Citrus Sinensis ID: 043351

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MIVGLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEWL
cccccccHHHHHHHHHHHHHHcccccEEEEccccEEEEEEcHHHHHHHHHHHHHHEEEEEccccEEEEEEccEEEEEEEEcccccHHHHcccccccccEEEEEEcccccccHHHHHHHHcccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccEEcc
cEEEccEEEEEcHHHHHHHHHHHHHHccccccccEEEEcHHHHHHHHHHHHcccEEEEEccccccEEEEccccccEEEEccccccHHHHHHHccHHHHcccccccccccccHHHHHHHHHHcccEEEEEccccccccHHHHHHcccHHHHcHHHEEEccccccHHcccccHHHHHHHHHHHEEccccHHHHHccHHHHHHHccHEccccccHHHHHHc
MIVGLGMCIVLLSSYFNISATRSFFQEFnentdniiscktcdmVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCisnnsfesnnlikeippnvgkLVHLRYLNLSDKFIETTGVFVNTIimpclssfqiescpklkmlpyyLLQTTKLQELKIYLCHILEEWL
MIVGLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEWL
MIVGLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEWL
*IVGLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEW*
***GLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHI****YDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEWL
MIVGLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEWL
MIVGLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEWL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVGLGMCIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQLVISSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILEEWL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
Q9STE7 847 Putative disease resistan yes no 0.623 0.160 0.246 0.0008
>sp|Q9STE7|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1 Back     alignment and function desciption
 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 73/158 (46%), Gaps = 22/158 (13%)

Query: 15  YFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSEQL-VISSFDEKIKRLHISCKM 73
           Y +    RS  +        ++SC+  D++ D +   +++L  ++ ++EK     I C+ 
Sbjct: 463 YIDELVDRSLVKAERIERGKVMSCRIHDLLRDLAIKKAKELNFVNVYNEKQHSSDI-CR- 520

Query: 74  YDTVHEFSQHLSEELFISSFDEKVCHSILTLSFIS-------VNSRNLLQELFGELTCLR 126
                E   HL  + ++   D +V   + +  FI        VN+ NL      +L  LR
Sbjct: 521 ----REVVHHLMNDYYLC--DRRVNKRMRSFLFIGERRGFGYVNTTNL------KLKLLR 568

Query: 127 ALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFI 164
            L +    F S N+   +P  +G+L+HLRYL ++D ++
Sbjct: 569 VLNMEGLLFVSKNISNTLPDVIGELIHLRYLGIADTYV 606
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
359482788 903 PREDICTED: putative disease resistance p 0.834 0.201 0.346 4e-18
359482769 904 PREDICTED: putative disease resistance p 0.834 0.201 0.356 6e-18
359482790 923 PREDICTED: putative disease resistance p 0.834 0.197 0.351 4e-17
297743527 613 unnamed protein product [Vitis vinifera] 0.816 0.290 0.334 8e-16
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.816 0.188 0.321 2e-15
359482794 880 PREDICTED: putative disease resistance p 0.784 0.194 0.336 3e-15
147855898 1295 hypothetical protein VITISV_034885 [Viti 0.619 0.104 0.394 4e-15
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.816 0.200 0.321 5e-15
359482784 919 PREDICTED: putative disease resistance p 0.802 0.190 0.352 5e-15
359482792 922 PREDICTED: putative disease resistance p 0.619 0.146 0.388 5e-15
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 109/202 (53%), Gaps = 20/202 (9%)

Query: 14  SYFNISATRSFFQEFNENTD-NIISCKTCDMVHDFSQYLSEQ--LVISSFDEKIKRLHIS 70
           +YF   A RSFFQ+F ++TD NII CK  D+VHDF+Q+L++    ++   +++++ + +S
Sbjct: 447 TYFEYLAARSFFQDFEKDTDGNIIRCKMHDIVHDFAQFLTQNECFIVEVDNQQMESIDLS 506

Query: 71  CKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCI 130
            K    +    +  S   F+S+++ K  H++L       +    L  L   LTCLRAL +
Sbjct: 507 FKKIRHITLVVRE-STPNFVSTYNMKNLHTLLAKEAFKSSVLVALPNLLRHLTCLRALDL 565

Query: 131 SNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFI-----ETTGVFVNTIIMPCLSSFQIE 185
           S     SN LI+E+P  VGKL+HLR+LNLS  F      ET     N      L +  I+
Sbjct: 566 S-----SNQLIEELPKEVGKLIHLRFLNLSGCFWLRELPETICDLYN------LQTLNIQ 614

Query: 186 SCPKLKMLPYYLLQTTKLQELK 207
            C  L+ LP  + +   L+ L+
Sbjct: 615 GCSSLRKLPQAMGKLINLRHLE 636

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743527|emb|CBI36394.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482794|ref|XP_002268547.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147855898|emb|CAN78626.1| hypothetical protein VITISV_034885 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
UNIPROTKB|Q96L50 414 LRR1 "Leucine-rich repeat prot 0.380 0.200 0.333 0.00013
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.183 0.044 0.476 0.00031
UNIPROTKB|Q96L50 LRR1 "Leucine-rich repeat protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 117 (46.2 bits), Expect = 0.00013, P = 0.00013
 Identities = 29/87 (33%), Positives = 51/87 (58%)

Query:   125 LRALCISN-NSFE-SNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFV-NTIIMPCLSS 181
             +R LC+ +    + S+N IK++P  +G L+HL+ LNL+D  +E+  V + ++ +   L S
Sbjct:   171 MRMLCLKSLRKLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRS 230

Query:   182 FQIESCPKLKMLPYYLLQTTKLQELKI 208
               + S  K+K LP    Q  +L+ LK+
Sbjct:   231 LDL-SKNKIKALPVQFCQLQELKNLKL 256
GO:0016567 "protein ubiquitination" evidence=IEA
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.4
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.37
KOG0617264 consensus Ras suppressor protein (contains leucine 99.26
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.26
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.23
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.21
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.08
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.03
PLN03150623 hypothetical protein; Provisional 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
PLN03150623 hypothetical protein; Provisional 98.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.84
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.7
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.6
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.55
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.51
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.5
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.41
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.4
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.29
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.07
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.95
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.89
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.88
PRK15386 426 type III secretion protein GogB; Provisional 97.85
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.84
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.83
PRK15386 426 type III secretion protein GogB; Provisional 97.82
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.79
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.57
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.51
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.06
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.8
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 96.74
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.6
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.51
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.41
KOG0473 326 consensus Leucine-rich repeat protein [Function un 96.31
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.53
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.39
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.23
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.89
smart0037026 LRR Leucine-rich repeats, outliers. 94.11
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.11
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.42
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.24
smart0037026 LRR Leucine-rich repeats, outliers. 92.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 92.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.77
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.35
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 88.83
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 88.35
PF1416257 YozD: YozD-like protein 85.63
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 85.38
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 84.7
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.66
KOG1947 482 consensus Leucine rich repeat proteins, some prote 82.66
KOG1947 482 consensus Leucine rich repeat proteins, some prote 81.28
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.91  E-value=1.4e-24  Score=197.92  Aligned_cols=189  Identities=22%  Similarity=0.270  Sum_probs=156.1

Q ss_pred             cccchh---------HHHHHHHHHHHHHhCCCccccccCCCCeeeEEeChhHHHHHHHHHH-hhcc--------------
Q 043351            2 IVGLGM---------CIVLLSSYFNISATRSFFQEFNENTDNIISCKTCDMVHDFSQYLSE-QLVI--------------   57 (218)
Q Consensus         2 ~~g~g~---------~e~~~~~y~~~L~~rsli~~~~~~~~~~~~~~mHdl~~dl~~~i~~-~~~~--------------   57 (218)
                      |++.|+         ++++|++|+.+|++|+|++..+.. ++..+|+|||+|||+|.++|+ .+..              
T Consensus       437 WiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~-~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~  515 (889)
T KOG4658|consen  437 WIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE-GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSE  515 (889)
T ss_pred             HHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc-cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccc
Confidence            677774         478999999999999999987754 667899999999999999998 4332              


Q ss_pred             ---cccCCceeEEEEeeeccchhhhhhhhhhhhhhccccCCCCeeEEEeccccccchhhhHHHHHhcCCCCcEEEecCCC
Q 043351           58 ---SSFDEKIKRLHISCKMYDTVHEFSQHLSEELFISSFDEKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNS  134 (218)
Q Consensus        58 ---~~~~~~~r~l~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~  134 (218)
                         ...+..+|++++..+..           ...+... ..+.|++|.+..+.. ......+..|..++.||+|||++|.
T Consensus       516 ~~~~~~~~~~rr~s~~~~~~-----------~~~~~~~-~~~~L~tLll~~n~~-~l~~is~~ff~~m~~LrVLDLs~~~  582 (889)
T KOG4658|consen  516 IPQVKSWNSVRRMSLMNNKI-----------EHIAGSS-ENPKLRTLLLQRNSD-WLLEISGEFFRSLPLLRVLDLSGNS  582 (889)
T ss_pred             cccccchhheeEEEEeccch-----------hhccCCC-CCCccceEEEeecch-hhhhcCHHHHhhCcceEEEECCCCC
Confidence               22345678999988776           3344433 444799999988642 2445566778999999999999988


Q ss_pred             CcccccccccCcccCCCCCCCeEeccCCCccccccccccccCce-ecEEeecCCCCCCCCchhhcCCCCCcEEeccCCC
Q 043351          135 FESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPC-LSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCH  212 (218)
Q Consensus       135 ~~~~~~l~~lp~~i~~L~~L~~L~l~~~~l~~~~~lp~~i~~L~-L~~L~l~~~~~l~~lP~~i~~L~~L~~L~l~~~~  212 (218)
                      .     +.++|.+|+.|.|||||+++++.+..   +|.++++|. |++|++..+..+..+|..+..|++||+|.+....
T Consensus       583 ~-----l~~LP~~I~~Li~LryL~L~~t~I~~---LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~  653 (889)
T KOG4658|consen  583 S-----LSKLPSSIGELVHLRYLDLSDTGISH---LPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA  653 (889)
T ss_pred             c-----cCcCChHHhhhhhhhcccccCCCccc---cchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc
Confidence            6     99999999999999999999999999   999999999 9999999988787787666779999999987764

>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF14162 YozD: YozD-like protein Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
 Score = 44.5 bits (105), Expect = 1e-05
 Identities = 21/129 (16%), Positives = 36/129 (27%), Gaps = 36/129 (27%)

Query: 111 SRNLLQELFGELTCLRALCISNNSFE--------------SNNLIKEIPPNVGKLVHLRY 156
           S N L  L    + L+ L +S N                   N +  +P ++  L     
Sbjct: 229 SGNRLTSLPVLPSELKELMVSGNRLTSLPMLPSGLLSLSVYRNQLTRLPESLIHLSSETT 288

Query: 157 LNLSDKFIETTGVFVNTIIMPCLSSFQIESCPKLKMLPYYLLQTTK-------LQELKIY 209
           +NL            N      LS   +++  ++   P Y     +              
Sbjct: 289 VNLEG----------NP-----LSERTLQALREITSAPGYSGPIIRFDMAGASAPRETRA 333

Query: 210 LCHILEEWL 218
           L     +WL
Sbjct: 334 LHLAAADWL 342
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.62
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.61
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.53
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.51
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.5
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.5
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.48
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.48
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.48
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.47
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.47
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.46
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.46
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.45
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.45
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.45
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.44
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.44
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.44
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.43
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.43
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.43
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.43
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.42
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.42
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.42
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.42
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.42
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.41
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 99.41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.4
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.4
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.39
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.39
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.39
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.37
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.37
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.37
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.36
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.36
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.35
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.35
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.35
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.35
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.34
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.34
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.33
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.33
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.33
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.32
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.32
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.3
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.3
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.3
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.3
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.3
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.28
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.28
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.27
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.22
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.2
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.2
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.18
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.17
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.15
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.03
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.97
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.9
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.89
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.86
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.84
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.83
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.72
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.68
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.56
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.53
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.51
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.42
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.25
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.23
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.23
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.88
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.86
2ra8_A 362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.71
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.52
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.15
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.46
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.49
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.38
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 94.26
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 94.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 91.31
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 86.69
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.62  E-value=1e-15  Score=125.87  Aligned_cols=109  Identities=20%  Similarity=0.216  Sum_probs=77.7

Q ss_pred             CCCeeEEEeccccccchhhhHHHHHhcCCCCcEEEecCCCCcccccccccCcccCCCCCCCeEeccCCCccccccccccc
Q 043351           95 EKVCHSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTI  174 (218)
Q Consensus        95 ~~~Lr~L~l~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~~~~~~~l~~lp~~i~~L~~L~~L~l~~~~l~~~~~lp~~i  174 (218)
                      +++|+.|.+.++..    ..+|..+..+++|++|++++|.      +..+|+.++.+++|++|++++|.+  .+.+|..+
T Consensus       182 l~~L~~L~L~~n~l----~~lp~~l~~l~~L~~L~L~~N~------l~~l~~~l~~l~~L~~L~Ls~n~~--~~~~p~~~  249 (328)
T 4fcg_A          182 LVNLQSLRLEWTGI----RSLPASIANLQNLKSLKIRNSP------LSALGPAIHHLPKLEELDLRGCTA--LRNYPPIF  249 (328)
T ss_dssp             STTCCEEEEEEECC----CCCCGGGGGCTTCCEEEEESSC------CCCCCGGGGGCTTCCEEECTTCTT--CCBCCCCT
T ss_pred             CCCCCEEECcCCCc----CcchHhhcCCCCCCEEEccCCC------CCcCchhhccCCCCCEEECcCCcc--hhhhHHHh
Confidence            55555555555322    2455567777778888887777      667777777788888888887774  33377777


Q ss_pred             cCce-ecEEeecCCCCCCCCchhhcCCCCCcEEeccCCCccc
Q 043351          175 IMPC-LSSFQIESCPKLKMLPYYLLQTTKLQELKIYLCHILE  215 (218)
Q Consensus       175 ~~L~-L~~L~l~~~~~l~~lP~~i~~L~~L~~L~l~~~~~l~  215 (218)
                      +.+. |+.|++++|+.++.+|..++++++|++|++++|..+.
T Consensus       250 ~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~  291 (328)
T 4fcg_A          250 GGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLS  291 (328)
T ss_dssp             TCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCC
T ss_pred             cCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchh
Confidence            7787 8888888877777788778888888888888877554
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.31
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.27
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.26
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.25
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.21
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.19
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.17
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.11
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.1
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.06
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.04
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.0
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.92
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.77
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.72
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.59
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.07
d2ca6a1 344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.82
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.59
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.17
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.42
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.49  E-value=2.5e-14  Score=99.70  Aligned_cols=100  Identities=18%  Similarity=0.185  Sum_probs=77.5

Q ss_pred             eEEEeccccccchhhhHHHHHhcCCCCcEEEecCCCCcccccccccCcccCCCCCCCeEeccCCCccccccccccccCce
Q 043351           99 HSILTLSFISVNSRNLLQELFGELTCLRALCISNNSFESNNLIKEIPPNVGKLVHLRYLNLSDKFIETTGVFVNTIIMPC  178 (218)
Q Consensus        99 r~L~l~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~~~~~~~l~~lp~~i~~L~~L~~L~l~~~~l~~~~~lp~~i~~L~  178 (218)
                      |.|+++++..    ..++. +..+++|++|++++|.      ++.+|+.++.+++|++|++++|.++.   +|. ++.++
T Consensus         1 R~L~Ls~n~l----~~l~~-l~~l~~L~~L~ls~N~------l~~lp~~~~~l~~L~~L~l~~N~i~~---l~~-~~~l~   65 (124)
T d1dcea3           1 RVLHLAHKDL----TVLCH-LEQLLLVTHLDLSHNR------LRALPPALAALRCLEVLQASDNALEN---VDG-VANLP   65 (124)
T ss_dssp             SEEECTTSCC----SSCCC-GGGGTTCCEEECCSSC------CCCCCGGGGGCTTCCEEECCSSCCCC---CGG-GTTCS
T ss_pred             CEEEcCCCCC----CCCcc-cccCCCCCEEECCCCc------cCcchhhhhhhhcccccccccccccc---cCc-ccccc
Confidence            4566666533    23333 6788888888888888      88888888888888999988888887   764 88888


Q ss_pred             -ecEEeecCCCCCCCCc--hhhcCCCCCcEEeccCCCcc
Q 043351          179 -LSSFQIESCPKLKMLP--YYLLQTTKLQELKIYLCHIL  214 (218)
Q Consensus       179 -L~~L~l~~~~~l~~lP--~~i~~L~~L~~L~l~~~~~l  214 (218)
                       |+.|++++|+ +..+|  ..++.+++|++|++++|++-
T Consensus        66 ~L~~L~l~~N~-i~~~~~~~~l~~~~~L~~L~l~~N~i~  103 (124)
T d1dcea3          66 RLQELLLCNNR-LQQSAAIQPLVSCPRLVLLNLQGNSLC  103 (124)
T ss_dssp             SCCEEECCSSC-CCSSSTTGGGGGCTTCCEEECTTSGGG
T ss_pred             ccCeEECCCCc-cCCCCCchhhcCCCCCCEEECCCCcCC
Confidence             8888888887 77666  35778888888988888753
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure