Citrus Sinensis ID: 043301
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 244 | ||||||
| 449460291 | 1296 | PREDICTED: uncharacterized protein LOC10 | 0.532 | 0.100 | 0.335 | 3e-10 | |
| 157679146 | 236 | DC1 domain containing protein [Nicotiana | 0.409 | 0.423 | 0.410 | 1e-09 | |
| 224144656 | 740 | predicted protein [Populus trichocarpa] | 0.409 | 0.135 | 0.394 | 3e-09 | |
| 449460289 | 829 | PREDICTED: uncharacterized protein LOC10 | 0.442 | 0.130 | 0.393 | 5e-09 | |
| 224137826 | 701 | predicted protein [Populus trichocarpa] | 0.409 | 0.142 | 0.413 | 6e-09 | |
| 356572112 | 567 | PREDICTED: uncharacterized protein LOC10 | 0.426 | 0.183 | 0.403 | 1e-08 | |
| 224144591 | 838 | predicted protein [Populus trichocarpa] | 0.340 | 0.099 | 0.435 | 1e-08 | |
| 15224871 | 247 | cysteine/histidine-rich C1 domain-contai | 0.905 | 0.894 | 0.271 | 1e-08 | |
| 15226371 | 248 | cysteine/histidine-rich C1 domain-contai | 0.508 | 0.5 | 0.352 | 2e-08 | |
| 224137818 | 455 | predicted protein [Populus trichocarpa] | 0.409 | 0.219 | 0.394 | 2e-08 |
| >gi|449460291|ref|XP_004147879.1| PREDICTED: uncharacterized protein LOC101206551 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 71.6 bits (174), Expect = 3e-10, Method: Compositional matrix adjust.
Identities = 50/149 (33%), Positives = 69/149 (46%), Gaps = 19/149 (12%)
Query: 10 LKHTSHMHYLIFNENEVGHDDVVIICDICETSLQGPAYGCGT--CEFSIHKSCAELPLKI 67
L + H H L FNE+ + V C C L+ PA+ C C F IH+SC LP +I
Sbjct: 5 LVNRPHQHPLFFNEDGRKINGEVAFCSRCRQPLRPPAFTCSNFDCNFHIHQSCLHLPPQI 64
Query: 68 DHPFH-CHPLTLSKTNHHRCDACLDECSGMAYRCHECCYNLHYHCTALKPSINFKELKCV 126
PFH HPL L +TN++ C C SG YRC +C + + ++KCV
Sbjct: 65 HSPFHPLHPLFL-ETNNYFCTVCWQMPSGDVYRCRKCNFQI--------------DIKCV 109
Query: 127 LHEVMQSLLEKQPQDVELRTIQERNPEDL 155
L + S L + D + R +P L
Sbjct: 110 LTDTKSSGLRRISGD-QFRHFSHPHPLTL 137
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|157679146|dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|224144656|ref|XP_002336168.1| predicted protein [Populus trichocarpa] gi|222874811|gb|EEF11942.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449460289|ref|XP_004147878.1| PREDICTED: uncharacterized protein LOC101206314 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224137826|ref|XP_002322661.1| predicted protein [Populus trichocarpa] gi|222867291|gb|EEF04422.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356572112|ref|XP_003554214.1| PREDICTED: uncharacterized protein LOC100810028 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224144591|ref|XP_002325342.1| predicted protein [Populus trichocarpa] gi|222862217|gb|EEE99723.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15224871|ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128201|gb|AAC16105.1| unknown protein [Arabidopsis thaliana] gi|37202108|gb|AAQ89669.1| At2g44380 [Arabidopsis thaliana] gi|51971661|dbj|BAD44495.1| unknown protein [Arabidopsis thaliana] gi|330255320|gb|AEC10414.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15226371|ref|NP_180394.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|4803954|gb|AAD29826.1| unknown protein [Arabidopsis thaliana] gi|330253004|gb|AEC08098.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224137818|ref|XP_002322659.1| predicted protein [Populus trichocarpa] gi|222867289|gb|EEF04420.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 244 | ||||||
| TAIR|locus:2050477 | 247 | AT2G44380 [Arabidopsis thalian | 0.524 | 0.518 | 0.337 | 2.4e-19 | |
| TAIR|locus:2062804 | 248 | AT2G28270 [Arabidopsis thalian | 0.508 | 0.5 | 0.373 | 1.4e-16 | |
| TAIR|locus:2158347 | 250 | AT5G43520 [Arabidopsis thalian | 0.909 | 0.888 | 0.277 | 4.7e-16 | |
| TAIR|locus:2827948 | 248 | AT2G17740 [Arabidopsis thalian | 0.463 | 0.455 | 0.354 | 1.8e-14 | |
| TAIR|locus:2050589 | 250 | AT2G44370 [Arabidopsis thalian | 0.446 | 0.436 | 0.344 | 2.3e-14 | |
| TAIR|locus:2154689 | 596 | AT5G54040 [Arabidopsis thalian | 0.647 | 0.265 | 0.331 | 4.3e-14 | |
| TAIR|locus:2168728 | 234 | AT5G40590 [Arabidopsis thalian | 0.446 | 0.465 | 0.347 | 6.2e-14 | |
| TAIR|locus:2028977 | 726 | AT1G66440 "AT1G66440" [Arabido | 0.446 | 0.150 | 0.382 | 1.6e-13 | |
| TAIR|locus:2083158 | 769 | AT3G50010 [Arabidopsis thalian | 0.430 | 0.136 | 0.355 | 2.9e-13 | |
| TAIR|locus:2125083 | 652 | AT4G01350 [Arabidopsis thalian | 0.614 | 0.230 | 0.284 | 3.6e-13 |
| TAIR|locus:2050477 AT2G44380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 198 (74.8 bits), Expect = 2.4e-19, Sum P(2) = 2.4e-19
Identities = 49/145 (33%), Positives = 72/145 (49%)
Query: 3 KQFERDKLKHTSHMHYL-IFNENEVGHDDVVIICDICETSLQGPAYGC--GTCEFSIHKS 59
K R ++H SH H L +F + D+VV C CE L G A+ C C++ +HKS
Sbjct: 5 KPVNRPSVRHASHNHPLRVFKARD--EDEVV--CSGCELELTGQAFKCMKSDCDYFLHKS 60
Query: 60 CAELPLKIDHPFHC-HPLTLSKT----NHHRCDACLDECSGMAYRCHECCYNLHYHCTAL 114
C +LP + +H H H LTL + + CDAC + SG Y C EC Y++H C +
Sbjct: 61 CFDLPRETNHKSHPNHSLTLLHSPPYGQSYTCDACGEYGSGFTYNCSECQYDVHVGCAFI 120
Query: 115 KPSINFKELKCVLHEVMQSLLEKQP 139
++ ++ HE +LL P
Sbjct: 121 PETVERED-----HEHPLTLLYNTP 140
|
|
| TAIR|locus:2062804 AT2G28270 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158347 AT5G43520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827948 AT2G17740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050589 AT2G44370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154689 AT5G54040 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168728 AT5G40590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028977 AT1G66440 "AT1G66440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083158 AT3G50010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125083 AT4G01350 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.19070001 | hypothetical protein (740 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 100.0 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.24 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.23 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.19 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.18 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.1 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.06 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.02 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.02 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 98.99 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 98.98 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 98.98 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 98.92 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 98.92 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 98.91 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 98.87 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 98.87 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 98.85 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 98.85 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 98.83 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 98.82 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 98.82 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 98.81 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 98.8 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 98.8 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 98.78 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 98.78 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 98.77 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 98.77 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 98.76 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 98.76 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 98.75 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 98.74 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 98.71 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 98.69 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 98.67 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 98.67 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 98.67 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 98.66 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 98.66 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 98.65 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 98.65 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 98.64 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 98.64 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 98.57 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 98.56 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 98.54 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 98.52 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 98.5 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 98.49 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 98.45 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 98.45 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 98.44 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 98.44 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 98.44 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 98.43 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 98.43 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 98.42 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 98.42 | |
| PF07649 | 30 | C1_3: C1-like domain; InterPro: IPR011424 This sho | 98.41 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 98.39 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 98.38 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 98.37 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 98.36 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 98.35 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 98.35 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 98.32 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 98.31 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 98.31 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 98.29 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 98.29 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 98.26 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 98.26 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 98.23 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 98.23 | |
| PF03107 | 30 | C1_2: C1 domain; InterPro: IPR004146 This short do | 98.22 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 98.22 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 98.21 | |
| PF07649 | 30 | C1_3: C1-like domain; InterPro: IPR011424 This sho | 98.21 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 98.21 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 98.2 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 98.19 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 98.18 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 98.16 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 98.11 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 98.1 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 98.08 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 98.07 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 98.07 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 98.04 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 98.03 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 98.02 | |
| PF03107 | 30 | C1_2: C1 domain; InterPro: IPR004146 This short do | 98.02 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 98.0 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 97.94 | |
| KOG1011 | 1283 | consensus Neurotransmitter release regulator, UNC- | 97.93 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 97.91 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 97.86 | |
| KOG1030 | 168 | consensus Predicted Ca2+-dependent phospholipid-bi | 97.84 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 97.83 | |
| cd02340 | 43 | ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre | 97.82 | |
| PF00130 | 53 | C1_1: Phorbol esters/diacylglycerol binding domain | 97.6 | |
| cd02339 | 45 | ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre | 97.6 | |
| PF00130 | 53 | C1_1: Phorbol esters/diacylglycerol binding domain | 97.58 | |
| cd02249 | 46 | ZZ Zinc finger, ZZ type. Zinc finger present in dy | 97.48 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 97.47 | |
| cd02338 | 49 | ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre | 97.46 | |
| cd02340 | 43 | ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre | 97.4 | |
| cd02341 | 48 | ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present | 97.37 | |
| cd02334 | 49 | ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr | 97.28 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 97.28 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 97.26 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 97.25 | |
| cd02342 | 43 | ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre | 97.07 | |
| cd02343 | 48 | ZZ_EF Zinc finger, ZZ type. Zinc finger present in | 97.07 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 97.05 | |
| cd02344 | 45 | ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present | 97.05 | |
| cd00029 | 50 | C1 Protein kinase C conserved region 1 (C1) . Cyst | 97.04 | |
| cd02335 | 49 | ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present | 97.03 | |
| cd02345 | 49 | ZZ_dah Zinc finger, ZZ type. Zinc finger present i | 97.01 | |
| cd00029 | 50 | C1 Protein kinase C conserved region 1 (C1) . Cyst | 96.97 | |
| cd02339 | 45 | ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre | 96.96 | |
| cd02343 | 48 | ZZ_EF Zinc finger, ZZ type. Zinc finger present in | 96.94 | |
| PLN03008 | 868 | Phospholipase D delta | 96.93 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 96.92 | |
| cd02249 | 46 | ZZ Zinc finger, ZZ type. Zinc finger present in dy | 96.87 | |
| cd02345 | 49 | ZZ_dah Zinc finger, ZZ type. Zinc finger present i | 96.81 | |
| smart00109 | 49 | C1 Protein kinase C conserved region 1 (C1) domain | 96.76 | |
| smart00109 | 49 | C1 Protein kinase C conserved region 1 (C1) domain | 96.73 | |
| cd02338 | 49 | ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre | 96.69 | |
| cd02334 | 49 | ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr | 96.61 | |
| smart00291 | 44 | ZnF_ZZ Zinc-binding domain, present in Dystrophin, | 96.59 | |
| cd02337 | 41 | ZZ_CBP Zinc finger, ZZ type. Zinc finger present i | 96.58 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 96.57 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 96.52 | |
| PF00569 | 46 | ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc | 96.51 | |
| PF00569 | 46 | ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc | 96.49 | |
| cd02341 | 48 | ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present | 96.46 | |
| cd02344 | 45 | ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present | 96.43 | |
| KOG4582 | 278 | consensus Uncharacterized conserved protein, conta | 96.42 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 96.2 | |
| cd02342 | 43 | ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre | 96.16 | |
| cd02335 | 49 | ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present | 96.1 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 96.1 | |
| smart00291 | 44 | ZnF_ZZ Zinc-binding domain, present in Dystrophin, | 96.08 | |
| cd02337 | 41 | ZZ_CBP Zinc finger, ZZ type. Zinc finger present i | 95.5 | |
| KOG1280 | 381 | consensus Uncharacterized conserved protein contai | 95.31 | |
| KOG1280 | 381 | consensus Uncharacterized conserved protein contai | 94.8 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 94.6 | |
| KOG4582 | 278 | consensus Uncharacterized conserved protein, conta | 94.45 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 93.02 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 92.73 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 92.6 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 91.79 | |
| KOG0905 | 1639 | consensus Phosphoinositide 3-kinase [Signal transd | 91.51 | |
| KOG0695 | 593 | consensus Serine/threonine protein kinase [Signal | 89.88 | |
| KOG1326 | 1105 | consensus Membrane-associated protein FER-1 and re | 88.6 | |
| cd02336 | 45 | ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present | 87.78 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 87.41 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 86.55 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 86.45 | |
| KOG2807 | 378 | consensus RNA polymerase II transcription initiati | 86.18 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 85.91 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 85.2 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 85.19 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 84.99 | |
| KOG2996 | 865 | consensus Rho guanine nucleotide exchange factor V | 84.49 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 84.25 | |
| KOG4286 | 966 | consensus Dystrophin-like protein [Cell motility; | 84.17 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 83.23 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 82.87 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 81.56 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 81.01 | |
| KOG1031 | 1169 | consensus Predicted Ca2+-dependent phospholipid-bi | 80.2 |
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-55 Score=409.05 Aligned_cols=192 Identities=22% Similarity=0.422 Sum_probs=172.2
Q ss_pred cccccccccccCCCCC---cEEeCCCCCccccccccCCC----------cCCCCCCCCcceEeec-CcccccccccCCCC
Q 043301 30 DVVIICDICETSLQGP---AYGCGTCEFSIHKSCAELPL----------KIDHPFHCHPLTLSKT-NHHRCDACLDECSG 95 (244)
Q Consensus 30 ~~~~~C~~C~~~i~g~---~Y~C~~C~F~lH~~Ca~~p~----------~i~hp~H~H~L~L~~~-~~~~Cd~Cg~~~~g 95 (244)
..+++|++|.++|||+ +|+|++|.|++|++|+++.. ..+.|..+|.+++++| ++++||+||+.++|
T Consensus 54 KqPTfCsHCkDFiwGfgKQGfQCqvC~fvvHkrChefVtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGsLLyG 133 (683)
T KOG0696|consen 54 KQPTFCSHCKDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGSLLYG 133 (683)
T ss_pred cCCchhhhhhhheeccccCceeeeEEeehhhhhhcceEEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHHHHHH
Confidence 5689999999999986 79999999999999999742 2466778999999999 99999999999988
Q ss_pred e---eEEcCCccceeccccccCcCccccCccccCCcCccccccccCCCCcEEEEEeccCCcceeeecccccccccCCCCc
Q 043301 96 M---AYRCHECCYNLHYHCTALKPSINFKELKCVLHEVMQSLLEKQPQDVELRTIQERNPEDLTFHDVFSSFTEKDRNQL 172 (244)
Q Consensus 96 ~---~Y~C~~Cd~~lH~~Ca~~p~~i~~~~~~h~~H~h~l~L~~~~p~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~n~l 172 (244)
. +++|+.|++++|.+|+..+|++ |+.+|++.+ |++.+.+.++++.|.++|.||. ||||||||||
T Consensus 134 l~HQGmKC~~C~mNVH~rCv~nVPsl--CG~DhtE~R----------Grl~l~~~~~~~~l~v~i~ea~-NLiPMDpNGl 200 (683)
T KOG0696|consen 134 LIHQGMKCDTCDMNVHHRCVENVPSL--CGTDHTERR----------GRLYLEAHIKRDVLTVTIKEAK-NLIPMDPNGL 200 (683)
T ss_pred HHhcccccccccchHHHHHhhcCCcc--cCCcchhhc----------ceEEEEEEecCceEEEEehhhc-cccccCCCCC
Confidence 6 6999999999999999999999 999999998 9999999999999999999998 5999999999
Q ss_pred chhhHHHHhhhhcccccccccCCCCceeEeecCCCCChhhhhhhhhhcCCCCccceeEEEEeccCccccc
Q 043301 173 DDITENIESEIAGIKKTLSETGDQGSKVTISESYPYSDDTLAQFILRLQNSLRSKNMSVEFWDLDDVLVN 242 (244)
Q Consensus 173 ~d~~~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 242 (244)
||||+++| +++.-...+||+||++.+++||.||| +|+|+|+|+|+|||||||||||||||||
T Consensus 201 SDPYvk~k-----liPD~~~~sKqKTkTik~~LNP~wNE---tftf~Lkp~DkdrRlsiEvWDWDrTsRN 262 (683)
T KOG0696|consen 201 SDPYVKLK-----LIPDPKNESKQKTKTIKATLNPVWNE---TFTFKLKPSDKDRRLSIEVWDWDRTSRN 262 (683)
T ss_pred CCcceeEE-----eccCCcchhhhhhhhhhhhcCccccc---eeEEecccccccceeEEEEecccccccc
Confidence 99998854 22222223899999666688888888 6999999999999999999999999999
|
|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd02340 ZZ_NBR1_like Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger | Back alignment and domain information |
|---|
| >cd02339 ZZ_Mind_bomb Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger | Back alignment and domain information |
|---|
| >cd02249 ZZ Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd02338 ZZ_PCMF_like Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02340 ZZ_NBR1_like Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02341 ZZ_ZZZ3 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02334 ZZ_dystrophin Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd02342 ZZ_UBA_plant Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02343 ZZ_EF Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02344 ZZ_HERC2 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd00029 C1 Protein kinase C conserved region 1 (C1) | Back alignment and domain information |
|---|
| >cd02335 ZZ_ADA2 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02345 ZZ_dah Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd00029 C1 Protein kinase C conserved region 1 (C1) | Back alignment and domain information |
|---|
| >cd02339 ZZ_Mind_bomb Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02343 ZZ_EF Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02249 ZZ Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02345 ZZ_dah Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) | Back alignment and domain information |
|---|
| >smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) | Back alignment and domain information |
|---|
| >cd02338 ZZ_PCMF_like Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02334 ZZ_dystrophin Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein | Back alignment and domain information |
|---|
| >cd02337 ZZ_CBP Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd02341 ZZ_ZZZ3 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02344 ZZ_HERC2 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >cd02342 ZZ_UBA_plant Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02335 ZZ_ADA2 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein | Back alignment and domain information |
|---|
| >cd02337 ZZ_CBP Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >cd02336 ZZ_RSC8 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2996 consensus Rho guanine nucleotide exchange factor VAV3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 244 | |||
| 1v5n_A | 89 | PDI-like hypothetical protein AT1G60420; DC1 domai | 2e-19 | |
| 1v5n_A | 89 | PDI-like hypothetical protein AT1G60420; DC1 domai | 7e-06 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 3e-04 |
| >1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 | Back alignment and structure |
|---|
Score = 79.2 bits (195), Expect = 2e-19
Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 2/70 (2%)
Query: 49 CGTCEFSIHKSCAELPLKIDHPFH-CHPLTLSKTNHHRCDACLDECSGMAYRCHECCYNL 107
E + + P K+ H H H L L++ + CD C +E + +Y C EC ++L
Sbjct: 12 LKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVYTCDKCEEEGTIWSYHCDECDFDL 71
Query: 108 HYHCTALKPS 117
H C AL
Sbjct: 72 HAKC-ALNED 80
|
| >1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.94 | |
| 1v5n_A | 89 | PDI-like hypothetical protein AT1G60420; DC1 domai | 99.47 | |
| 1v5n_A | 89 | PDI-like hypothetical protein AT1G60420; DC1 domai | 99.46 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.14 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.13 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.11 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.04 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 98.99 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 98.99 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 98.98 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 98.95 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 98.95 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 98.94 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 98.93 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 98.92 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 98.91 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 98.9 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 98.89 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 98.89 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 98.89 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 98.88 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 98.88 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 98.88 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 98.87 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 98.87 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 98.85 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 98.81 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 98.7 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 98.7 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 98.7 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 98.69 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 98.67 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 98.66 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 98.6 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 98.59 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 98.57 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 98.56 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 98.56 | |
| 2eli_A | 85 | Protein kinase C alpha type; PKC-alpha, PKC-A, str | 98.55 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 98.54 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 98.53 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 98.47 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 98.46 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 98.29 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 98.19 | |
| 2enz_A | 65 | NPKC-theta, protein kinase C theta type; zinc bind | 98.08 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 97.95 | |
| 1ptq_A | 50 | Protein kinase C delta type; phosphotransferase; 1 | 97.92 | |
| 1rfh_A | 59 | RAS association (ralgds/AF-6) domain family 5; zin | 97.92 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 97.91 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 97.9 | |
| 1kbe_A | 49 | Kinase suppressor of RAS; KSR, cysteine-rich domai | 97.88 | |
| 2fnf_X | 72 | Putative RAS effector NORE1; zinc, signal transduc | 97.86 | |
| 2row_A | 84 | RHO-associated protein kinase 2; ATP-binding, coil | 97.83 | |
| 2row_A | 84 | RHO-associated protein kinase 2; ATP-binding, coil | 97.83 | |
| 2enz_A | 65 | NPKC-theta, protein kinase C theta type; zinc bind | 97.82 | |
| 1faq_A | 52 | RAF-1; transferase, serine/threonine-protein kinas | 97.82 | |
| 2eli_A | 85 | Protein kinase C alpha type; PKC-alpha, PKC-A, str | 97.8 | |
| 1ptq_A | 50 | Protein kinase C delta type; phosphotransferase; 1 | 97.79 | |
| 3uej_A | 65 | NPKC-delta, protein kinase C delta type; proteine | 97.79 | |
| 1y8f_A | 66 | UNC-13 homolog A, MUNC13-1; cysteine-rich domain, | 97.76 | |
| 2db6_A | 74 | SH3 and cysteine rich domain 3; STAC3, C1 domain, | 97.75 | |
| 2enn_A | 77 | NPKC-theta, protein kinase C theta type; zinc bind | 97.73 | |
| 3uej_A | 65 | NPKC-delta, protein kinase C delta type; proteine | 97.73 | |
| 2yuu_A | 83 | NPKC-delta, protein kinase C delta type; metal bin | 97.71 | |
| 2db6_A | 74 | SH3 and cysteine rich domain 3; STAC3, C1 domain, | 97.68 | |
| 2enn_A | 77 | NPKC-theta, protein kinase C theta type; zinc bind | 97.65 | |
| 1faq_A | 52 | RAF-1; transferase, serine/threonine-protein kinas | 97.65 | |
| 2yuu_A | 83 | NPKC-delta, protein kinase C delta type; metal bin | 97.65 | |
| 2fnf_X | 72 | Putative RAS effector NORE1; zinc, signal transduc | 97.64 | |
| 1rfh_A | 59 | RAS association (ralgds/AF-6) domain family 5; zin | 97.63 | |
| 1y8f_A | 66 | UNC-13 homolog A, MUNC13-1; cysteine-rich domain, | 97.62 | |
| 1kbe_A | 49 | Kinase suppressor of RAS; KSR, cysteine-rich domai | 97.29 | |
| 2e5r_A | 63 | Dystrobrevin alpha; ZZ domain, structural genomics | 97.17 | |
| 2fc7_A | 82 | ZZZ3 protein; structure genomics, ZZ domain, struc | 97.03 | |
| 4b6d_A | 61 | RAC GTPase-activating protein 1; signaling protein | 96.97 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 96.82 | |
| 2dip_A | 98 | Zinc finger SWIM domain-containing protein 2; ZZ d | 96.8 | |
| 2e5r_A | 63 | Dystrobrevin alpha; ZZ domain, structural genomics | 96.76 | |
| 1tot_A | 52 | CREB-binding protein; zinc binding, CBP, TAZ2, tra | 96.73 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 96.39 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 96.38 | |
| 2dip_A | 98 | Zinc finger SWIM domain-containing protein 2; ZZ d | 96.28 | |
| 4b6d_A | 61 | RAC GTPase-activating protein 1; signaling protein | 96.15 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 96.07 | |
| 2fc7_A | 82 | ZZZ3 protein; structure genomics, ZZ domain, struc | 96.06 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 96.03 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 95.94 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 95.76 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 95.75 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 95.72 | |
| 1tot_A | 52 | CREB-binding protein; zinc binding, CBP, TAZ2, tra | 95.44 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 95.35 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 95.3 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 90.49 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 85.13 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 82.61 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 81.49 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 81.28 |
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
Probab=99.94 E-value=5.5e-28 Score=238.48 Aligned_cols=200 Identities=23% Similarity=0.389 Sum_probs=123.5
Q ss_pred CCCEeeeeccCCCcccccccccccCCCC---CcEEeCCCCCccccccccCCCcC----------CCCCCCCcceEeec-C
Q 043301 17 HYLIFNENEVGHDDVVIICDICETSLQG---PAYGCGTCEFSIHKSCAELPLKI----------DHPFHCHPLTLSKT-N 82 (244)
Q Consensus 17 H~L~L~~~~~~~~~~~~~C~~C~~~i~g---~~Y~C~~C~F~lH~~Ca~~p~~i----------~hp~H~H~L~L~~~-~ 82 (244)
|.++. .. ...+++|++|+..||| .+|+|..|++.+|++|....... +.+.-.|.+...++ .
T Consensus 38 H~f~~-~~----~~~p~~C~~C~~~i~g~~~qg~~C~~C~~~~H~~C~~~v~~~c~~~~~~~~~~~~~~~h~~~~~~~~~ 112 (674)
T 3pfq_A 38 HKFTA-RF----FKQPTFCSHCTDFIWGFGKQGFQCQVCSFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSS 112 (674)
T ss_dssp ---------------------------------------------------------------------CCCCCEECCSS
T ss_pred ceEEe-ee----CCCCCccccccccccccCCceeECCCCCCCcChhhcCcCcccCCCcccccccccccCCcceeecCCCC
Confidence 66655 11 3568999999999998 48999999999999999864321 12334789988887 8
Q ss_pred cccccccccCCCCe---eEEcCCccceeccccccCcCccccCccccCCcCccccccccCCCCcEEEEEeccCCcceeeec
Q 043301 83 HHRCDACLDECSGM---AYRCHECCYNLHYHCTALKPSINFKELKCVLHEVMQSLLEKQPQDVELRTIQERNPEDLTFHD 159 (244)
Q Consensus 83 ~~~Cd~Cg~~~~g~---~Y~C~~Cd~~lH~~Ca~~p~~i~~~~~~h~~H~h~l~L~~~~p~~~~~~~~~~~~~~~~~v~~ 159 (244)
+++|++|++.+.|. +|+|..|++++|.+|....+.+ |+.++...+ |++.+......+.+.++|.+
T Consensus 113 ~~~C~~C~~~l~g~~~qg~~C~~C~~~~H~~C~~~v~~~--C~~d~~~~~----------g~i~~~~~~~~~~L~V~v~~ 180 (674)
T 3pfq_A 113 PTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSL--CGTDHTERR----------GRIYIQAHIDREVLIVVVRD 180 (674)
T ss_dssp CCCCSSSCSCCBBSSSCEECCSSSCCCBCSSTTSSSCCC--SSSCSSCCS----------CEEEEEEEECSSEEEEEEEE
T ss_pred CCCCCccccccchhhcCccccccCCcchhhhhhhccCcc--ccccccccc----------ccccccceeccceeeeeeec
Confidence 89999999988774 7999999999999999999888 888888776 77777777778889999999
Q ss_pred ccccccccCCCCcchhhHHHHhhhhcccccccccCCCCceeEeecCCCCChhhhhhhhhhcCCCCccceeEEEEeccCcc
Q 043301 160 VFSSFTEKDRNQLDDITENIESEIAGIKKTLSETGDQGSKVTISESYPYSDDTLAQFILRLQNSLRSKNMSVEFWDLDDV 239 (244)
Q Consensus 160 ~~~~~~~~~~n~l~d~~~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 239 (244)
|. +|.+||++|.+|||+++. +...-....+++|++.-.+++|.||| +|.|.+..++.+++|.|||||||+.
T Consensus 181 a~-~L~~~d~~g~sDPyvkv~-----l~p~~~~~~k~kT~v~~~tlnP~wne---~f~f~~~~~~~~~~L~v~v~d~d~~ 251 (674)
T 3pfq_A 181 AK-NLVPMDPNGLSDPYVKLK-----LIPDPKSESKQKTKTIKSSLNPEWNE---TFRFQLKESDKDRRLSVEIWDWDLT 251 (674)
T ss_dssp EE-SCCCCSTTSSCCEEEEEE-----EESCSSCCSCEECCCCSSCSSCEEEE---EEEEECCSTTTTCEEEEEEEECCSS
T ss_pred cc-ccCCCCcccccCcccccc-----cccCccccccccccccccccCCCccc---eeeeecccCCccceeeeEEeecccc
Confidence 97 589999999999998854 11111112456677455577787877 6999999999999999999999999
Q ss_pred ccc
Q 043301 240 LVN 242 (244)
Q Consensus 240 ~~~ 242 (244)
++|
T Consensus 252 ~~d 254 (674)
T 3pfq_A 252 SRN 254 (674)
T ss_dssp SCC
T ss_pred ccc
Confidence 886
|
| >1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 | Back alignment and structure |
|---|
| >1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* | Back alignment and structure |
|---|
| >1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A | Back alignment and structure |
|---|
| >2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A | Back alignment and structure |
|---|
| >2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* | Back alignment and structure |
|---|
| >3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* | Back alignment and structure |
|---|
| >1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* | Back alignment and structure |
|---|
| >2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A | Back alignment and structure |
|---|
| >2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A | Back alignment and structure |
|---|
| >2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 244 | ||||
| d1v5na_ | 89 | g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 | 2e-16 | |
| d1v5na_ | 89 | g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 | 2e-06 |
| >d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 | Back information, alignment and structure |
|---|
class: Small proteins fold: Cysteine-rich domain superfamily: Cysteine-rich domain family: C1-like domain domain: Pdi-like hypothetical protein At1g60420 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 70.3 bits (172), Expect = 2e-16
Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 2/70 (2%)
Query: 49 CGTCEFSIHKSCAELPLKIDHPFH-CHPLTLSKTNHHRCDACLDECSGMAYRCHECCYNL 107
E + + P K+ H H H L L++ + CD C +E + +Y C EC ++L
Sbjct: 12 LKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVYTCDKCEEEGTIWSYHCDECDFDL 71
Query: 108 HYHCTALKPS 117
H C AL
Sbjct: 72 HAKC-ALNED 80
|
| >d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| d1v5na_ | 89 | Pdi-like hypothetical protein At1g60420 {Thale cre | 99.59 | |
| d1v5na_ | 89 | Pdi-like hypothetical protein At1g60420 {Thale cre | 99.55 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.22 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.9 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.72 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 98.72 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 98.7 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.7 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 98.66 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 98.57 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.54 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 98.53 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.49 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 98.4 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 98.38 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 98.31 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 98.19 | |
| d1tbna_ | 66 | Protein kinase c-gamma {Rat (Rattus rattus) [TaxId | 98.18 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 98.17 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 98.17 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 98.1 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 98.08 | |
| d1tbna_ | 66 | Protein kinase c-gamma {Rat (Rattus rattus) [TaxId | 97.82 | |
| d1faqa_ | 52 | RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.76 | |
| d1xa6a3 | 62 | Beta-chimaerin, middle domain {Human (Homo sapiens | 97.74 | |
| d1faqa_ | 52 | RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.69 | |
| d1ptqa_ | 50 | Protein kinase C-delta (PKCdelta) {Mouse (Mus musc | 97.62 | |
| d1xa6a3 | 62 | Beta-chimaerin, middle domain {Human (Homo sapiens | 97.61 | |
| d1kbea_ | 49 | Kinase suppressor of Ras, Ksr {Mouse (Mus musculus | 97.61 | |
| d1ptqa_ | 50 | Protein kinase C-delta (PKCdelta) {Mouse (Mus musc | 97.49 | |
| d1kbea_ | 49 | Kinase suppressor of Ras, Ksr {Mouse (Mus musculus | 97.36 | |
| d2fc7a1 | 69 | Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu | 97.16 | |
| d2dipa1 | 85 | Zinc finger ZZ-type-containing protein 2 {Human (H | 96.87 | |
| d1tota1 | 52 | CREB-binding protein, CBP {Mouse (Mus musculus) [T | 96.85 | |
| d2fc7a1 | 69 | Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu | 96.63 | |
| d1r79a_ | 84 | Diacylglycerol kinase delta {Human (Homo sapiens) | 96.53 | |
| d1r79a_ | 84 | Diacylglycerol kinase delta {Human (Homo sapiens) | 96.43 | |
| d2dipa1 | 85 | Zinc finger ZZ-type-containing protein 2 {Human (H | 96.33 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 95.61 | |
| d1tota1 | 52 | CREB-binding protein, CBP {Mouse (Mus musculus) [T | 94.85 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 86.29 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 80.03 |
| >d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Cysteine-rich domain superfamily: Cysteine-rich domain family: C1-like domain domain: Pdi-like hypothetical protein At1g60420 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.59 E-value=4.8e-17 Score=120.65 Aligned_cols=75 Identities=27% Similarity=0.539 Sum_probs=70.4
Q ss_pred CCCcEEeCCCCCccccccccCCCcCCCCCC-CCcceEeecCcccccccccCCCCeeEEcCCccceeccccccCcCc
Q 043301 43 QGPAYGCGTCEFSIHKSCAELPLKIDHPFH-CHPLTLSKTNHHRCDACLDECSGMAYRCHECCYNLHYHCTALKPS 117 (244)
Q Consensus 43 ~g~~Y~C~~C~F~lH~~Ca~~p~~i~hp~H-~H~L~L~~~~~~~Cd~Cg~~~~g~~Y~C~~Cd~~lH~~Ca~~p~~ 117 (244)
.|..|+|.+|++.+|+.|+.+|.+|+|+.| .|+|+|.......|++|++.+.||+|+|..|+|++|..||..|..
T Consensus 6 ~~t~~~~~e~~~~~he~c~~~P~~I~Hp~Hp~H~L~L~~~~~~~C~~C~~~~~g~~Y~C~~C~f~LH~~CA~~P~~ 81 (89)
T d1v5na_ 6 SGTEERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVYTCDKCEEEGTIWSYHCDECDFDLHAKCALNEDT 81 (89)
T ss_dssp CCCSSCCSHHHHHHHHHTSSSCSEECCSTTTTSCEEEECCSSCCCTTTSCCCCSCEEECTTTCCCCCHHHHHCSSC
T ss_pred CchHHHHHHHHhhhhHHHhcCCCeecCCCCCCCCeEEecCCCCEeCCCCCCcCCcEeEeccCCCEecHHHcCCCcc
Confidence 467899999999999999999999999999 699999887788999999999999999999999999999999854
|
| >d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|