTED: uncharacterized protein LOC10 0.975 0.976 0.711 0.0
3565238361057 PREDICTED: uncharacterized protein LOC10 0.975 0.967 0.688 0.0
2240796131023 predicted protein [Populus trichocarpa] 0.956 0.980 0.720 0.0
3565609011066 PREDICTED: uncharacterized protein LOC10 0.979 0.963 0.686 0.0
224135077988 predicted protein [Populus trichocarpa] 0.924 0.981 0.703 0.0
255584486962 RNA-binding protein, putative [Ricinus c 0.898 0.980 0.748 0.0
2978167301010 nucleic acid binding protein [Arabidopsi 0.927 0.963 0.575 0.0
>gi|359474483|ref|XP_002278861.2| PREDICTED: uncharacterized protein LOC100250662 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1392 bits (3602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/1067 (75%), Positives = 892/1067 (83%), Gaps = 47/1067 (4%)

Query: 17   ALEGYGAIHEPNFRVGGSYDERRFLDERYSRDNIYPRNAF-----QRENYPPPP--VGLW 69
            ALEGYGA+H+ NFRVGGSYD+RRFLDER+SRDN+YPRNAF     +RENYPPPP  VGLW
Sbjct: 52   ALEGYGAVHDANFRVGGSYDDRRFLDERFSRDNVYPRNAFHRDILERENYPPPPSAVGLW 111

Query: 70   PQSRRRNYEEDYSLDRESRRHEKPYIDSYHEMDAYCG----HEIDSFPEFDKFRDGYRNI 125
            PQ+RRR+YEE+YSLDRESRRHEKPY+DSYHEMD +      HE+D+F E+DKFRDGYR I
Sbjct: 112  PQTRRRSYEEEYSLDRESRRHEKPYLDSYHEMDTFREADKYHEVDTFQEYDKFRDGYRGI 171

Query: 126  ENYRDHGFERPPRFGGRDRDRDDYDDYDYRSRSSHQSREDSREGDCDFGRLSYDSDYDRG 185
            +NYRDHGF+RP RFG RDRD   YDDYDYRSR SHQ+REDSRE D D+GR SYDSDYDRG
Sbjct: 172  DNYRDHGFDRPSRFGARDRDDHAYDDYDYRSRLSHQNREDSRERDYDYGRHSYDSDYDRG 231

Query: 186  SRRDGSWRRHESRDRERDKRCLSRERELSPHRRHEHSASRSQSRSRSRGRDDRPRSRSPR 245
            SRRDG+WRR ESRDRERDKR LSRER+ SP R+HE        RSRSRGR+DRPRSRSPR
Sbjct: 232  SRRDGNWRRRESRDRERDKRGLSRERDQSPPRKHE--------RSRSRGREDRPRSRSPR 283

Query: 246  GRSHGRSHREDSYDDGRYERIEKRRDREERRQREHYAVAPSGTIVVKGLSQKTTEEDLYQ 305
            GRSHGRSHREDSYDDGR+ER EKRRDRE++RQ EHY+VAPS T+VVKGLSQKTTEEDLYQ
Sbjct: 284  GRSHGRSHREDSYDDGRHERSEKRRDREDKRQHEHYSVAPSATVVVKGLSQKTTEEDLYQ 343

Query: 306  ILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEYS 365
            ILAEWGPLRHVRVIKER+SG+SRGFAFIDFPSVGAAR MMD+IGDDGLVVDGRKLFFEYS
Sbjct: 344  ILAEWGPLRHVRVIKERSSGISRGFAFIDFPSVGAARVMMDKIGDDGLVVDGRKLFFEYS 403

Query: 366  SKPTGGSGGHYGQESAMGARHSNHKS-TIPCDWMCTICGCVNFARRTSCFQCNEARTDDA 424
            SKPTGG+GG +GQE+   + H NHKS T+P DWMC ICGCVNFARRTSCFQCNE RTD++
Sbjct: 404  SKPTGGAGGPFGQENTFKSGHINHKSMTVPSDWMCIICGCVNFARRTSCFQCNEVRTDES 463

Query: 425  PPAEMNSSNPIPLGKKGSDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKF 484
            PPA++ SSN   LGKKGS+ GP HVLVVRGLDE ADEEMLRYEFSKHAPIKDLRLVRDKF
Sbjct: 464  PPADIASSNATSLGKKGSEAGPIHVLVVRGLDENADEEMLRYEFSKHAPIKDLRLVRDKF 523

Query: 485  THVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAYAKSILGPGSGMSASSQSSS 544
            THVSRGFAF+HFHSVEDA+KALEATNGTTLEKNGQILRVAYAKSILGPGSG + SSQSSS
Sbjct: 524  THVSRGFAFVHFHSVEDATKALEATNGTTLEKNGQILRVAYAKSILGPGSGTTGSSQSSS 583

Query: 545  LAAAAIEAAAFSQQYDAVGWAPKEYNPDDKQPTRGQEQRSDGDMV-QKDGLALQSGFVWD 603
            LAAAAIEAA F+QQYDAVGWAPKEYNPDDKQ T GQ+ R +GD   QKDG A QSGFVWD
Sbjct: 584  LAAAAIEAATFAQQYDAVGWAPKEYNPDDKQSTGGQD-RGNGDPAGQKDGSAPQSGFVWD 642

Query: 604  EASGYYYDAASGFYYDGNTGLYYDGNSGIWYSYDQQTQQYIPCTDQNDNKTSGNGSEPSK 663
            E SGYYYDAASGFYYDGNTGLYYDGN G WYSYD  TQQY+PCTDQND KTSG     S 
Sbjct: 643  ETSGYYYDAASGFYYDGNTGLYYDGNGGTWYSYDHSTQQYVPCTDQNDTKTSGK-QSESS 701

Query: 664  QVDGGSKNRKVVISAPAATVSSVEKPASLPDAVQAAATAAIAAEKKGKEKSKEVKVVSKS 723
            +    S +RKVVISAPAAT++S EK ASLPDAVQAAATAA+AAEKK KEK KE+K+ SKS
Sbjct: 702  KASDSSNSRKVVISAPAATITSNEKAASLPDAVQAAATAAMAAEKKEKEKLKEIKLASKS 761

Query: 724  TIVANKKKLNNA-TMWKQWSH----------DNQQSASADDRPGPAGQASKTKFKSDSAA 772
            +I+ANKKK++N  TMWKQ SH          DNQ SA+ DDRP   G + K KF++D   
Sbjct: 762  SILANKKKMSNVLTMWKQRSHEGQATRVALDDNQPSAAVDDRPNSIGPSPKGKFRTDVVT 821

Query: 773  TKENNTFSSGAGAPTAIPQAVGLDSPVKSKPVSSTSGGTLMGVIRNSGRGFQP------G 826
            TKE +T +SG    +     VGL+S VK++PVS++ GGT+MGVIR SGRG         G
Sbjct: 822  TKE-HTAASGGFTTSTPALTVGLESQVKARPVSNSLGGTVMGVIRGSGRGVVKSDTSYLG 880

Query: 827  SSGGLSASSTAPPSSAGSSSSVNSDTITAVTPFRTDASALGSYTPPVATGSGKRRFSEMP 886
            SSGG+S S+ A   +AGSSSS+NSDT T  TPFRTDASALGSYTPPVA GSGKRRFSEMP
Sbjct: 881  SSGGVSTSAPA-AYTAGSSSSINSDT-TLTTPFRTDASALGSYTPPVAAGSGKRRFSEMP 938

Query: 887  LPPA-TQKEQPQTTYRDRAAERRSLYGSSFSAGDDLPDVGSGDSNRDFALKKGSVDSMPF 945
            +  A TQKEQP TTYRDRAAERRSLYGSS S GD L D+G GDS RD A KKGS+DSMPF
Sbjct: 939  VQLASTQKEQPHTTYRDRAAERRSLYGSSSSTGDSLSDLGIGDSTRDSAFKKGSLDSMPF 998

Query: 946  PPGVGGRGFTADS---VQSYEVITADKAIDENNVGNRMLRSMGWHEGLGLGKDGSGMIEP 1002
            PPGVGG     D+   VQSYEVITADKAIDE+NVGNRMLRSMGW EG GLGKDGSGM+EP
Sbjct: 999  PPGVGGGRGMGDANGNVQSYEVITADKAIDESNVGNRMLRSMGWQEGSGLGKDGSGMVEP 1058

Query: 1003 VQAQAMDSRAGLGSQQKKVDPSLEVQAGDSYKTLIHKKALARFREMS 1049
            VQAQAMDSRAGLGS QKK+DP LEVQ GDSY+TLI KKALARF+EMS
Sbjct: 1059 VQAQAMDSRAGLGSHQKKLDPGLEVQPGDSYRTLIQKKALARFQEMS 1105




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297742133|emb|CBI33920.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147774578|emb|CAN76782.1| hypothetical protein VITISV_013474 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449462375|ref|XP_004148916.1| PREDICTED: uncharacterized protein LOC101209801 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356523836|ref|XP_003530540.1| PREDICTED: uncharacterized protein LOC100787998 [Glycine max] Back     alignment and taxonomy information
>gi|224079613|ref|XP_002305898.1| predicted protein [Populus trichocarpa] gi|222848862|gb|EEE86409.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356560901|ref|XP_003548725.1| PREDICTED: uncharacterized protein LOC100777686 [Glycine max] Back     alignment and taxonomy information
>gi|224135077|ref|XP_002327561.1| predicted protein [Populus trichocarpa] gi|222836115|gb|EEE74536.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255584486|ref|XP_002532972.1| RNA-binding protein, putative [Ricinus communis] gi|223527250|gb|EEF29409.1| RNA-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297816730|ref|XP_002876248.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297322086|gb|EFH52507.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1049
UNIPROTKB|A0JMV4833 rbm5-a "RNA-binding protein 5- 0.106 0.134 0.415 4.8e-46
UNIPROTKB|A4IGK4838 rbm5 "RNA-binding protein 5" [ 0.106 0.133 0.406 1.1e-45
UNIPROTKB|Q6DDU9749 rbm5-b "RNA-binding protein 5- 0.106 0.149 0.406 1.4e-45
MGI|MGI:1933204815 Rbm5 "RNA binding motif protei 0.106 0.137 0.386 1.2e-42
UNIPROTKB|F1SPQ8815 RBM5 "Uncharacterized protein" 0.106 0.137 0.386 1.5e-42
UNIPROTKB|P52756815 RBM5 "RNA-binding protein 5" [ 0.106 0.137 0.386 1.9e-42
RGD|1305059815 Rbm5 "RNA binding motif protei 0.106 0.137 0.386 1.9e-42
UNIPROTKB|E2QUP3815 RBM5 "Uncharacterized protein" 0.106 0.137 0.386 3.7e-42
UNIPROTKB|Q1RMU5815 RBM5 "RNA-binding protein 5" [ 0.106 0.137 0.386 9.6e-42
UNIPROTKB|E1BXK5810 E1BXK5 "Uncharacterized protei 0.106 0.138 0.366 3.5e-39
UNIPROTKB|A0JMV4 rbm5-a "RNA-binding protein 5-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 4.8e-46, Sum P(6) = 4.8e-46
 Identities = 49/118 (41%), Positives = 66/118 (55%)

Query:   931 RDFALKKGSVDSMPFPPGVGGRGFTADSVQSYEVITADKAIDENNVGNRMLRSMGWHEGL 990
             RD A ++     +P PP    + F A +V +YE  T D  ID +N+GN+ML++MGW EG 
Sbjct:   721 RDRAAERRVKYGIPEPPEPKRKRF-APTVVNYEQPTKD-GIDNSNIGNKMLQAMGWKEGS 778

Query:   991 GLGKDGSGMIEPVQAQAMDSRAGLGSQQKKVDPSLEVQAGDSYKTLIHKKALARFREM 1048
             GLG+   G+  P+QAQ     AGLG++      S  V   DSYK  + K   ARF EM
Sbjct:   779 GLGRKSQGITAPIQAQVRMRGAGLGAKGS----SYGVNTSDSYKDAVRKAMFARFSEM 832


GO:0000245 "spliceosomal complex assembly" evidence=ISS
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=ISS
GO:0003729 "mRNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0043065 "positive regulation of apoptotic process" evidence=ISS
UNIPROTKB|A4IGK4 rbm5 "RNA-binding protein 5" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DDU9 rbm5-b "RNA-binding protein 5-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:1933204 Rbm5 "RNA binding motif protein 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPQ8 RBM5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P52756 RBM5 "RNA-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305059 Rbm5 "RNA binding motif protein 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUP3 RBM5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q1RMU5 RBM5 "RNA-binding protein 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXK5 E1BXK5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1049
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 5e-29
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-27
smart0036073 smart00360, RRM, RNA recognition motif 2e-19
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 7e-17
smart0036073 smart00360, RRM, RNA recognition motif 9e-17
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-16
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-16
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-16
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 5e-15
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-14
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-13
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-13
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-13
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-13
smart0044347 smart00443, G_patch, glycine rich nucleic binding 7e-13
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 8e-13
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 2e-12
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 3e-12
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 5e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-11
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 3e-11
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 4e-11
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-11
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 4e-11
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 5e-11
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 7e-11
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 8e-11
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 9e-11
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 9e-11
pfam0158545 pfam01585, G-patch, G-patch domain 1e-10
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-10
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 3e-10
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-10
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-10
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 4e-10
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 4e-10
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 7e-10
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 7e-10
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 8e-10
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 1e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-09
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-09
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 1e-09
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 2e-09
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 2e-09
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-09
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 3e-09
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 3e-09
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 3e-09
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-09
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 4e-09
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 4e-09
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 5e-09
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 6e-09
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 7e-09
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 7e-09
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 9e-09
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 1e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-08
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-08
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-08
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-08
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-08
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 3e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-08
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 4e-08
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 5e-08
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 6e-08
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 7e-08
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 7e-08
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 7e-08
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 9e-08
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 9e-08
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-07
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-07
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 2e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 2e-07
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 2e-07
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 2e-07
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-07
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 3e-07
smart0054725 smart00547, ZnF_RBZ, Zinc finger domain 3e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 4e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 4e-07
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 5e-07
PRK12678672 PRK12678, PRK12678, transcription termination fact 7e-07
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 8e-07
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 9e-07
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 9e-07
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-06
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-06
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 1e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-06
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-06
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-06
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-06
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-06
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-06
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 3e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 4e-06
PRK12678672 PRK12678, PRK12678, transcription termination fact 5e-06
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 5e-06
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 5e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 6e-06
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 6e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 6e-06
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 6e-06
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 6e-06
cd1275287 cd12752, RRM1_RBM5, RNA recognition motif 1 in ver 6e-06
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 7e-06
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 8e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-06
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 9e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-05
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 1e-05
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-05
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 1e-05
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 1e-05
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-05
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-05
cd1275385 cd12753, RRM1_RBM10, RNA recognition motif 1 in ve 1e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-05
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-05
cd1275385 cd12753, RRM1_RBM10, RNA recognition motif 1 in ve 2e-05
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 2e-05
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 2e-05
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 2e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-05
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 2e-05
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 2e-05
cd1256286 cd12562, RRM2_RBM5_like, RNA recognition motif 2 i 2e-05
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 3e-05
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-05
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 3e-05
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 3e-05
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 3e-05
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 3e-05
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 3e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 3e-05
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-05
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 4e-05
cd1275487 cd12754, RRM2_RBM10, RNA recognition motif 2 in ve 4e-05
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 4e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 5e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 5e-05
cd1268980 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 5e-05
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 5e-05
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 5e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 5e-05
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 5e-05
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 5e-05
PRK12678672 PRK12678, PRK12678, transcription termination fact 6e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 6e-05
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 6e-05
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 6e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 7e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 8e-05
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 8e-05
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 8e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 9e-05
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 9e-05
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 9e-05
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 9e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 9e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 1e-04
PHA03255234 PHA03255, PHA03255, BDLF3; Provisional 1e-04
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 1e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 1e-04
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 1e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 1e-04
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 1e-04
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 1e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-04
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 2e-04
cd1225379 cd12253, RRM_PIN4_like, RNA recognition motif in y 2e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 2e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 2e-04
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-04
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 2e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 2e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-04
pfam1265679 pfam12656, G-patch_2, DExH-box splicing factor bin 2e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 2e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 2e-04
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 2e-04
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 2e-04
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 2e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-04
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 3e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 3e-04
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 3e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 3e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-04
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 3e-04
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 3e-04
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 3e-04
PRK12678672 PRK12678, PRK12678, transcription termination fact 4e-04
cd1275487 cd12754, RRM2_RBM10, RNA recognition motif 2 in ve 4e-04
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 4e-04
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 4e-04
cd1275586 cd12755, RRM2_RBM5, RNA recognition motif 2 in ver 4e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 5e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 5e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 5e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 5e-04
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 5e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 5e-04
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 5e-04
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 5e-04
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 5e-04
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 6e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 6e-04
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 6e-04
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 6e-04
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 6e-04
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 6e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 6e-04
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 6e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 7e-04
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 7e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 8e-04
cd1256286 cd12562, RRM2_RBM5_like, RNA recognition motif 2 i 8e-04
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 8e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 9e-04
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 9e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.001
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 0.001
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.001
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 0.001
cd1278080 cd12780, RRM1_hnRNPL, RNA recognition motif 1 in v 0.001
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 0.001
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.001
pfam0064129 pfam00641, zf-RanBP, Zn-finger in Ran binding prot 0.001
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.001
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 0.001
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 0.001
cd1268681 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 0.001
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 0.002
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.002
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 0.002
cd1225379 cd12253, RRM_PIN4_like, RNA recognition motif in y 0.002
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 0.002
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 0.002
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 0.002
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 0.002
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.002
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 0.002
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 0.002
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.002
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.002
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 0.002
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 0.002
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 0.002
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 0.002
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 0.003
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 0.003
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 0.003
cd1275586 cd12755, RRM2_RBM5, RNA recognition motif 2 in ver 0.003
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.003
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 0.003
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 0.003
PRK12688 751 PRK12688, PRK12688, flagellin; Reviewed 0.003
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 0.003
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.003
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 0.003
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.004
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.004
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 0.004
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 0.004
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 0.004
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 0.004
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
 Score =  110 bits (278), Expect = 5e-29
 Identities = 39/84 (46%), Positives = 56/84 (66%), Gaps = 3/84 (3%)

Query: 446 PTHVLVVRGLDEYADEEMLRYEFSKHA--PIKDLRLVRDKFTHVSRGFAFLHFHSVEDAS 503
           PT+ L++RGLD    EE +    S  A  PIKD+RL+RDK T  SRGFAF+ F S+EDA+
Sbjct: 1   PTNTLILRGLDLLTTEEDILQALSAIASVPIKDVRLIRDKLTGTSRGFAFVEFPSLEDAT 60

Query: 504 KALEATNGT-TLEKNGQILRVAYA 526
           + ++A N       +G+++RV+YA
Sbjct: 61  QWMDALNNLDPFVIDGRVVRVSYA 84


This subfamily includes the RRM1 and RRM2 of RNA-binding protein 5 (RBM5 or LUCA15 or H37) and RNA-binding protein 10 (RBM10 or S1-1), and the RRM2 of RNA-binding protein 6 (RBM6 or NY-LU-12 or g16 or DEF-3). These RBMs share high sequence homology and may play an important role in regulating apoptosis. RBM5 is a known modulator of apoptosis. It may also act as a tumor suppressor or an RNA splicing factor. RBM6 has been predicted to be a nuclear factor based on its nuclear localization signal. Both, RBM6 and RBM5, specifically bind poly(G) RNA. RBM10 is a paralog of RBM5. It may play an important role in mRNA generation, processing and degradation in several cell types. The rat homolog of human RBM10 is protein S1-1, a hypothetical RNA binding protein with poly(G) and poly(U) binding capabilities. All family members contain two RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), two C2H2-type zinc fingers, and a G-patch/D111 domain. . Length = 84

>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|197727 smart00443, G_patch, glycine rich nucleic binding domain Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|144978 pfam01585, G-patch, G-patch domain Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|197784 smart00547, ZnF_RBZ, Zinc finger domain Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241196 cd12752, RRM1_RBM5, RNA recognition motif 1 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241197 cd12753, RRM1_RBM10, RNA recognition motif 1 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241197 cd12753, RRM1_RBM10, RNA recognition motif 1 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241006 cd12562, RRM2_RBM5_like, RNA recognition motif 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|241198 cd12754, RRM2_RBM10, RNA recognition motif 2 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|165513 PHA03255, PHA03255, BDLF3; Provisional Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|221692 pfam12656, G-patch_2, DExH-box splicing factor binding site Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|241198 cd12754, RRM2_RBM10, RNA recognition motif 2 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241199 cd12755, RRM2_RBM5, RNA recognition motif 2 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241006 cd12562, RRM2_RBM5_like, RNA recognition motif 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241224 cd12780, RRM1_hnRNPL, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein L (hnRNP-L) Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|201366 pfam00641, zf-RanBP, Zn-finger in Ran binding protein and others Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241130 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 1 and 2 (PTBPH1 and PTBPH2) Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241199 cd12755, RRM2_RBM5, RNA recognition motif 2 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|171664 PRK12688, PRK12688, flagellin; Reviewed Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1049
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.98
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.97
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.96
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.96
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.95
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.95
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.95
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.94
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.92
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.92
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.91
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.91
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.91
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.9
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.9
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.89
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.88
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.87
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.87
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.87
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.86
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.86
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.83
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.78
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.77
KOG0154573 consensus RNA-binding protein RBM5 and related pro 99.75
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.75
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.75
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.72
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.69
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.68
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.67
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.66
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.64
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.56
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.53
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.53
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.51
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.49
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.48
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.45
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.45
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.44
KOG0122270 consensus Translation initiation factor 3, subunit 99.39
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.39
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.35
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.34
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 99.32
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.31
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.3
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.3
KOG0122270 consensus Translation initiation factor 3, subunit 99.29
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.29
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.29
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.28
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.28
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.28
PF0158545 G-patch: G-patch domain; InterPro: IPR000467 The D 99.27
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.27
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.26
KOG4207256 consensus Predicted splicing factor, SR protein su 99.23
KOG4207256 consensus Predicted splicing factor, SR protein su 99.23
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.23
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.21
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.21
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.21
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.19
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.18
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.17
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.17
PLN03120260 nucleic acid binding protein; Provisional 99.16
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.15
PLN03213759 repressor of silencing 3; Provisional 99.12
smart0036272 RRM_2 RNA recognition motif. 99.12
smart0044347 G_patch glycine rich nucleic binding domain. A pre 99.11
PLN03120260 nucleic acid binding protein; Provisional 99.11
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.1
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.1
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.1
smart0036071 RRM RNA recognition motif. 99.08
PLN03213 759 repressor of silencing 3; Provisional 99.08
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.06
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.06
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.03
PLN03121243 nucleic acid binding protein; Provisional 99.03
smart0036272 RRM_2 RNA recognition motif. 99.03
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.03
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.02
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.0
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.0
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.0
smart0036071 RRM RNA recognition motif. 98.99
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 98.99
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.99
KOG0965988 consensus Predicted RNA-binding protein, contains 98.96
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.95
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.94
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.92
PLN03121243 nucleic acid binding protein; Provisional 98.92
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.92
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 98.91
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 98.91
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.88
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.86
smart0036170 RRM_1 RNA recognition motif. 98.85
smart0036170 RRM_1 RNA recognition motif. 98.83
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.81
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.8
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 98.78
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.78
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.76
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.75
KOG0112975 consensus Large RNA-binding protein (RRM superfami 98.71
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.71
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.7
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.68
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.67
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.65
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.57
KOG4210285 consensus Nuclear localization sequence binding pr 98.51
KOG2809 326 consensus Telomerase elongation inhibitor/RNA matu 98.5
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.49
KOG0226290 consensus RNA-binding proteins [General function p 98.43
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.41
KOG1995351 consensus Conserved Zn-finger protein [General fun 98.4
PF1265677 G-patch_2: DExH-box splicing factor binding site 98.38
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.34
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.28
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.26
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.26
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.24
KOG4660549 consensus Protein Mei2, essential for commitment t 98.22
KOG2384223 consensus Major histocompatibility complex protein 98.2
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.18
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.18
KOG2184 767 consensus Tuftelin-interacting protein TIP39, cont 98.15
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.11
KOG3673 845 consensus FtsJ-like RNA methyltransferase [RNA pro 98.09
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.05
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.99
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.96
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.95
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 97.94
KOG0226290 consensus RNA-binding proteins [General function p 97.93
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.79
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 97.78
KOG0151877 consensus Predicted splicing regulator, contains R 97.77
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 97.75
KOG4660549 consensus Protein Mei2, essential for commitment t 97.75
KOG2185 486 consensus Predicted RNA-processing protein, contai 97.72
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.7
KOG0151877 consensus Predicted splicing regulator, contains R 97.69
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 97.67
KOG1548382 consensus Transcription elongation factor TAT-SF1 97.65
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.63
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 97.57
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.52
KOG1994 268 consensus Predicted RNA binding protein, contains 97.49
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.33
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.13
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.96
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.89
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.77
KOG2314698 consensus Translation initiation factor 3, subunit 96.76
KOG1996378 consensus mRNA splicing factor [RNA processing and 96.63
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.57
KOG4210285 consensus Nuclear localization sequence binding pr 96.53
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 96.4
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 96.36
KOG4315 455 consensus G-patch nucleic acid binding protein [Ge 96.27
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.27
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.21
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 96.14
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.06
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.06
KOG4368757 consensus Predicted RNA binding protein, contains 96.05
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.94
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 95.92
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 95.85
KOG3152278 consensus TBP-binding protein, activator of basal 95.84
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 95.61
KOG2135526 consensus Proteins containing the RNA recognition 95.56
KOG2314698 consensus Translation initiation factor 3, subunit 95.56
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 95.5
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.44
KOG1855484 consensus Predicted RNA-binding protein [General f 95.24
KOG3152278 consensus TBP-binding protein, activator of basal 95.21
KOG3263196 consensus Nucleic acid binding protein [General fu 95.18
KOG1855484 consensus Predicted RNA-binding protein [General f 95.18
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 94.22
KOG0835367 consensus Cyclin L [General function prediction on 94.2
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 94.17
KOG0112975 consensus Large RNA-binding protein (RRM superfami 93.98
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.77
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.67
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 92.86
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 92.86
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 92.42
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.4
KOG2138 883 consensus Predicted RNA binding protein, contains 91.94
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 90.5
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 90.1
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 89.41
PF08648180 DUF1777: Protein of unknown function (DUF1777); In 88.57
PF15023166 DUF4523: Protein of unknown function (DUF4523) 87.74
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 87.61
KOG0154573 consensus RNA-binding protein RBM5 and related pro 87.19
KOG1994 268 consensus Predicted RNA binding protein, contains 86.25
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 86.0
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 85.88
KOG2253668 consensus U1 snRNP complex, subunit SNU71 and rela 85.26
KOG2253668 consensus U1 snRNP complex, subunit SNU71 and rela 85.2
KOG2135526 consensus Proteins containing the RNA recognition 85.13
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 85.05
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 84.75
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 83.96
KOG2068327 consensus MOT2 transcription factor [Transcription 83.78
KOG2068327 consensus MOT2 transcription factor [Transcription 83.36
KOG2548653 consensus SWAP mRNA splicing regulator [RNA proces 82.49
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 81.58
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 80.5
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
Probab=99.98  E-value=3.7e-31  Score=314.63  Aligned_cols=180  Identities=32%  Similarity=0.495  Sum_probs=154.1

Q ss_pred             CCCCceEEEcCCCCCCCHHHHHHHHhhcCCeeEEEEeecCCCCCccceEEEEcCCHHHHHHHHHHhcCCCeeeCCeeEEE
Q 043164          283 VAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFF  362 (1049)
Q Consensus       283 ~~ps~~L~V~nLp~~~tee~L~~~F~~~G~i~~v~i~~dk~tg~srG~AFVeF~~~e~A~~Al~~l~~ng~~i~Gr~i~V  362 (1049)
                      ..+.++|||+|||..+|+++|+++|+.||.|.+|.|+.|+.+|.++|||||+|.+.++|.+||. |  +|..|.|++|.|
T Consensus        86 ~~~~~~l~V~nlp~~~~~~~l~~~F~~~G~v~~v~i~~d~~~~~skg~afVeF~~~e~A~~Al~-l--~g~~~~g~~i~v  162 (457)
T TIGR01622        86 ERDDRTVFVLQLALKARERDLYEFFSKVGKVRDVQCIKDRNSRRSKGVAYVEFYDVESVIKALA-L--TGQMLLGRPIIV  162 (457)
T ss_pred             ccCCcEEEEeCCCCCCCHHHHHHHHHhcCCeeEEEEeecCCCCCcceEEEEEECCHHHHHHHHH-h--CCCEECCeeeEE
Confidence            4567899999999999999999999999999999999999999999999999999999999995 6  999999999999


Q ss_pred             eecCCCCCCCCCCCCccccccccccCCCCCCCCccccccccccccccccccccccCCCCCCCCcccCCCCCCCCCCCCCC
Q 043164          363 EYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGS  442 (1049)
Q Consensus       363 ~~A~~p~~~~~~~~~~~~~~~~~~~~~r~~~p~dw~~~~~~~~n~~~r~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~  442 (1049)
                      .++.......                                    ..     .  ....         .         .
T Consensus       163 ~~~~~~~~~~------------------------------------~~-----~--~~~~---------~---------~  181 (457)
T TIGR01622       163 QSSQAEKNRA------------------------------------AK-----A--ATHQ---------P---------G  181 (457)
T ss_pred             eecchhhhhh------------------------------------hh-----c--cccc---------C---------C
Confidence            8752111000                                    00     0  0000         0         0


Q ss_pred             CCCCcceEEEeCCCccCcHHHHHHHhhccCCeeeEEEeecCCCCceeeEEEEEeCCHHHHHHHHHHhCCCeeccCCeEEE
Q 043164          443 DTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILR  522 (1049)
Q Consensus       443 ~~~ps~~LfV~NLp~~~teedLre~Fs~fG~I~~v~I~rD~~tg~SrGfAFVeF~s~e~A~kAl~~LnG~~~~i~Gr~L~  522 (1049)
                      ....+.+|||+|||..+++++|+++|++||.|..|.|+.+..+|.++|||||+|.+.++|.+|+..|||..|  +|+.|+
T Consensus       182 ~~p~~~~l~v~nl~~~~te~~l~~~f~~~G~i~~v~~~~d~~~g~~~g~afV~f~~~e~A~~A~~~l~g~~i--~g~~i~  259 (457)
T TIGR01622       182 DIPNFLKLYVGNLHFNITEQELRQIFEPFGDIEDVQLHRDPETGRSKGFGFIQFHDAEEAKEALEVMNGFEL--AGRPIK  259 (457)
T ss_pred             CCCCCCEEEEcCCCCCCCHHHHHHHHHhcCCeEEEEEEEcCCCCccceEEEEEECCHHHHHHHHHhcCCcEE--CCEEEE
Confidence            001257999999999999999999999999999999999999999999999999999999999999999888  799999


Q ss_pred             EEEeec
Q 043164          523 VAYAKS  528 (1049)
Q Consensus       523 V~~Ak~  528 (1049)
                      |.||..
T Consensus       260 v~~a~~  265 (457)
T TIGR01622       260 VGYAQD  265 (457)
T ss_pred             EEEccC
Confidence            999884



A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the model.

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0154 consensus RNA-binding protein RBM5 and related proteins, contain G-patch and RRM domains [General function prediction only] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF01585 G-patch: G-patch domain; InterPro: IPR000467 The D111/G-patch domain [] is a short conserved region of about 40 amino acids which occurs in a number of putative RNA-binding proteins, including tumor suppressor and DNA-damage-repair proteins, suggesting that this domain may have an RNA binding function Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>smart00443 G_patch glycine rich nucleic binding domain Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0965 consensus Predicted RNA-binding protein, contains SWAP and G-patch domains [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG2809 consensus Telomerase elongation inhibitor/RNA maturation protein PINX1 [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12656 G-patch_2: DExH-box splicing factor binding site Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG2184 consensus Tuftelin-interacting protein TIP39, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG3673 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4315 consensus G-patch nucleic acid binding protein [General function prediction only] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG3263 consensus Nucleic acid binding protein [General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2138 consensus Predicted RNA binding protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF08648 DUF1777: Protein of unknown function (DUF1777); InterPro: IPR013957 This entry shows eukaryotic proteins of unknown function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG0154 consensus RNA-binding protein RBM5 and related proteins, contain G-patch and RRM domains [General function prediction only] Back     alignment and domain information
>KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2548 consensus SWAP mRNA splicing regulator [RNA processing and modification] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1049
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 1e-10
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 2e-10
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 4e-10
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 6e-10
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 1e-08
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-07
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 4e-07
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 8e-07
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 4e-05
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 1e-06
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 1e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 2e-05
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 3e-05
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 4e-05
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 6e-05
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 6e-05
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 7e-05
2lxi_A91 Nmr Structure Of The N-Terminal Rna Binding Domain 8e-05
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 9e-05
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 1e-04
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 1e-04
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-04
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 2e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 2e-04
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 3e-04
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 3e-04
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 3e-04
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 3e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-04
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 4e-04
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 4e-04
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 4e-04
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 5e-04
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 7e-04
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 7e-04
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 8e-04
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 38/91 (41%), Positives = 57/91 (62%), Gaps = 3/91 (3%) Query: 436 PLGKKGSDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLH 495 PLG + ++ P L V GL Y E LR FSK+ PI D+ +V D+ + SRGFAF++ Sbjct: 2 PLGSR-ANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVY 60 Query: 496 FHSVEDASKALEATNGTTLEKNGQILRVAYA 526 F +V+DA +A E NG +E +G+ +RV ++ Sbjct: 61 FENVDDAKEAKERANG--MELDGRRIRVDFS 89
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2LXI|A Chain A, Nmr Structure Of The N-Terminal Rna Binding Domain 1 (Rrm1) Of The Protein Rbm10 From Homo Sapiens Length = 91 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1049
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-29
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-11
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-23
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-06
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-23
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-19
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-21
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-06
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-21
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-12
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-21
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-06
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-06
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-19
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-15
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-19
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-10
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 8e-19
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-18
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-14
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-18
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 4e-15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-18
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-18
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-08
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-17
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-17
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-17
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-13
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-17
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-16
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-11
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-07
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-17
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-15
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-17
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 8e-15
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-17
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 7e-17
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-13
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 7e-17
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-12
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-16
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-14
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-16
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-09
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-16
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-16
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-14
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-16
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 7e-16
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-16
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-13
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-16
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 4e-13
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 6e-14
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-16
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-14
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-16
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-14
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-16
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-09
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 7e-16
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 3e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 8e-16
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-09
1x4e_A85 RNA binding motif, single-stranded interacting pro 9e-16
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-15
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-09
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-05
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-15
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-15
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 9e-13
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-15
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-15
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-15
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-09
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-15
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 9e-11
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 3e-15
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-11
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-15
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 9e-14
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 4e-15
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 9e-13
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-15
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-12
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-15
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-10
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-15
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-12
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 6e-15
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 6e-10
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 7e-15
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-09
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 8e-15
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 8e-15
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-14
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-14
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-13
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-14
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-11
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-14
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-13
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-14
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-13
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-14
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-11
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-14
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-08
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 6e-11
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-14
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-14
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 8e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-11
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 4e-14
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-14
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-14
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 9e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-09
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-14
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-13
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-14
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-11
2kt5_A124 RNA and export factor-binding protein 2; chaperone 6e-14
2kt5_A124 RNA and export factor-binding protein 2; chaperone 9e-12
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 6e-14
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-11
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 6e-14
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-13
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 6e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-11
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-14
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-11
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 7e-14
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-07
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 8e-14
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-13
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 9e-14
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-12
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-13
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-07
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-13
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-09
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-13
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 6e-13
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-13
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-13
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 8e-13
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-11
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-05
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-13
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 3e-10
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-09
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 7e-11
2div_A99 TRNA selenocysteine associated protein; structural 2e-13
2div_A99 TRNA selenocysteine associated protein; structural 5e-09
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-13
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-10
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 5e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-13
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 5e-13
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 4e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-13
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-09
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-09
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-13
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-10
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-13
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-11
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 6e-13
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 7e-12
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 7e-13
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-12
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-11
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-12
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 5e-05
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-12
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-09
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-12
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 4e-08
1x5p_A97 Negative elongation factor E; structure genomics, 2e-12
1x5p_A97 Negative elongation factor E; structure genomics, 2e-05
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-12
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-09
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-12
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-08
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-12
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-12
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 4e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-06
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-12
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 8e-09
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 5e-12
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-09
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 6e-06
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-12
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-07
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-12
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-08
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-11
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 8e-11
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-11
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-11
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-11
3q2s_C229 Cleavage and polyadenylation specificity factor S; 6e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-09
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-11
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-09
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-11
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-11
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 5e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-11
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 5e-09
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 3e-11
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 7e-05
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 8e-09
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-11
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 7e-07
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-11
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 1e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 7e-11
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-08
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 7e-11
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 8e-11
2i2y_A150 Fusion protein consists of immunoglobin G- binding 7e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 9e-11
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-06
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 9e-11
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-08
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-10
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-08
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-10
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 9e-08
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-10
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-10
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-08
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-08
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-09
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-10
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 5e-07
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-10
2krb_A81 Eukaryotic translation initiation factor 3 subunit 5e-04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-10
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 6e-09
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-10
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-10
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-10
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-06
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 5e-10
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-09
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 9e-10
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 9e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-09
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-06
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-09
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-07
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-05
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-09
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-08
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 5e-09
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 6e-09
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-05
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 7e-09
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-08
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 7e-05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-08
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 3e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 4e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 4e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-05
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 5e-08
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 6e-08
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-07
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-07
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 3e-07
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 7e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 7e-07
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 8e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-05
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 3e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-04
2k1p_A33 Zinc finger RAN-binding domain-containing protein 3e-06
2lk0_A32 RNA-binding protein 5; zinc finger; NMR {Homo sapi 6e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 4e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-05
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 2e-05
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 2e-05
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 2e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-05
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 4e-05
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 1e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-04
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 6e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 7e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 9e-04
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
 Score =  115 bits (290), Expect = 2e-29
 Identities = 44/250 (17%), Positives = 76/250 (30%), Gaps = 67/250 (26%)

Query: 284 APSGTIVVKGLSQKTTEEDLYQILAEWGPLRHV-----RVIKERNSGVSRGFAFIDFPSV 338
           A +  + V  +    TEE +         L  +       +        + FAF++F SV
Sbjct: 2   AMARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSV 61

Query: 339 GAA-RAM-MDRIGDDGLVVDGRKLFFEYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCD 396
               +AM  D     G++  G+ L                                    
Sbjct: 62  DETTQAMAFD-----GIIFQGQSLK----------------------------------- 81

Query: 397 WMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGSDTGPTHVLVVRGLD 456
                   +                   P    N S  +P           H L + GL 
Sbjct: 82  --------IRRPHDYQ----------PLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLP 123

Query: 457 EYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEK 516
            Y +++ ++   +   P+K   LV+D  T +S+G+AF  +  +    +A+   NG  L  
Sbjct: 124 NYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQL-- 181

Query: 517 NGQILRVAYA 526
             + L V  A
Sbjct: 182 GDKKLLVQRA 191


>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A Length = 33 Back     alignment and structure
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* Length = 32 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 Back     alignment and structure
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 Back     alignment and structure
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Length = 98 Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Length = 98 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1049
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.96
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.96
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.96
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.96
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.96
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.95
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.95
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.95
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.95
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.94
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.94
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.94
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.93
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.93
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.93
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.93
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.92
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.92
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.92
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.79
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.71
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.7
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.7
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.68
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.68
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.65
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.65
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.65
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.64
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.63
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.63
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.62
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.61
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.61
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.61
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.61
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.61
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.61
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.61
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.61
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.61
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.61
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.61
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.61
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.61
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.61
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.61
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.61
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.6
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.6
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.6
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.6
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.6
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.6
2div_A99 TRNA selenocysteine associated protein; structural 99.6
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.6
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.6
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.6
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.6
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.59
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.59
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.59
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.59
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.59
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.59
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.59
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.59
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.59
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.59
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.59
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.59
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.59
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.58
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.58
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.58
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.58
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.58
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.58
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.58
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.58
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.58
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.58
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.58
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.58
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.58
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.58
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.58
2div_A99 TRNA selenocysteine associated protein; structural 99.57
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.57
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.57
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.57
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.57
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.57
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.57
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.56
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.56
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.56
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.56
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.56
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.56
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.56
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.56
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.56
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.56
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.56
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.56
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.56
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.56
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.56
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.56
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.55
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.55
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.55
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.55
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.55
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.55
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.55
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.55
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.55
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.55
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.55
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.55
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.55
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.55
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.55
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.55
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.55
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.55
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.55
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.55
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.55
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.55
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.55
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.55
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.54
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.54
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.54
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.54
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.54
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.54
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.54
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.54
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.54
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.54
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.54
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.54
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.54
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.54
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.54
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.53
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.53
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.53
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.53
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.53
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.53
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.53
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.53
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.53
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.53
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.53
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.52
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.52
2dis_A109 Unnamed protein product; structural genomics, RRM 99.52
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.52
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.52
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.52
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.52
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.52
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.52
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.52
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.52
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.52
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.52
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.51
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.51
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.51
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.51
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.51
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.51
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.51
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.51
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.51
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.51
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.51
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.5
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.5
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.5
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.5
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.5
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.5
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.5
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.5
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.5
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.5
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.5
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.5
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.5
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.5
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.5
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.49
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.49
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.49
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.49
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.49
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.49
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.49
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.49
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.49
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.49
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.49
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.49
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.48
2dis_A109 Unnamed protein product; structural genomics, RRM 99.48
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.48
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.48
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.47
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.47
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.47
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.47
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.47
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.47
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.47
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.47
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.47
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.47
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.47
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.47
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.47
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.47
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.47
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.46
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.46
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.46
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.46
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.46
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.46
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.46
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.45
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.45
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.45
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.45
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.45
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.45
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.44
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.44
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.44
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.44
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.44
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.44
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.44
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.44
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.44
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.44
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.44
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.43
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.43
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.43
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.43
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.43
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.43
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.43
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.43
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.43
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.15
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.42
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.42
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.42
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.42
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.42
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.42
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.41
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.41
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.41
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.41
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.41
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.41
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.41
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.41
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.4
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.4
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.4
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.4
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.4
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.4
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.4
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.4
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.4
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.4
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.4
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.4
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.4
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.4
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.4
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.39
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.39
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.39
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.39
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.39
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.39
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.38
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.38
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.38
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.38
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.38
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.38
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.37
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.37
1x5p_A97 Negative elongation factor E; structure genomics, 99.37
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.37
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.37
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.36
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.36
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.36
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.36
1x5p_A97 Negative elongation factor E; structure genomics, 99.36
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.35
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.35
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.35
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.35
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.35
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.34
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.34
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.34
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.34
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.34
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.33
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.33
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.33
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.33
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.32
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.32
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.32
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.31
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.31
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.31
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.31
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.3
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.3
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.3
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.29
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.28
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.28
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.27
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.27
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.27
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.26
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.24
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.23
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.23
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.23
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.21
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.2
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.18
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.18
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.17
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.17
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.16
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.16
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.15
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.12
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.11
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.1
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.05
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.0
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.0
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.99
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.99
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.92
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.75
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.55
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.55
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.53
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.51
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.34
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.29
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.28
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.99
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.85
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.95
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.49
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.29
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.22
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.9
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 95.62
2k1p_A33 Zinc finger RAN-binding domain-containing protein 95.08
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.04
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.03
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.86
2lk0_A32 RNA-binding protein 5; zinc finger; NMR {Homo sapi 94.84
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 94.36
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 94.34
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 94.2
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 93.72
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 93.52
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 93.51
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 89.83
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 87.11
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 85.76
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 84.92
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=99.96  E-value=2.3e-29  Score=267.31  Aligned_cols=171  Identities=26%  Similarity=0.421  Sum_probs=151.1

Q ss_pred             CCCCCceEEEcCCCCCCCHHHHHHHHhhcCCeeEEEEeecCCCCCccceEEEEcCCHHHHHHHHHHhcCCCeeeCCeeEE
Q 043164          282 AVAPSGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLF  361 (1049)
Q Consensus       282 ~~~ps~~L~V~nLp~~~tee~L~~~F~~~G~i~~v~i~~dk~tg~srG~AFVeF~~~e~A~~Al~~l~~ng~~i~Gr~i~  361 (1049)
                      +..|.++|||+|||+.+||++|+++|+.||+|.+|.|++|+.+|.++|||||+|.+.++|.+||+.|  ++..+.|+.|.
T Consensus        11 p~~p~~tlfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~~G~afV~F~~~~~A~~Ai~~~--~~~~~~g~~i~   88 (213)
T 4f02_A           11 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTM--NFDVIKGKPVR   88 (213)
T ss_dssp             ----CCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHH--TTCEETTEECE
T ss_pred             CCCCCcEEEEeCCCCCCCHHHHHHHHHhhCCEEEEEEecccCCCCccccccceeCCHHHHHHHHHHh--hhhhcCCcccc
Confidence            3457789999999999999999999999999999999999999999999999999999999999999  99999999999


Q ss_pred             EeecCCCCCCCCCCCCccccccccccCCCCCCCCccccccccccccccccccccccCCCCCCCCcccCCCCCCCCCCCCC
Q 043164          362 FEYSSKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKG  441 (1049)
Q Consensus       362 V~~A~~p~~~~~~~~~~~~~~~~~~~~~r~~~p~dw~~~~~~~~n~~~r~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~  441 (1049)
                      |.++.....                          .                                            
T Consensus        89 ~~~~~~~~~--------------------------~--------------------------------------------   98 (213)
T 4f02_A           89 IMWSQRDPS--------------------------L--------------------------------------------   98 (213)
T ss_dssp             EEECCCCTH--------------------------H--------------------------------------------
T ss_pred             ccccccccc--------------------------c--------------------------------------------
Confidence            998521100                          0                                            


Q ss_pred             CCCCCcceEEEeCCCccCcHHHHHHHhhccCCeeeEEEeecCCCCceeeEEEEEeCCHHHHHHHHHHhCCCeeccCCeEE
Q 043164          442 SDTGPTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQIL  521 (1049)
Q Consensus       442 ~~~~ps~~LfV~NLp~~~teedLre~Fs~fG~I~~v~I~rD~~tg~SrGfAFVeF~s~e~A~kAl~~LnG~~~~i~Gr~L  521 (1049)
                       ......+|||+|||..+++++|+++|++||.|..|.|++|.  +.++|||||+|.+.++|.+||+.|||..|  +|+.|
T Consensus        99 -~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d~--~~~~g~~fV~f~~~~~a~~Ai~~lng~~~--~g~~i  173 (213)
T 4f02_A           99 -RKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETQEAAERAIEKMNGMLL--NDRKV  173 (213)
T ss_dssp             -HHHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEEET--TEEEEEEEEEESSHHHHHHHHHHHTTCEE--TTEEC
T ss_pred             -cccccccceECCcccccHHHHHHHHHhhcCCeEEEEeeccC--CCCceEEEEEeCCHHHHHHHHHHhCCCEE--CCEEE
Confidence             00023589999999999999999999999999999999985  45899999999999999999999999999  79999


Q ss_pred             EEEEeecC
Q 043164          522 RVAYAKSI  529 (1049)
Q Consensus       522 ~V~~Ak~k  529 (1049)
                      .|.||+++
T Consensus       174 ~V~~a~~~  181 (213)
T 4f02_A          174 FVGRFKSR  181 (213)
T ss_dssp             EEEECCCH
T ss_pred             EEEEcCCC
Confidence            99998764



>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1049
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 7e-15
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-13
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-13
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-06
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-13
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-12
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-08
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-07
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 9e-09
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-12
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-12
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 4e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-08
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 4e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-12
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-12
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-06
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 7e-12
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 8e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-12
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 8e-12
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-10
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 9e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-08
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 3e-07
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-07
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 3e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-08
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-07
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 5e-11
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 6e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 6e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 8e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 9e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 8e-09
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-08
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-10
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 7e-08
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-10
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-10
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 6e-04
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-07
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-10
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 9e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 4e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 7e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-09
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 5e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-09
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 4e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 8e-06
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-06
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 4e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-07
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 3e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 4e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 6e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 6e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 7e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 7e-09
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 8e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 8e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 9e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 9e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 9e-06
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 9e-09
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-08
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 8e-04
d1n0za_45 g.41.11.1 (A:) Znf265, first zinc-finger domain {H 2e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-05
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-08
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 5e-06
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 4e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 8e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 7e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-06
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 3e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-06
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 4e-07
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-05
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 5e-07
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 1e-04
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 8e-07
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 3e-06
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 4e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 4e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 1e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-06
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 9e-06
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 4e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 9e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 8e-05
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-04
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 4e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.001
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 4e-04
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 8e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.001
d1x4fa199 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) 0.004
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 69.2 bits (169), Expect = 4e-15
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 450 LVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEAT 509
           L V  L     E ML  +FS   PI  +R+ RD  T  S G+A+++F    DA +AL+  
Sbjct: 3   LYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTM 62

Query: 510 NGTTLEKNGQILRVAYAK 527
           N   +   G+ +R+ +++
Sbjct: 63  NFDVI--KGKPVRIMWSQ 78


>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1049
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.94
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.68
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.68
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.68
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.68
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.68
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.68
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.67
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.67
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.67
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.67
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.67
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.67
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.66
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.66
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.66
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.66
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.66
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.66
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.65
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.65
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.64
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.64
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.64
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.64
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.63
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.63
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.63
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.63
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.62
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.62
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.62
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.62
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.62
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.62
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.62
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.62
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.62
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.62
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.62
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.62
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.61
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.61
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.61
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.61
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.61
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.6
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.6
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.6
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.6
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.6
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.59
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.59
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.58
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.58
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.58
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.58
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.58
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.58
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.58
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.57
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.57
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.57
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.57
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.56
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.56
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.55
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.55
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.55
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.55
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.55
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.55
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.55
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.54
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.54
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.53
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.53
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.53
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.53
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.53
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.52
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.52
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.52
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.52
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.52
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.51
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.51
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.51
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.5
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.5
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.5
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.5
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.5
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.5
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.49
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.49
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.49
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.49
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.49
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.48
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.48
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.48
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.48
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.48
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.48
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.48
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.48
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.48
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.47
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.47
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.47
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.47
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.47
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.47
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.47
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.47
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.45
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.45
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.45
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.45
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.45
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.45
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.45
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.45
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.45
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.44
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.44
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.44
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.44
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.44
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.43
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.43
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.43
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.41
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.41
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.41
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.41
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.4
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.4
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.4
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.4
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.39
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.39
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.39
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.38
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.35
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.35
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.32
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.29
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.28
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.27
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.23
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.22
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.22
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.22
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.16
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.16
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.13
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.09
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.06
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.04
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.98
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.97
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.92
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.83
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.34
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.29
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.16
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.11
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.68
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.66
d1n0za_45 Znf265, first zinc-finger domain {Human (Homo sapi 93.3
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 90.58
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 86.3
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=5.8e-26  Score=232.44  Aligned_cols=171  Identities=27%  Similarity=0.387  Sum_probs=147.7

Q ss_pred             CceEEEcCCCCCCCHHHHHHHHhhcCCeeEEEEeecCCCCCccceEEEEcCCHHHHHHHHHHhcCCCeeeCCeeEEEeec
Q 043164          286 SGTIVVKGLSQKTTEEDLYQILAEWGPLRHVRVIKERNSGVSRGFAFIDFPSVGAARAMMDRIGDDGLVVDGRKLFFEYS  365 (1049)
Q Consensus       286 s~~L~V~nLp~~~tee~L~~~F~~~G~i~~v~i~~dk~tg~srG~AFVeF~~~e~A~~Al~~l~~ng~~i~Gr~i~V~~A  365 (1049)
                      .++|||+|||+.+|+++|+++|+.||.|.+|.|+.+..+|.++|||||+|.+.++|..|+..   ++..+.++.+.+...
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~---~~~~~~~~~~~~~~~   82 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA---RPHKVDGRVVEPKRA   82 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHT---CSCEETTEECEEEEC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHh---cCCcccccchhhhhh
Confidence            36899999999999999999999999999999999999999999999999999999999976   677788888887763


Q ss_pred             CCCCCCCCCCCCccccccccccCCCCCCCCccccccccccccccccccccccCCCCCCCCcccCCCCCCCCCCCCCCCCC
Q 043164          366 SKPTGGSGGHYGQESAMGARHSNHKSTIPCDWMCTICGCVNFARRTSCFQCNEARTDDAPPAEMNSSNPIPLGKKGSDTG  445 (1049)
Q Consensus       366 ~~p~~~~~~~~~~~~~~~~~~~~~r~~~p~dw~~~~~~~~n~~~r~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~  445 (1049)
                      ....                           +.+                    .                    .....
T Consensus        83 ~~~~---------------------------~~~--------------------~--------------------~~~~~   95 (183)
T d1u1qa_          83 VSRE---------------------------DSQ--------------------R--------------------PGAHL   95 (183)
T ss_dssp             CCTT---------------------------GGG--------------------S--------------------TTTTC
T ss_pred             hhcc---------------------------ccc--------------------c--------------------ccccc
Confidence            1100                           000                    0                    00011


Q ss_pred             CcceEEEeCCCccCcHHHHHHHhhccCCeeeEEEeecCCCCceeeEEEEEeCCHHHHHHHHHHhCCCeeccCCeEEEEEE
Q 043164          446 PTHVLVVRGLDEYADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFLHFHSVEDASKALEATNGTTLEKNGQILRVAY  525 (1049)
Q Consensus       446 ps~~LfV~NLp~~~teedLre~Fs~fG~I~~v~I~rD~~tg~SrGfAFVeF~s~e~A~kAl~~LnG~~~~i~Gr~L~V~~  525 (1049)
                      +..+|||+|||..+++++|+++|+.||.|..+.|+.+..++.++|||||+|.+.++|.+||+ +++..|  +|+.|+|.+
T Consensus        96 ~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~--~G~~i~V~~  172 (183)
T d1u1qa_          96 TVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTV--NGHNCEVRK  172 (183)
T ss_dssp             CCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEE--TTEEEEEEE
T ss_pred             ccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeE--CCEEEEEEe
Confidence            35689999999999999999999999999999999999999999999999999999999997 788777  799999999


Q ss_pred             eecC
Q 043164          526 AKSI  529 (1049)
Q Consensus       526 Ak~k  529 (1049)
                      |.++
T Consensus       173 A~~k  176 (183)
T d1u1qa_         173 ALSK  176 (183)
T ss_dssp             CCCH
T ss_pred             cCCc
Confidence            8765



>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure