Citrus Sinensis ID: 043355

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MSGKASSSSQPSIGLSGSGALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN
cccccccccccccccccccccEEEEEEcccEEEEccccccEEEEccccEEEEEccccEEEEEEccccccccccccccccccEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEccccccEEEEEEccccccEEEEEEc
cccccccccccccccccccccEEEEEEccccEEcccccccEEEccccEEEEEEccccEEEEEEEcccccccccccccccccEEEEEEccccEEEEEEEcccEEEEEEcccccEEEEcccccccEEEEEEEcccccccEEEEEc
msgkassssqpsiglsgsgalshvyiqypplrcsipesrglhyddgtKLLISSTsnqifswktvpfnplatstsdsipegpilsirfSLDTKLIAIQRSSSEIQFWIRETSEAFSHrcrsdsenilgffwtdcplcdfvvvkn
msgkassssqpsiglsGSGALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLAtstsdsipegpILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN
MSGKAssssqpsiglsgsgALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN
*******************ALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVV**
**********************HVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLA******I*EGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN
***************SGSGALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN
******************GALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGKASSSSQPSIGLSGSGALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
Q96DM3 657 Uncharacterized protein C yes no 0.433 0.094 0.352 1e-05
Q8VC42 657 Uncharacterized protein C yes no 0.433 0.094 0.338 3e-05
>sp|Q96DM3|MIC1_HUMAN Uncharacterized protein C18orf8 OS=Homo sapiens GN=C18orf8 PE=2 SV=2 Back     alignment and function desciption
 Score = 48.5 bits (114), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 67  NPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQF--WIRETSE-AFSHRCRSDSE 123
           NP++    D   +G +  I+FSL+ K++A+QR+S  + F  +I + S+  ++  C++ + 
Sbjct: 55  NPISFRMDD---KGEVKCIKFSLENKILAVQRTSKTVDFCNFIPDNSQLEYTQECKTKNA 111

Query: 124 NILGFFWT 131
           NILGF WT
Sbjct: 112 NILGFCWT 119

Homo sapiens (taxid: 9606)
>sp|Q8VC42|MIC1_MOUSE Uncharacterized protein C18orf8 homolog OS=Mus musculus GN=Mic1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
255587909 692 conserved hypothetical protein [Ricinus 0.986 0.203 0.732 2e-57
225441513 696 PREDICTED: uncharacterized protein C18or 0.986 0.202 0.725 3e-54
449518531 730 PREDICTED: uncharacterized protein LOC10 0.986 0.193 0.704 2e-52
449437553 730 PREDICTED: uncharacterized protein LOC10 0.986 0.193 0.704 3e-52
356572134 743 PREDICTED: uncharacterized protein LOC10 0.986 0.189 0.676 3e-51
357510041 730 hypothetical protein MTR_7g093740 [Medic 0.986 0.193 0.654 2e-50
356503501 697 PREDICTED: uncharacterized protein C18or 0.986 0.202 0.647 2e-49
224139906 710 predicted protein [Populus trichocarpa] 0.839 0.169 0.716 8e-48
224088172 517 predicted protein [Populus trichocarpa] 0.986 0.272 0.647 9e-48
297829758 734 hypothetical protein ARALYDRAFT_897410 [ 0.881 0.171 0.642 5e-44
>gi|255587909|ref|XP_002534438.1| conserved hypothetical protein [Ricinus communis] gi|223525295|gb|EEF27945.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 1/142 (0%)

Query: 1   MSGKASSSSQPSIGLSGSGALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFS 60
           MSGKASSS + ++G SGSG LSHV++QYPPLRCSI  SRG +YDDG+KLL++ TSNQ+FS
Sbjct: 1   MSGKASSS-RLNVGFSGSGGLSHVFVQYPPLRCSIAGSRGFYYDDGSKLLLAPTSNQVFS 59

Query: 61  WKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRS 120
           WKT+PF+P A   SDSI EGPILSIR+SLD K IAIQ SS EIQFW RET E FSH+CRS
Sbjct: 60  WKTIPFDPYAAPVSDSISEGPILSIRYSLDAKFIAIQHSSQEIQFWHRETGETFSHKCRS 119

Query: 121 DSENILGFFWTDCPLCDFVVVK 142
           + E+ILGFFWTDCPLCDFV+VK
Sbjct: 120 ELESILGFFWTDCPLCDFVLVK 141

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225441513|ref|XP_002276025.1| PREDICTED: uncharacterized protein C18orf8 [Vitis vinifera] gi|297739807|emb|CBI29989.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449518531|ref|XP_004166295.1| PREDICTED: uncharacterized protein LOC101227142 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437553|ref|XP_004136556.1| PREDICTED: uncharacterized protein LOC101218836 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356572134|ref|XP_003554225.1| PREDICTED: uncharacterized protein LOC100500389 [Glycine max] Back     alignment and taxonomy information
>gi|357510041|ref|XP_003625309.1| hypothetical protein MTR_7g093740 [Medicago truncatula] gi|355500324|gb|AES81527.1| hypothetical protein MTR_7g093740 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356503501|ref|XP_003520546.1| PREDICTED: uncharacterized protein C18orf8-like [Glycine max] Back     alignment and taxonomy information
>gi|224139906|ref|XP_002323334.1| predicted protein [Populus trichocarpa] gi|222867964|gb|EEF05095.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224088172|ref|XP_002308354.1| predicted protein [Populus trichocarpa] gi|222854330|gb|EEE91877.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297829758|ref|XP_002882761.1| hypothetical protein ARALYDRAFT_897410 [Arabidopsis lyrata subsp. lyrata] gi|297328601|gb|EFH59020.1| hypothetical protein ARALYDRAFT_897410 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
TAIR|locus:2088624 682 AT3G12010 "AT3G12010" [Arabido 0.860 0.180 0.634 1.7e-39
ZFIN|ZDB-GENE-041212-46 657 zgc:101800 "zgc:101800" [Danio 0.377 0.082 0.368 4.1e-05
TAIR|locus:2088624 AT3G12010 "AT3G12010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 426 (155.0 bits), Expect = 1.7e-39, P = 1.7e-39
 Identities = 78/123 (63%), Positives = 96/123 (78%)

Query:    20 ALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPE 79
             ALSHVYI +P LRC+IPES GL YDD  +LLI +TS+Q+FSW+T PFNP    + DSI E
Sbjct:    13 ALSHVYIHHPSLRCNIPESNGLFYDDANRLLICTTSSQVFSWETSPFNPDVPPSVDSISE 72

Query:    80 GPILSIRFSLDTKLIAIQRSSSEIQFWIRETSEAFSHRCRSDSENILGFFWTDCPLCDFV 139
             GPILSIRFSLD K IA+QRS  EIQ + RET +  +H+C++ SE+ILGFFW+D PLCD  
Sbjct:    73 GPILSIRFSLDKKAIAVQRSDCEIQLFNRETKQILNHKCKAGSESILGFFWSDSPLCDLA 132

Query:   140 VVK 142
             +VK
Sbjct:   133 IVK 135
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
ZFIN|ZDB-GENE-041212-46 zgc:101800 "zgc:101800" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
KOG2377 657 consensus Uncharacterized conserved protein [Funct 100.0
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 97.05
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.41
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 95.07
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 94.92
KOG0265 338 consensus U5 snRNP-specific protein-like factor an 94.27
KOG0318603 consensus WD40 repeat stress protein/actin interac 94.19
KOG0315311 consensus G-protein beta subunit-like protein (con 93.53
KOG0305 484 consensus Anaphase promoting complex, Cdc20, Cdh1, 93.17
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 92.9
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 92.37
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 91.99
PTZ00421 493 coronin; Provisional 91.67
COG4946 668 Uncharacterized protein related to the periplasmic 90.57
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 90.17
KOG1274 933 consensus WD40 repeat protein [General function pr 89.83
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 89.7
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 89.4
KOG2048 691 consensus WD40 repeat protein [General function pr 88.98
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 88.53
PTZ00420 568 coronin; Provisional 88.29
KOG0318 603 consensus WD40 repeat stress protein/actin interac 88.27
PTZ00421 493 coronin; Provisional 88.19
KOG0283 712 consensus WD40 repeat-containing protein [Function 88.17
PRK05137 435 tolB translocation protein TolB; Provisional 88.02
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 87.9
KOG0278334 consensus Serine/threonine kinase receptor-associa 87.62
KOG1407313 consensus WD40 repeat protein [Function unknown] 87.15
PRK03629 429 tolB translocation protein TolB; Provisional 86.72
KOG2106 626 consensus Uncharacterized conserved protein, conta 86.71
PRK11028330 6-phosphogluconolactonase; Provisional 86.64
KOG0973 942 consensus Histone transcription regulator HIRA, WD 86.51
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 86.39
PTZ00420 568 coronin; Provisional 86.18
PRK11028 330 6-phosphogluconolactonase; Provisional 85.55
PRK01742 429 tolB translocation protein TolB; Provisional 83.8
PRK01029428 tolB translocation protein TolB; Provisional 83.39
PRK02889 427 tolB translocation protein TolB; Provisional 82.73
KOG0645 312 consensus WD40 repeat protein [General function pr 82.64
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 81.51
KOG0288459 consensus WD40 repeat protein TipD [General functi 80.27
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 80.12
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-45  Score=327.26  Aligned_cols=124  Identities=35%  Similarity=0.606  Sum_probs=117.0

Q ss_pred             CCCcceEEEeeCCCceecCCCCcceeEeCCCcEEEEEcCCCeEEEEEccCCCCCCCceecC-CCCceeEEEecCCCcEEE
Q 043355           17 GSGALSHVYIQYPPLRCSIPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSI-PEGPILSIRFSLDTKLIA   95 (143)
Q Consensus        17 ~~~~~~h~~i~~~plR~~~~~~~~vFyDDank~v~avrsggv~gv~v~~~~p~~~~~~fri-d~G~I~sIKFS~D~KiLA   95 (143)
                      |+|||+|+||+||-|||++|+++||||||+|||+|||||||+|||+||+++ ++-|++|+| |+|+|+|||||||+|+||
T Consensus         4 gsGalyhelihhPslfcnipesngvFfDDaNkqlfavrSggatgvvvkgpn-dDVpiSfdm~d~G~I~SIkFSlDnkilA   82 (657)
T KOG2377|consen    4 GSGALYHELIHHPSLFCNIPESNGVFFDDANKQLFAVRSGGATGVVVKGPN-DDVPISFDMDDKGEIKSIKFSLDNKILA   82 (657)
T ss_pred             CCcceEEEEecCchhhccCCcccceeeccCcceEEEEecCCeeEEEEeCCC-CCCCceeeecCCCceeEEEeccCcceEE
Confidence            568999999999999999999999999999999999999999999997765 446788887 999999999999999999


Q ss_pred             EecCCCeEEEEEc---CCCceEEEEecCCCCcEEEEEeccCCCceEEEEeC
Q 043355           96 IQRSSSEIQFWIR---ETSEAFSHRCRSDSENILGFFWTDCPLCDFVVVKN  143 (143)
Q Consensus        96 IQRs~~sVEFvn~---~~~~~~~q~cK~k~~~IlGF~Wt~~~~cdivlVTn  143 (143)
                      |||++++|||+||   ++-.++.|+||.|++.|+||||+++.  |++||||
T Consensus        83 VQR~~~~v~f~nf~~d~~~l~~~~~ck~k~~~IlGF~W~~s~--e~A~i~~  131 (657)
T KOG2377|consen   83 VQRTSKTVDFCNFIPDNSQLEYTQECKTKNANILGFCWTSST--EIAFITD  131 (657)
T ss_pred             EEecCceEEEEecCCCchhhHHHHHhccCcceeEEEEEecCe--eEEEEec
Confidence            9999999999999   56699999999999999999999995  9999997

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 97.51
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 97.23
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.17
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 97.13
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.09
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.99
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 96.99
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.95
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.92
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.76
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 96.76
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.71
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 96.7
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.69
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.69
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.63
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.62
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.6
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 96.58
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.55
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 96.54
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 96.4
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.38
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 96.38
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.35
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.33
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.31
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.3
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 96.24
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.22
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.2
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 96.16
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.15
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.11
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.09
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.09
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.05
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 96.04
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.01
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.99
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.97
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 95.94
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.93
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 95.9
2ymu_A577 WD-40 repeat protein; unknown function, two domain 95.89
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.83
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 95.78
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.76
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.66
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.64
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.51
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.47
3jrp_A 379 Fusion protein of protein transport protein SEC13 95.43
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 95.42
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.4
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.39
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 95.38
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.33
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.3
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.28
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 95.25
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 95.25
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.23
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 95.21
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.18
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 95.13
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.09
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 94.98
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.92
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.88
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 94.81
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 94.81
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.69
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.67
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 94.65
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 94.64
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.62
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.58
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 94.5
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.47
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.41
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.38
2pm7_B 297 Protein transport protein SEC13, protein transport 94.38
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.33
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 94.28
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.21
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.13
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.12
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 94.08
3jro_A 753 Fusion protein of protein transport protein SEC13 93.92
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.86
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.84
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 93.81
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.8
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.76
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.72
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 93.71
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.6
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.59
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 93.59
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 93.56
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 93.49
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 93.42
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.25
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.23
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 93.16
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 93.1
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 92.97
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 92.88
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 92.82
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.78
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 92.78
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.77
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 92.5
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 92.32
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.06
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 91.97
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 91.89
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 91.79
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 91.77
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 91.75
3jro_A 753 Fusion protein of protein transport protein SEC13 91.7
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.56
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.38
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 91.22
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 91.19
2pm7_B 297 Protein transport protein SEC13, protein transport 91.1
1k32_A 1045 Tricorn protease; protein degradation, substrate g 91.05
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 90.86
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 90.82
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 90.69
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 90.49
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 90.33
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 89.57
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 89.09
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 88.74
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 88.66
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 88.18
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 88.15
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 88.04
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 87.88
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 87.79
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 87.66
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 87.26
1k32_A 1045 Tricorn protease; protein degradation, substrate g 86.95
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 86.94
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 86.76
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 86.73
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 86.51
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 85.64
1q7f_A 286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 85.56
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 84.96
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 84.62
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 84.62
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 84.59
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 84.25
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 84.16
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 83.6
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 82.24
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 82.01
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 81.9
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 81.77
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 81.73
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
Probab=97.51  E-value=0.0077  Score=44.70  Aligned_cols=105  Identities=8%  Similarity=0.050  Sum_probs=73.5

Q ss_pred             CCCCcceeEeCCCcEEEEEcCCCeEEEEEccCCCCCCCceecC--CCCceeEEEecCCCcEEEEecCCCeEEEEEcCCCc
Q 043355           35 IPESRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSI--PEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETSE  112 (143)
Q Consensus        35 ~~~~~~vFyDDank~v~avrsggv~gv~v~~~~p~~~~~~fri--d~G~I~sIKFS~D~KiLAIQRs~~sVEFvn~~~~~  112 (143)
                      ...++.+-|....+.|++...|.+.=|.+...........+..  .+++|.++.||||+++|++--.+..|.+++.+++.
T Consensus        51 ~~~v~~~~~~~~~~~l~~~~dg~i~iw~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~~~d~~~~~  130 (337)
T 1gxr_A           51 GEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPT  130 (337)
T ss_dssp             SSCCCEEEECSSSSEEEEECBSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECCCC-
T ss_pred             CCceEEEEEecCCcEEEEcCCCeEEEEECCCCCceeeeecccccCCCCcEEEEEEcCCCCEEEEEcCCCcEEEEECCCCC
Confidence            3458888999888888887645555566632222222333332  55699999999999999999999999999998774


Q ss_pred             -eEEEEecCCCCcEEEEEeccCCCceEEEE
Q 043355          113 -AFSHRCRSDSENILGFFWTDCPLCDFVVV  141 (143)
Q Consensus       113 -~~~q~cK~k~~~IlGF~Wt~~~~cdivlV  141 (143)
                       ......+.....|.+..|....  +.+++
T Consensus       131 ~~~~~~~~~~~~~i~~~~~~~~~--~~l~~  158 (337)
T 1gxr_A          131 PRIKAELTSSAPACYALAISPDS--KVCFS  158 (337)
T ss_dssp             -EEEEEEECSSSCEEEEEECTTS--SEEEE
T ss_pred             cceeeecccCCCceEEEEECCCC--CEEEE
Confidence             3444555566779999998765  55443
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.9
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.06
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.95
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.94
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.75
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.69
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.66
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.59
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.43
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.36
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 96.3
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.3
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.26
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 96.07
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.03
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 95.81
d1pgua1 325 Actin interacting protein 1 {Baker's yeast (Saccha 95.81
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.66
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 95.37
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 94.66
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.35
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 93.74
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 93.73
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.47
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 93.46
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 93.39
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 93.17
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 93.02
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 92.75
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 92.53
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 92.09
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 91.61
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 91.41
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 91.06
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 90.87
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 89.91
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 89.6
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 88.84
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 88.3
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 85.69
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 81.98
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 80.84
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 80.71
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=97.90  E-value=0.00029  Score=53.01  Aligned_cols=98  Identities=6%  Similarity=0.016  Sum_probs=67.8

Q ss_pred             CcceeEeCCCcEEEEEcCCCeEEEEEccCCCCCCCceecCCCCceeEEEecCCCcEEEEecCCCeEEEEEcCCC-ceEEE
Q 043355           38 SRGLHYDDGTKLLISSTSNQIFSWKTVPFNPLATSTSDSIPEGPILSIRFSLDTKLIAIQRSSSEIQFWIRETS-EAFSH  116 (143)
Q Consensus        38 ~~~vFyDDank~v~avrsggv~gv~v~~~~p~~~~~~frid~G~I~sIKFS~D~KiLAIQRs~~sVEFvn~~~~-~~~~q  116 (143)
                      ...+=||..++.+.....+.+.=|.+  ..+ .....+.--+++|.+++||||+++||+--.+.+|.+++..++ ..+..
T Consensus        20 ~~~~a~~~~g~~l~~~~~~~v~i~~~--~~~-~~~~~~~~H~~~v~~~~~sp~g~~latg~~dg~i~iwd~~~~~~~~~~   96 (311)
T d1nr0a1          20 AVVLGNTPAGDKIQYCNGTSVYTVPV--GSL-TDTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTHILKT   96 (311)
T ss_dssp             CCCCEECTTSSEEEEEETTEEEEEET--TCS-SCCEEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEESSSTTCCEEE
T ss_pred             eEEEEEcCCCCEEEEEeCCEEEEEEC--CCC-ceeEEEcCCCCCEEEEEEeCCCCeEeccccCceEeeeeeecccccccc
Confidence            33466776666655554454444444  222 122233334679999999999999999999999999999776 45566


Q ss_pred             EecCCCCcEEEEEeccCCCceEEE
Q 043355          117 RCRSDSENILGFFWTDCPLCDFVV  140 (143)
Q Consensus       117 ~cK~k~~~IlGF~Wt~~~~cdivl  140 (143)
                      ..+..+..|....|....  ..++
T Consensus        97 ~~~~~~~~v~~v~~s~d~--~~l~  118 (311)
T d1nr0a1          97 TIPVFSGPVKDISWDSES--KRIA  118 (311)
T ss_dssp             EEECSSSCEEEEEECTTS--CEEE
T ss_pred             ccccccCccccccccccc--cccc
Confidence            666667889999998766  5444
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure