Citrus Sinensis ID: 043608


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
cHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcHHHccccccccHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHcc
cHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHcc
FSNDYVSSLCKQNLYNEALVAYdfsqnntnirirpstyAGLISACSSLRSlqlgrkvhdhillskcqpdvVLQNHILNmygkcgsledarmgfdkmpqrnvVSWTAMIAGCSQNYQENDAIKLYIQMLQsgvmpgqftFGSIIKACSglgsvclgrQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFnemlhhgayqpnefifGSVFSACSNFARILfneidspdlaSWNALIAGVASHSNANEAMSLFSEMrdrellpdglTVHSLLCACIGRLTLYQGMQVHSYIIKmgfdsnvpVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLasqikpdhitfNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLfnfmenpdvvsWSSLILGYAQFGCGDEALKLFTRMRslgvspnlVTLVGVLTACSHVGLVEEGLHLYRIMENeygiiptrehCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGiarkdvtswGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
*****VSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASH********LFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLL**
FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
********LCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query579 2.2.26 [Sep-21-2011]
Q9LFI1 768 Pentatricopeptide repeat- yes no 0.996 0.751 0.547 0.0
Q9FWA6 903 Pentatricopeptide repeat- no no 0.943 0.604 0.313 8e-88
Q9SS60 882 Pentatricopeptide repeat- no no 0.982 0.645 0.312 1e-87
Q9SVA5 834 Pentatricopeptide repeat- no no 0.975 0.677 0.306 4e-86
Q5G1T1 850 Pentatricopeptide repeat- no no 0.941 0.641 0.321 1e-83
Q9SVP7 1064 Pentatricopeptide repeat- no no 0.937 0.510 0.309 1e-83
Q9LUS3654 Pentatricopeptide repeat- no no 0.932 0.825 0.324 3e-83
Q9SN39 871 Pentatricopeptide repeat- no no 0.934 0.621 0.328 3e-82
Q7Y211 890 Pentatricopeptide repeat- no no 0.982 0.639 0.296 1e-81
Q9CAA8 743 Putative pentatricopeptid no no 0.877 0.683 0.333 5e-81
>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein At3g53360, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E86 PE=2 SV=1 Back     alignment and function desciption
 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/617 (54%), Positives = 439/617 (71%), Gaps = 40/617 (6%)

Query: 3   NDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHIL 62
           ND+++SLCK N Y EAL A+DF+Q N++ +IR  TY  LI ACSS RSL  GRK+HDHIL
Sbjct: 35  NDHINSLCKSNFYREALEAFDFAQKNSSFKIRLRTYISLICACSSSRSLAQGRKIHDHIL 94

Query: 63  LSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIK 122
            S C+ D +L NHIL+MYGKCGSL DAR  FD MP+RN+VS+T++I G SQN Q  +AI+
Sbjct: 95  NSNCKYDTILNNHILSMYGKCGSLRDAREVFDFMPERNLVSYTSVITGYSQNGQGAEAIR 154

Query: 123 LYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMYT 182
           LY++MLQ  ++P QF FGSIIKAC+    V LG+QLHA VIK E  SHLIAQNALIAMY 
Sbjct: 155 LYLKMLQEDLVPDQFAFGSIIKACASSSDVGLGKQLHAQVIKLESSSHLIAQNALIAMYV 214

Query: 183 KFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFG 242
           +F+++ DA  VF GI  KD+ SW S+IA FS+LG+E EAL H  EML  G + PNE+IFG
Sbjct: 215 RFNQMSDASRVFYGIPMKDLISWSSIIAGFSQLGFEFEALSHLKEMLSFGVFHPNEYIFG 274

Query: 243 SVFSACS----------------------------------------NFARILFNEIDSP 262
           S   ACS                                        N AR +F++I+ P
Sbjct: 275 SSLKACSSLLRPDYGSQIHGLCIKSELAGNAIAGCSLCDMYARCGFLNSARRVFDQIERP 334

Query: 263 DLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVH 322
           D ASWN +IAG+A++  A+EA+S+FS+MR    +PD +++ SLLCA    + L QGMQ+H
Sbjct: 335 DTASWNVIIAGLANNGYADEAVSVFSQMRSSGFIPDAISLRSLLCAQTKPMALSQGMQIH 394

Query: 323 SYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQA 382
           SYIIK GF +++ VCN++LTMY  CS L     +F++   NADSVSWN+I+ ACLQH Q 
Sbjct: 395 SYIIKWGFLADLTVCNSLLTMYTFCSDLYCCFNLFEDFRNNADSVSWNTILTACLQHEQP 454

Query: 383 EELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGL 442
            E+ RLF  ML S+ +PDHIT  +++  C +++SL++ +Q+HCY  KTGLA + F+ NGL
Sbjct: 455 VEMLRLFKLMLVSECEPDHITMGNLLRGCVEISSLKLGSQVHCYSLKTGLAPEQFIKNGL 514

Query: 443 MDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNL 502
           +D+Y KCGSLG AR++F+ M+N DVVSWS+LI+GYAQ G G+EAL LF  M+S G+ PN 
Sbjct: 515 IDMYAKCGSLGQARRIFDSMDNRDVVSWSTLIVGYAQSGFGEEALILFKEMKSAGIEPNH 574

Query: 503 VTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFIN 562
           VT VGVLTACSHVGLVEEGL LY  M+ E+GI PT+EHCSCVVDLLARAG ++EAE FI+
Sbjct: 575 VTFVGVLTACSHVGLVEEGLKLYATMQTEHGISPTKEHCSCVVDLLARAGRLNEAERFID 634

Query: 563 QMACDADIVVWKSLLAS 579
           +M  + D+VVWK+LL++
Sbjct: 635 EMKLEPDVVVWKTLLSA 651





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2 Back     alignment and function description
>sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protein At3g03580 OS=Arabidopsis thaliana GN=PCMP-H23 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function description
>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana GN=EMB2261 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|Q9LUS3|PP237_ARATH Pentatricopeptide repeat-containing protein At3g16610 OS=Arabidopsis thaliana GN=PCMP-E91 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H81 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
147784524 763 hypothetical protein VITISV_032420 [Viti 0.998 0.757 0.614 0.0
359481513 755 PREDICTED: pentatricopeptide repeat-cont 0.998 0.765 0.614 0.0
449440387 792 PREDICTED: pentatricopeptide repeat-cont 0.996 0.728 0.564 0.0
449518693 792 PREDICTED: pentatricopeptide repeat-cont 0.996 0.728 0.564 0.0
356503704 855 PREDICTED: pentatricopeptide repeat-cont 0.998 0.676 0.564 0.0
356570738 777 PREDICTED: pentatricopeptide repeat-cont 0.996 0.742 0.559 0.0
15231798 768 pentatricopeptide repeat-containing prot 0.996 0.751 0.547 0.0
297816638 769 pentatricopeptide repeat-containing prot 0.996 0.750 0.544 0.0
357510605 887 Pentatricopeptide repeat-containing prot 0.998 0.651 0.533 0.0
115468242 766 Os06g0506100 [Oryza sativa Japonica Grou 0.934 0.706 0.491 1e-161
>gi|147784524|emb|CAN61725.1| hypothetical protein VITISV_032420 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/618 (61%), Positives = 462/618 (74%), Gaps = 40/618 (6%)

Query: 2   SNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHI 61
           SN+Y+++LCKQ L+NEA+ A++F Q  T   +  STYA LISACS LRSL+ GRK+HDH+
Sbjct: 30  SNEYITTLCKQKLFNEAIKAFEFLQKKTGFCLTLSTYAYLISACSYLRSLEHGRKIHDHM 89

Query: 62  LLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAI 121
           L SK  PD+ LQNHILNMYGKCGSL+DA+  FD MP+RNVVSWT++IAG SQN Q  +A+
Sbjct: 90  LKSKSHPDLTLQNHILNMYGKCGSLKDAQKVFDAMPERNVVSWTSVIAGYSQNGQGGNAL 149

Query: 122 KLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAMY 181
           + Y QMLQSGVMP QFTFGSIIKACS LG + LGRQLHAHV+KSE G+H+IAQNALI+MY
Sbjct: 150 EFYFQMLQSGVMPDQFTFGSIIKACSSLGDIGLGRQLHAHVLKSEFGAHIIAQNALISMY 209

Query: 182 TKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIF 241
           TK + I+DA +VFS +A +D+ SWGSMIA FS+LGYELEALC+F EMLH G Y PNEFIF
Sbjct: 210 TKSNVIIDALDVFSRMATRDLISWGSMIAGFSQLGYELEALCYFKEMLHQGVYLPNEFIF 269

Query: 242 GSVFSACSNF----------------------------------------ARILFNEIDS 261
           GSVFSACS+                                         AR++F +I  
Sbjct: 270 GSVFSACSSLLQPEYGRQLHGMSIKFGLGRDVFAGCSLCDMYAKCGLLSCARVVFYQIGR 329

Query: 262 PDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQV 321
           PDL +WNA+IAG A   +A EA++ FS+MR + L+PD +TV SLLCAC     LYQGMQV
Sbjct: 330 PDLVAWNAIIAGFAYGGDAKEAIAFFSQMRHQGLIPDEITVRSLLCACTSPSELYQGMQV 389

Query: 322 HSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQ 381
           H YI KMG D +VPVCN +LTMYAKCS L +A+  F+E+  NAD VSWN+I+ AC+ H+Q
Sbjct: 390 HGYINKMGLDLDVPVCNTLLTMYAKCSELRDAIFFFEEMRCNADLVSWNAILTACMHHDQ 449

Query: 382 AEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNG 441
           AEE+F L   M  SQ +PD+IT  +V+GA A+  S+E+  Q+HCY  KTGL  D+ V NG
Sbjct: 450 AEEVFGLLKLMCISQHRPDYITLTNVLGASAETVSIEIGNQVHCYALKTGLNCDISVTNG 509

Query: 442 LMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPN 501
           L+D+Y KCGSL +ARK+F+ + NPDVVSWSSLILGYAQFG G+EALKLF  MR L V PN
Sbjct: 510 LIDLYAKCGSLKTARKIFDSVINPDVVSWSSLILGYAQFGYGEEALKLFKTMRRLDVKPN 569

Query: 502 LVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFI 561
            VT VGVLTACSHVGLVEEG  LY  ME E+GI+PTREHCSC+VDLLARAGC++EAE FI
Sbjct: 570 HVTFVGVLTACSHVGLVEEGWQLYGTMEKEFGIVPTREHCSCMVDLLARAGCLNEAEAFI 629

Query: 562 NQMACDADIVVWKSLLAS 579
           +QMA D DIVVWK+LLA+
Sbjct: 630 HQMAFDPDIVVWKTLLAA 647




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359481513|ref|XP_003632631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440387|ref|XP_004137966.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449518693|ref|XP_004166371.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356503704|ref|XP_003520645.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356570738|ref|XP_003553542.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|15231798|ref|NP_190904.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174119|sp|Q9LFI1.1|PP280_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g53360, mitochondrial; Flags: Precursor gi|6729487|emb|CAB67643.1| putative protein [Arabidopsis thaliana] gi|332645554|gb|AEE79075.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297816638|ref|XP_002876202.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322040|gb|EFH52461.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357510605|ref|XP_003625591.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500606|gb|AES81809.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|115468242|ref|NP_001057720.1| Os06g0506100 [Oryza sativa Japonica Group] gi|52075894|dbj|BAD45840.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] gi|113595760|dbj|BAF19634.1| Os06g0506100 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
TAIR|locus:2083961 768 AT3G53360 "AT3G53360" [Arabido 0.701 0.528 0.486 1.8e-103
TAIR|locus:2089333654 AT3G16610 "AT3G16610" [Arabido 0.575 0.509 0.379 1.7e-84
TAIR|locus:505006130 970 AT1G18485 [Arabidopsis thalian 0.590 0.352 0.346 5.5e-83
TAIR|locus:2103483 890 OTP84 "ORGANELLE TRANSCRIPT PR 0.656 0.426 0.312 8.5e-82
TAIR|locus:2196583 866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.556 0.371 0.340 1.7e-81
TAIR|locus:2088827700 AT3G26540 [Arabidopsis thalian 0.561 0.464 0.306 2.6e-77
TAIR|locus:2178188 995 MEF7 "AT5G09950" [Arabidopsis 0.566 0.329 0.344 4.5e-77
TAIR|locus:2132452686 AT4G08210 "AT4G08210" [Arabido 0.576 0.486 0.309 1.2e-75
TAIR|locus:2148101 850 AT5G16860 "AT5G16860" [Arabido 0.887 0.604 0.320 2.5e-72
TAIR|locus:2164880 710 EMB2744 "EMBRYO DEFECTIVE 2744 0.573 0.467 0.326 1.4e-70
TAIR|locus:2083961 AT3G53360 "AT3G53360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1025 (365.9 bits), Expect = 1.8e-103, P = 1.8e-103
 Identities = 205/421 (48%), Positives = 295/421 (70%)

Query:   171 LIAQNALIAMYTK----FDRILDARNVFS-GIARKDVTSWGSMIAAFSKL-----GYELE 220
             LI+ +++IA +++    F+ +   + + S G+   +   +GS + A S L     G ++ 
Sbjct:   234 LISWSSIIAGFSQLGFEFEALSHLKEMLSFGVFHPNEYIFGSSLKACSSLLRPDYGSQIH 293

Query:   221 ALCHFNEMLHHGAYQPNEFIFGSVFSACS--NFARILFNEIDSPDLASWNALIAGVASHS 278
              LC  +E+  +     +      +++ C   N AR +F++I+ PD ASWN +IAG+A++ 
Sbjct:   294 GLCIKSELAGNAIAGCS---LCDMYARCGFLNSARRVFDQIERPDTASWNVIIAGLANNG 350

Query:   279 NANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCN 338
              A+EA+S+FS+MR    +PD +++ SLLCA    + L QGMQ+HSYIIK GF +++ VCN
Sbjct:   351 YADEAVSVFSQMRSSGFIPDAISLRSLLCAQTKPMALSQGMQIHSYIIKWGFLADLTVCN 410

Query:   339 AILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIK 398
             ++LTMY  CS L     +F++   NADSVSWN+I+ ACLQH Q  E+ RLF  ML S+ +
Sbjct:   411 SLLTMYTFCSDLYCCFNLFEDFRNNADSVSWNTILTACLQHEQPVEMLRLFKLMLVSECE 470

Query:   399 PDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKL 458
             PDHIT  +++  C +++SL++ +Q+HCY  KTGLA + F+ NGL+D+Y KCGSLG AR++
Sbjct:   471 PDHITMGNLLRGCVEISSLKLGSQVHCYSLKTGLAPEQFIKNGLIDMYAKCGSLGQARRI 530

Query:   459 FNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLV 518
             F+ M+N DVVSWS+LI+GYAQ G G+EAL LF  M+S G+ PN VT VGVLTACSHVGLV
Sbjct:   531 FDSMDNRDVVSWSTLIVGYAQSGFGEEALILFKEMKSAGIEPNHVTFVGVLTACSHVGLV 590

Query:   519 EEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLA 578
             EEGL LY  M+ E+GI PT+EHCSCVVDLLARAG ++EAE FI++M  + D+VVWK+LL+
Sbjct:   591 EEGLKLYATMQTEHGISPTKEHCSCVVDLLARAGRLNEAERFIDEMKLEPDVVVWKTLLS 650

Query:   579 S 579
             +
Sbjct:   651 A 651


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2089333 AT3G16610 "AT3G16610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088827 AT3G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132452 AT4G08210 "AT4G08210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148101 AT5G16860 "AT5G16860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164880 EMB2744 "EMBRYO DEFECTIVE 2744" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LFI1PP280_ARATHNo assigned EC number0.54780.99650.7513yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023152001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (641 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-118
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-60
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-56
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-51
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-41
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-35
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-31
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-18
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-16
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-13
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
pfam1285434 pfam12854, PPR_1, PPR repeat 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  369 bits (948), Expect = e-118
 Identities = 204/620 (32%), Positives = 320/620 (51%), Gaps = 51/620 (8%)

Query: 1   FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDH 60
            SN  + +LC      +AL   +  Q    + +    Y  L   C   R+++ G +V   
Sbjct: 53  DSNSQLRALCSHGQLEQALKLLESMQE-LRVPVDEDAYVALFRLCEWKRAVEEGSRVCSR 111

Query: 61  ILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDA 120
            L S     V L N +L+M+ + G L  A   F KMP+R++ SW  ++ G ++    ++A
Sbjct: 112 ALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEA 171

Query: 121 IKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNALIAM 180
           + LY +ML +GV P  +TF  +++ C G+  +  GR++HAHV++      +   NALI M
Sbjct: 172 LCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITM 231

Query: 181 YTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFI 240
           Y K   ++ AR VF  + R+D  SW +MI+ + + G  LE L  F  M    +  P+   
Sbjct: 232 YVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMREL-SVDPDLMT 290

Query: 241 FGSVFSACSNF----------------------------------------ARILFNEID 260
             SV SAC                                           A  +F+ ++
Sbjct: 291 ITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRME 350

Query: 261 SPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLL--CACIGRLTLYQG 318
           + D  SW A+I+G   +   ++A+  ++ M    + PD +T+ S+L  CAC+G L +  G
Sbjct: 351 TKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDV--G 408

Query: 319 MQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKELGKNADSVSWNSIIAA-CL 377
           +++H    + G  S V V NA++ MY+KC  +  AL VF  +    D +SW SIIA   L
Sbjct: 409 VKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNI-PEKDVISWTSIIAGLRL 467

Query: 378 QHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVF 437
            +   E L   F +ML + +KP+ +T    + ACA++ +L    ++H ++ +TG+ FD F
Sbjct: 468 NNRCFEALI-FFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGF 525

Query: 438 VMNGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLG 497
           + N L+D+Y++CG +  A   FN  E  DVVSW+ L+ GY   G G  A++LF RM   G
Sbjct: 526 LPNALLDLYVRCGRMNYAWNQFNSHEK-DVVSWNILLTGYVAHGKGSMAVELFNRMVESG 584

Query: 498 VSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEA 557
           V+P+ VT + +L ACS  G+V +GL  +  ME +Y I P  +H +CVVDLL RAG + EA
Sbjct: 585 VNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEA 644

Query: 558 EDFINQMACDADIVVWKSLL 577
            +FIN+M    D  VW +LL
Sbjct: 645 YNFINKMPITPDPAVWGALL 664


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 579
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.87
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.86
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
KOG2076 895 consensus RNA polymerase III transcription factor 99.74
KOG2003 840 consensus TPR repeat-containing protein [General f 99.74
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.7
KOG2003840 consensus TPR repeat-containing protein [General f 99.7
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.68
KOG1915677 consensus Cell cycle control protein (crooked neck 99.66
KOG2076 895 consensus RNA polymerase III transcription factor 99.66
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.64
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.6
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.58
KOG1915677 consensus Cell cycle control protein (crooked neck 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.56
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.55
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.53
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.49
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.48
KOG0547606 consensus Translocase of outer mitochondrial membr 99.48
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.44
KOG0547606 consensus Translocase of outer mitochondrial membr 99.43
KOG1126638 consensus DNA-binding cell division cycle control 99.43
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.43
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.42
KOG2376652 consensus Signal recognition particle, subunit Srp 99.39
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.38
PF1304150 PPR_2: PPR repeat family 99.35
PF1304150 PPR_2: PPR repeat family 99.34
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.33
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.32
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
PRK12370553 invasion protein regulator; Provisional 99.25
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.24
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.2
KOG1129478 consensus TPR repeat-containing protein [General f 99.2
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.18
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.15
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.14
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.14
PRK12370553 invasion protein regulator; Provisional 99.13
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.13
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.12
KOG1129478 consensus TPR repeat-containing protein [General f 99.11
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.1
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.06
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.05
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.0
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.98
PRK11189296 lipoprotein NlpI; Provisional 98.97
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.97
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.94
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.94
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.9
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.9
PRK11189296 lipoprotein NlpI; Provisional 98.89
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.89
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.82
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.82
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.78
PRK04841 903 transcriptional regulator MalT; Provisional 98.74
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.71
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.68
PF1285434 PPR_1: PPR repeat 98.65
PRK04841903 transcriptional regulator MalT; Provisional 98.65
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.64
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.62
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.58
PF1285434 PPR_1: PPR repeat 98.55
KOG1128777 consensus Uncharacterized conserved protein, conta 98.55
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.48
PRK15359144 type III secretion system chaperone protein SscB; 98.47
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.46
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.46
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.45
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.44
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.42
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.42
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.37
KOG1125579 consensus TPR repeat-containing protein [General f 98.34
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.34
KOG1125579 consensus TPR repeat-containing protein [General f 98.34
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.33
PRK10370198 formate-dependent nitrite reductase complex subuni 98.29
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.27
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.27
PRK10370198 formate-dependent nitrite reductase complex subuni 98.24
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.23
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.22
PLN02789320 farnesyltranstransferase 98.22
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.21
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.2
PLN02789320 farnesyltranstransferase 98.18
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.14
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.12
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.12
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.11
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.09
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.06
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.05
PRK15359144 type III secretion system chaperone protein SscB; 98.04
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.03
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.02
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 98.02
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.92
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.89
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.88
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.85
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.84
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.77
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.77
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.76
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.74
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.71
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.66
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.65
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.64
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.62
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.61
KOG20411189 consensus WD40 repeat protein [General function pr 97.6
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.6
KOG20411189 consensus WD40 repeat protein [General function pr 97.56
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.56
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.51
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.44
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.43
KOG0553304 consensus TPR repeat-containing protein [General f 97.42
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.41
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.38
COG4700251 Uncharacterized protein conserved in bacteria cont 97.38
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.37
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.36
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.34
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.33
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.33
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.29
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.27
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.25
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.24
PF12688120 TPR_5: Tetratrico peptide repeat 97.23
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.2
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.18
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.18
PRK10803263 tol-pal system protein YbgF; Provisional 97.12
COG4700251 Uncharacterized protein conserved in bacteria cont 97.11
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.1
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.06
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.06
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.04
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.04
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.03
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.02
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.01
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.97
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.96
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.96
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.95
PF12688120 TPR_5: Tetratrico peptide repeat 96.91
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.84
KOG0553304 consensus TPR repeat-containing protein [General f 96.8
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.76
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.71
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.52
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.51
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.51
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.5
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.47
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.47
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.44
PF1337173 TPR_9: Tetratricopeptide repeat 96.43
PRK10803263 tol-pal system protein YbgF; Provisional 96.41
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.39
PF1337173 TPR_9: Tetratricopeptide repeat 96.38
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 96.37
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.33
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.26
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.25
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.24
KOG3941406 consensus Intermediate in Toll signal transduction 96.18
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.17
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.08
COG3898531 Uncharacterized membrane-bound protein [Function u 96.05
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.94
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.91
PRK15331165 chaperone protein SicA; Provisional 95.81
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.66
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.59
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.46
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.28
KOG1258577 consensus mRNA processing protein [RNA processing 95.17
PRK15331165 chaperone protein SicA; Provisional 95.15
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.15
KOG3941406 consensus Intermediate in Toll signal transduction 95.09
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.07
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.07
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.91
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.81
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.8
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.77
KOG1585308 consensus Protein required for fusion of vesicles 94.71
smart00299140 CLH Clathrin heavy chain repeat homology. 94.69
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.69
smart00299140 CLH Clathrin heavy chain repeat homology. 94.61
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.59
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.56
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.48
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.29
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.25
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.16
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.13
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.99
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.8
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.68
PF1342844 TPR_14: Tetratricopeptide repeat 93.56
KOG1258577 consensus mRNA processing protein [RNA processing 93.55
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 93.47
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.44
PF13512142 TPR_18: Tetratricopeptide repeat 93.4
KOG1585308 consensus Protein required for fusion of vesicles 93.17
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.14
KOG4555175 consensus TPR repeat-containing protein [Function 93.11
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.1
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.02
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.49
PF1342844 TPR_14: Tetratricopeptide repeat 92.35
PF1343134 TPR_17: Tetratricopeptide repeat 92.15
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.13
KOG4555175 consensus TPR repeat-containing protein [Function 91.84
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.52
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.42
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.35
PRK11906458 transcriptional regulator; Provisional 91.32
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.11
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.92
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 90.79
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.61
COG3629280 DnrI DNA-binding transcriptional activator of the 90.5
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.41
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.4
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 90.39
PRK11906458 transcriptional regulator; Provisional 90.37
COG3629280 DnrI DNA-binding transcriptional activator of the 90.34
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 90.19
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.17
PRK11619644 lytic murein transglycosylase; Provisional 89.99
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.92
PRK09687280 putative lyase; Provisional 89.9
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.52
PF13512142 TPR_18: Tetratricopeptide repeat 89.36
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 88.85
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.84
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.43
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 88.31
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 88.14
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.13
COG0457291 NrfG FOG: TPR repeat [General function prediction 87.94
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 87.58
KOG1550552 consensus Extracellular protein SEL-1 and related 87.45
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 87.19
KOG2062 929 consensus 26S proteasome regulatory complex, subun 87.15
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 86.95
PRK09687280 putative lyase; Provisional 86.87
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 86.71
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.51
KOG1941 518 consensus Acetylcholine receptor-associated protei 86.39
COG1747 711 Uncharacterized N-terminal domain of the transcrip 86.29
COG4455 273 ImpE Protein of avirulence locus involved in tempe 85.53
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 85.42
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 85.4
PF1343134 TPR_17: Tetratricopeptide repeat 85.26
KOG4570418 consensus Uncharacterized conserved protein [Funct 85.02
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 84.89
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 84.88
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.3
KOG4570 418 consensus Uncharacterized conserved protein [Funct 83.96
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 83.74
COG0457291 NrfG FOG: TPR repeat [General function prediction 83.64
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.39
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 83.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.77
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 82.75
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.5
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 82.41
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 80.88
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 80.18
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 80.09
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=9.7e-86  Score=688.13  Aligned_cols=574  Identities=35%  Similarity=0.621  Sum_probs=560.6

Q ss_pred             CchhhhhHhhhcCChhHHHHHHHHhhhhcCCCCCcccHHHHHHHhhcchhhhhhhhHHHHHHHhCCCCChhHHHHHHHHH
Q 043608            1 FSNDYVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMY   80 (579)
Q Consensus         1 ~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~   80 (579)
                      .+|.+++.|++.|++++|+.+|+.|.+. |.+|+..+|..++.+|.+.+..+.+.+++..+.+.+..++...++.++..|
T Consensus        53 ~~n~~i~~l~~~g~~~~A~~l~~~m~~~-g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~  131 (857)
T PLN03077         53 DSNSQLRALCSHGQLEQALKLLESMQEL-RVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMF  131 (857)
T ss_pred             hHHHHHHHHHhCCCHHHHHHHHHHHHhc-CCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHH
Confidence            3789999999999999999999999987 899999999999999999999999999999999999999999999999999


Q ss_pred             HccCChhhHHHhhcCCCCCCeeehhHHhhhhhcCCChhhHHHHHHHHHHCCCCCCcccHHHHHHHhcCCCcchhHHHHHH
Q 043608           81 GKCGSLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQENDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHA  160 (579)
Q Consensus        81 ~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~g~~p~~~~~~~li~~~~~~~~~~~a~~~~~  160 (579)
                      ++.|+++.|.++|++|++||..+||.+|.+|++.|++++|+++|++|...|+.||..||+.++++|+..+++..+.+++.
T Consensus       132 ~~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~  211 (857)
T PLN03077        132 VRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHA  211 (857)
T ss_pred             HhCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhccCCChhHHHHHHHHHhcCCCHHHHHHHhcccCCCcHhhHHHHHHHHHhcCChHHHHHHHHHHHhcCCCCCChHh
Q 043608          161 HVIKSEHGSHLIAQNALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFI  240 (579)
Q Consensus       161 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~~p~~~~  240 (579)
                      .+.+.|+.||..+++.|+.+|++.|++++|.++|++|+++|..+||++|.+|++.|++++|+++|++|.+.|+ .||..|
T Consensus       212 ~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~-~Pd~~t  290 (857)
T PLN03077        212 HVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSV-DPDLMT  290 (857)
T ss_pred             HHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCC-CCChhH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999998 999999


Q ss_pred             HHHHHHHHHHH----------------------------------------HHHHhhcCCCCChhhHHHHHHHHHcCCCh
Q 043608          241 FGSVFSACSNF----------------------------------------ARILFNEIDSPDLASWNALIAGVASHSNA  280 (579)
Q Consensus       241 ~~~~l~~~~~~----------------------------------------~~~~~~~~~~~~~~~~~~li~~~~~~~~~  280 (579)
                      |+.++.+|...                                        +.++|+++..||..+||.+|.+|++.|++
T Consensus       291 y~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~  370 (857)
T PLN03077        291 ITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLP  370 (857)
T ss_pred             HHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCH
Confidence            99999887643                                        88899999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCCCCChHHHHHHHHHhhcccchhhHHHHHHHHHHcCCCCCchhHHHHHHHHHhcCChHHHHHHHHHc
Q 043608          281 NEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKEL  360 (579)
Q Consensus       281 ~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~  360 (579)
                      ++|+++|++|.+.|+.||..||+.++.+|++.|+++.+.++++.+.+.|+.|+..+++.++++|++.|++++|.++|++|
T Consensus       371 ~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m  450 (857)
T PLN03077        371 DKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNI  450 (857)
T ss_pred             HHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCcHhHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCchhHHH
Q 043608          361 GKNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMN  440 (579)
Q Consensus       361 ~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~  440 (579)
                      ..+ |..+|+.++.+|++.|+.++|..+|++|.. +++||..||+.++.+|++.|+.+.+.+++..+.+.|+.++..+++
T Consensus       451 ~~~-d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~n  528 (857)
T PLN03077        451 PEK-DVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPN  528 (857)
T ss_pred             CCC-CeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceech
Confidence            875 999999999999999999999999999986 599999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCHHHHHHHHhhCCCCChhhHHHHHHHHHhcCCcHHHHHHHHHHHhCCCCCChhHHHHHHHHhhccCchHH
Q 043608          441 GLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEE  520 (579)
Q Consensus       441 ~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~  520 (579)
                      +|+++|+++|++++|.++|+.+ .||..+|++++.+|++.|+.++|.++|++|.+.|+.||..||+.++.+|.+.|++++
T Consensus       529 aLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~e  607 (857)
T PLN03077        529 ALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQ  607 (857)
T ss_pred             HHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHH
Confidence            9999999999999999999999 999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhCCCCCcchhHHHHHHHHhcCChhHHHHHHHhhcCCCChhHhhhhhcC
Q 043608          521 GLHLYRIMENEYGIIPTREHCSCVVDLLARAGCVHEAEDFINQMACDADIVVWKSLLAS  579 (579)
Q Consensus       521 a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~l~~~  579 (579)
                      |.++|+.|.+.+|+.|+..+|..++++|.+.|++++|.+++++|+.+||..+|++||+|
T Consensus       608 a~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~a  666 (857)
T PLN03077        608 GLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNA  666 (857)
T ss_pred             HHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHH
Confidence            99999999977799999999999999999999999999999999999999999999874



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-08
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 76.4 bits (187), Expect = 1e-14
 Identities = 92/619 (14%), Positives = 171/619 (27%), Gaps = 217/619 (35%)

Query: 5   YVSSLCKQNLYNEALVAYDFSQNNTNIRIRPSTYAGLISACSSLRSLQLGRKVHDHILLS 64
           Y+    +  LYN+  V   F++ N +   R   Y  L  A   LR               
Sbjct: 112 YIE--QRDRLYNDNQV---FAKYNVS---RLQPYLKLRQALLELRP-------------- 149

Query: 65  KCQPDVVLQNHILNMYGKCG-------SLEDARMGFDKMPQRNVVSWTAMIAGCSQNYQE 117
               +V++      + G  G            ++   KM     + W  +      N   
Sbjct: 150 --AKNVLIDG----VLG-SGKTWVALDVCLSYKVQ-CKMD--FKIFWLNL--K---NCNS 194

Query: 118 NDAIKLYIQMLQSGVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQ--- 174
            + +   ++MLQ            I    +         +L  H I++E    L+     
Sbjct: 195 PETV---LEMLQK-------LLYQIDPNWTSRSDHSSNIKLRIHSIQAEL-RRLLKSKPY 243

Query: 175 -NALIAMYTKFDRILDARNVFSGIARKDVTSWGSMIAAFSKLGYELEALCHFNEMLHHGA 233
            N L+        +L            +V    +             A   FN       
Sbjct: 244 ENCLL--------VLL-----------NV--QNAKA---------WNA---FN------- 263

Query: 234 YQPNEFIFGSVFSACSNFARILFNEIDSPDLASWNALIAGVASHSNAN---------EAM 284
                         C    +IL   + +      + L A   +H + +         E  
Sbjct: 264 -------LS-----C----KIL---LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVK 304

Query: 285 SLFS---EMRDRELLPDGLTVHSLLCACIGRLT-----------LYQGMQVHSYIIKMGF 330
           SL     + R ++L  + LT +    + I                    ++ + II+   
Sbjct: 305 SLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTT-IIESSL 363

Query: 331 DSNVPVCNAILTMYAKCSVLCNALLVFKELGKNAD------SVSWNSIIAACLQHNQAEE 384
           +   P       M+ + S       VF     +A       S+ W  +I + +      +
Sbjct: 364 NVLEP--AEYRKMFDRLS-------VFPP---SAHIPTILLSLIWFDVIKSDVM-VVVNK 410

Query: 385 LFRLFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLH-----CYITKTGLAFDVFVM 439
           L +    ++  Q K   I+   +         LE    LH      Y        D  + 
Sbjct: 411 LHK--YSLVEKQPKESTISIPSI--YLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIP 466

Query: 440 NGLMDIYIKCGSLGSARKLFNFMENPDVVSWSSLILGYAQFGCG-DEALKLFTRM----R 494
             L D Y            ++              +G+        E + LF  +    R
Sbjct: 467 PYL-DQYF-----------YSH-------------IGHHLKNIEHPERMTLFRMVFLDFR 501

Query: 495 SLGVSPNLVTLVGVLTACSHVGLVEEGLH---LYR--IMENEYGIIPTREH-CSCVVDLL 548
            L        +    TA +  G +   L     Y+  I +N+    P  E   + ++D L
Sbjct: 502 FLE-----QKIRHDSTAWNASGSILNTLQQLKFYKPYICDND----PKYERLVNAILDFL 552

Query: 549 ARAG--CVHEAEDFINQMA 565
            +     +      + ++A
Sbjct: 553 PKIEENLICSKYTDLLRIA 571


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.81
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.76
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.67
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.67
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.66
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.6
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.51
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.51
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.49
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.48
3u4t_A272 TPR repeat-containing protein; structural genomics 99.47
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.47
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.44
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.43
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.42
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.42
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.4
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.39
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.37
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.37
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.35
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.33
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.27
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.25
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.25
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.24
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.24
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.24
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.21
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.19
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.13
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.1
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.08
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.05
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.04
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.01
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.01
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.99
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.94
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.93
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.88
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.86
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.85
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.85
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.81
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.81
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.8
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.77
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.77
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.76
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.74
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.71
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.71
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.7
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.7
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.7
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.64
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.64
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.59
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.58
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.55
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.53
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.5
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.49
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.48
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.48
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.44
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.41
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.4
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.39
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.36
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.34
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.34
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.33
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.31
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.31
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.3
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.26
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.26
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.26
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.25
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.24
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.23
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.22
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.2
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.2
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.19
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.18
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.14
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.1
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.1
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.07
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.06
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.03
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.02
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.02
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.01
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.97
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.97
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.97
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.96
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.96
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.96
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.93
3k9i_A117 BH0479 protein; putative protein binding protein, 97.86
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.86
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.85
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.84
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.81
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.78
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.78
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.78
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.75
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.75
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.73
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.72
3k9i_A117 BH0479 protein; putative protein binding protein, 97.69
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.69
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.66
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.61
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.58
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.58
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.52
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.51
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.5
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.49
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.44
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.42
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.36
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.35
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.34
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.33
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.32
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.27
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.25
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.06
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.03
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.91
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.8
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.8
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.68
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.62
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.55
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.47
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.43
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.4
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.4
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.29
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.28
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.17
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.03
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.99
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.89
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.79
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.75
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.72
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.04
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.87
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.67
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.65
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 94.4
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.29
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.16
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.91
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.9
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.76
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.57
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.52
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.38
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.77
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 92.58
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.25
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 91.96
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.83
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.19
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.0
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.98
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.24
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.72
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.43
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 89.27
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.04
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.72
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.01
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 87.45
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.41
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.25
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 87.02
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 86.79
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.29
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 86.2
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 86.03
2p58_C116 Putative type III secretion protein YSCG; type III 85.88
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 84.51
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.2
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.5e-40  Score=333.76  Aligned_cols=474  Identities=8%  Similarity=-0.016  Sum_probs=251.9

Q ss_pred             cccHHHHHHHhhcchhhhhhhhHHHHHHHhCCCCChhHHHHHHHHHHccCChhhHHHhhcCCC--CCCeeehhHHhhhhh
Q 043608           35 PSTYAGLISACSSLRSLQLGRKVHDHILLSKCQPDVVLQNHILNMYGKCGSLEDARMGFDKMP--QRNVVSWTAMIAGCS  112 (579)
Q Consensus        35 ~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~--~~~~~~~~~l~~~~~  112 (579)
                      ...|+.++..+.+.|++++|..+|+++.+.  .|+..++..++.+|.+.|++++|..+|+++.  .++..+++.++.+|.
T Consensus        84 ~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~  161 (597)
T 2xpi_A           84 EDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLV  161 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHHHHH
Confidence            344444444444444444444444444432  2333444444444444444444444444442  234444444444444


Q ss_pred             cCCChhhHHHHHHHHHHC---------------CCCCCcccHHHHHHHhcCCCcchhHHHHHHHHHHhccCCChhHHHHH
Q 043608          113 QNYQENDAIKLYIQMLQS---------------GVMPGQFTFGSIIKACSGLGSVCLGRQLHAHVIKSEHGSHLIAQNAL  177 (579)
Q Consensus       113 ~~~~~~~a~~~~~~~~~~---------------g~~p~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l  177 (579)
                      +.|++++|.++|+++...               |.+++..+|..++.+|.+.|++++|.++|+++.+.++ .+...+..+
T Consensus       162 ~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p-~~~~~~~~l  240 (597)
T 2xpi_A          162 KLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDA-KCYEAFDQL  240 (597)
T ss_dssp             HTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCHHHHHHH
T ss_pred             HHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc-hhhHHHHHH
Confidence            444444444444421111               1112234444555555555555555555555544331 122233333


Q ss_pred             HHHHhcCCCHHHHHH--H-hcccCCC----cHhhHHHHHHHHHhcCChHHHHHHHHHHHhcCCCCCChHhHHHHHHHHHH
Q 043608          178 IAMYTKFDRILDARN--V-FSGIARK----DVTSWGSMIAAFSKLGYELEALCHFNEMLHHGAYQPNEFIFGSVFSACSN  250 (579)
Q Consensus       178 ~~~~~~~g~~~~a~~--~-~~~~~~~----~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~~p~~~~~~~~l~~~~~  250 (579)
                      ...+...+..+.+..  + +..+...    ....|+.++..|.+.|++++|.++|+++.+.                   
T Consensus       241 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~-------------------  301 (597)
T 2xpi_A          241 VSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL-------------------  301 (597)
T ss_dssp             HHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG-------------------
T ss_pred             HHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC-------------------
Confidence            333322222111110  0 1111111    1223333444444555555555555444332                   


Q ss_pred             HHHHHhhcCCCCChhhHHHHHHHHHcCCChHHHHHHHHHHHhCCCCCChHHHHHHHHHhhcccchhhHHHHHHHHHHcCC
Q 043608          251 FARILFNEIDSPDLASWNALIAGVASHSNANEAMSLFSEMRDRELLPDGLTVHSLLCACIGRLTLYQGMQVHSYIIKMGF  330 (579)
Q Consensus       251 ~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~  330 (579)
                                +++..+|+.++..+.+.|++++|.++|+++.+.+ +.+..++..++.++.+.|++++|..+++.+.+.. 
T Consensus       302 ----------~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-  369 (597)
T 2xpi_A          302 ----------EKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-  369 (597)
T ss_dssp             ----------GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-
T ss_pred             ----------CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-
Confidence                      2444445555555555555555555555554432 2234444455555555555555555555554332 


Q ss_pred             CCCchhHHHHHHHHHhcCChHHHHHHHHHc-C-CCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCcHhHHHHHH
Q 043608          331 DSNVPVCNAILTMYAKCSVLCNALLVFKEL-G-KNADSVSWNSIIAACLQHNQAEELFRLFSRMLASQIKPDHITFNDVM  408 (579)
Q Consensus       331 ~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~-~-~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~  408 (579)
                      +.+..++..++.+|.+.|++++|.++|+++ . .+.+..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..++..++
T Consensus       370 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~  448 (597)
T 2xpi_A          370 PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLG  448 (597)
T ss_dssp             TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHH
T ss_pred             cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHH
Confidence            334555566666666666666666666654 1 12245566777777777777777777777766653 33556666677


Q ss_pred             HHHhccCChHHHHHHHHHHHHcCCCCchhHHHHHHHHHHHcCCHHHHHHHHhhCC--------CCC--hhhHHHHHHHHH
Q 043608          409 GACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFME--------NPD--VVSWSSLILGYA  478 (579)
Q Consensus       409 ~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~--------~~~--~~~~~~l~~~~~  478 (579)
                      .+|.+.|++++|.++++.+.+... .++.+++.++.+|.+.|++++|.++|+++.        .|+  ..+|..++.+|.
T Consensus       449 ~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~  527 (597)
T 2xpi_A          449 MQHMQLGNILLANEYLQSSYALFQ-YDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYR  527 (597)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCC-CChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHH
Confidence            777777777777777777665542 256667777777777777777777776663        244  557777788888


Q ss_pred             hcCCcHHHHHHHHHHHhCCCCCChhHHHHHHHHhhccCchHHHHHHHHHHHHhhCCCCC-cchhHHHHHHH
Q 043608          479 QFGCGDEALKLFTRMRSLGVSPNLVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPT-REHCSCVVDLL  548 (579)
Q Consensus       479 ~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~-~~~~~~l~~~~  548 (579)
                      +.|++++|.+.++++.+.+ +.+..+|..+..+|.+.|++++|.+.++++.+.   .|+ ...+..+..+|
T Consensus       528 ~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~---~p~~~~~~~~l~~~~  594 (597)
T 2xpi_A          528 KLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAI---SPNEIMASDLLKRAL  594 (597)
T ss_dssp             HTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH---CTTCHHHHHHHHHTT
T ss_pred             HhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc---CCCChHHHHHHHHHH
Confidence            8888888888888877754 336677788888888888888888888887754   343 44555555544



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.45
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.43
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.08
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.04
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.02
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.97
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.79
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.78
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.76
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.49
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.41
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.37
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.2
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.15
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.15
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.11
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.1
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.09
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.07
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.07
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.03
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.96
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.9
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.83
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.73
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.63
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.55
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.51
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.5
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.45
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.45
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.4
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.18
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.12
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.04
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.03
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.82
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.65
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.45
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.88
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.68
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.31
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.09
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.84
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.84
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.12
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.47
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.11
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.94
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 82.73
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=3.3e-19  Score=168.65  Aligned_cols=236  Identities=11%  Similarity=0.050  Sum_probs=133.2

Q ss_pred             hcccchhhHHHHHHHHHHcCCCCCchhHHHHHHHHHhcCChHHHHHHHHHc-CC-CCChhhHHHHHHHHHhcCCHHHHHH
Q 043608          310 IGRLTLYQGMQVHSYIIKMGFDSNVPVCNAILTMYAKCSVLCNALLVFKEL-GK-NADSVSWNSIIAACLQHNQAEELFR  387 (579)
Q Consensus       310 ~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~-~~-~~~~~~~~~l~~~~~~~~~~~~a~~  387 (579)
                      ...+....+...+....... +.+...+..+...+...|+++.|...++.. .. +-+...+..+...+...|++++|..
T Consensus       146 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~  224 (388)
T d1w3ba_         146 KALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVA  224 (388)
T ss_dssp             HTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHH
T ss_pred             cccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHH
Confidence            33344444444444433332 223344444555555555555555555543 11 1134455555666666666666666


Q ss_pred             HHHHHHHCCCCCcHhHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCchhHHHHHHHHHHHcCCHHHHHHHHhhCC---C
Q 043608          388 LFSRMLASQIKPDHITFNDVMGACAKMASLEMVTQLHCYITKTGLAFDVFVMNGLMDIYIKCGSLGSARKLFNFME---N  464 (579)
Q Consensus       388 ~~~~m~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~---~  464 (579)
                      .+++....+ +.+...+..+...+...|++++|...+++..+... -++.++..+..++...|++++|.+.++...   .
T Consensus       225 ~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~  302 (388)
T d1w3ba_         225 AYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP-HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCP  302 (388)
T ss_dssp             HHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCS-SCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCT
T ss_pred             HHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCC
Confidence            666655542 23344455555566666666666666666555432 234555666666666666666666666554   2


Q ss_pred             CChhhHHHHHHHHHhcCCcHHHHHHHHHHHhCCCCCC-hhHHHHHHHHhhccCchHHHHHHHHHHHHhhCCCCC-cchhH
Q 043608          465 PDVVSWSSLILGYAQFGCGDEALKLFTRMRSLGVSPN-LVTLVGVLTACSHVGLVEEGLHLYRIMENEYGIIPT-REHCS  542 (579)
Q Consensus       465 ~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~-~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~-~~~~~  542 (579)
                      .+...+..+...+...|++++|++.+++..+.  .|+ ..++..+..++...|++++|...|++..+   +.|+ ...+.
T Consensus       303 ~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~---l~P~~~~a~~  377 (388)
T d1w3ba_         303 THADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR---ISPTFADAYS  377 (388)
T ss_dssp             TCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT---TCTTCHHHHH
T ss_pred             ccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH---hCCCCHHHHH
Confidence            34455666666677777777777777776653  343 44666677777777777777777777663   3443 44566


Q ss_pred             HHHHHHHhcCC
Q 043608          543 CVVDLLARAGC  553 (579)
Q Consensus       543 ~l~~~~~~~g~  553 (579)
                      .|..+|.+.||
T Consensus       378 ~lg~~~~~~~D  388 (388)
T d1w3ba_         378 NMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHTCC
T ss_pred             HHHHHHHHcCC
Confidence            66666666654



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure