Citrus Sinensis ID: 043637


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MAGNAATILKNILSKSSPKPTPSKTLTKTISGHLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFDRY
cccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHHccccccEEEcHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHcHHHcccccccccHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHccccc
cccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHEHHHHccc
MAGNAATILKNIlsksspkptpsktltktisghlksdepvsySLYAHLFQLCASSKAIVEARKLESnlvtfyptppvfLLNRAIECygkcgnlddarglfdemperdggswNAMLGaytqngfpgrtLELFLDmnhsgvsanqITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLRedirplnfTFANALFACsflsspyegmqiHGVIIKIDFEGDDVVLGSLTEMYVKCGrledarglldqpderniiSWTSIVSGYAISGRIREARELFnempernviSWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGlseikmgkevhgfihrndyssniFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSemqwetrpskftFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFkesssldviICNSMILGFCHNERGREALEVFGLmkkegikpdhitFHGILLACIHEGNVKLALQFFDSmrckygiipqleHYECMIKLYCRYGYMKELEDFVnrmpfnptvpMLRKIFDKCRKNGYATLGEWAARRLNelnpwapfqfkittnrfdry
MAGNAATILknilsksspkptpsktLTKTISGHLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEdarglldqpderniiswtsivsgyaISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQmsqrrdkvsWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLnelnpwapfqfkittnrfdry
MAGNAATILKNIlsksspkptpsktltktISGHLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFDRY
***************************************VSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYAR***************WETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTN*****
***NAATILKNILSKSSPKPTPSKTLTKTISGHLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFDRY
********LKNILSKS*********LTKTISGHLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARR**************WETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFDRY
***NAATILKNILSKSSPKPTPSKTLTKTISGHLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFDRY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGNAATILKNILSKSSPKPTPSKTLTKTISGHLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFDRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
Q9LRV2700 Pentatricopeptide repeat- yes no 0.959 0.95 0.544 0.0
Q9LFL5 850 Pentatricopeptide repeat- no no 0.914 0.745 0.298 4e-89
Q9LFI1768 Pentatricopeptide repeat- no no 0.870 0.785 0.295 4e-88
Q9SS831028 Pentatricopeptide repeat- no no 0.839 0.566 0.288 8e-85
Q9SS60 882 Pentatricopeptide repeat- no no 0.838 0.658 0.310 4e-84
Q9SN39 871 Pentatricopeptide repeat- no no 0.862 0.686 0.300 2e-83
Q9SIT7697 Pentatricopeptide repeat- no no 0.717 0.713 0.301 4e-83
Q9SVA5834 Pentatricopeptide repeat- no no 0.897 0.745 0.293 1e-82
Q9FIB2 995 Putative pentatricopeptid no no 0.891 0.621 0.298 2e-82
O49287695 Putative pentatricopeptid no no 0.864 0.861 0.299 5e-82
>sp|Q9LRV2|PP256_ARATH Pentatricopeptide repeat-containing protein At3g26540 OS=Arabidopsis thaliana GN=PCMP-A5 PE=2 SV=1 Back     alignment and function desciption
 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/670 (54%), Positives = 486/670 (72%), Gaps = 5/670 (0%)

Query: 3   GNAATILKNILSKSSPKPTPSKTLTKTISGHLKSDEPVSYSLYAHLFQLCASSKAIVEAR 62
           G   T+ + IL     +      ++K +S    S EPVSY LY  LF+ C+S   +V+AR
Sbjct: 27  GTKLTVTRQIL-----EHLEGGNVSKAVSVLFASPEPVSYWLYERLFRSCSSKALVVQAR 81

Query: 63  KLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWNAMLGAYTQNG 122
           K++S+LVTF P PP+FLLNRAIE YGKCG +DDAR LF+EMPERDGGSWNA++ A  QNG
Sbjct: 82  KVQSHLVTFSPLPPIFLLNRAIEAYGKCGCVDDARELFEEMPERDGGSWNAVITACAQNG 141

Query: 123 FPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILES 182
                  +F  MN  GV A + ++A VL+S    L+L + +QLH  +VK G+ GNV LE+
Sbjct: 142 VSDEVFRMFRRMNRDGVRATETSFAGVLKSCGLILDLRLLRQLHCAVVKYGYSGNVDLET 201

Query: 183 SLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRP 242
           S+VD YGKC VM+DARR+FD+I N + VSWNVIVRRYL  G   EAVVMFFKML  ++RP
Sbjct: 202 SIVDVYGKCRVMSDARRVFDEIVNPSDVSWNVIVRRYLEMGFNDEAVVMFFKMLELNVRP 261

Query: 243 LNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLL 302
           LN T ++ + ACS   +   G  IH + +K+    D VV  S+ +MYVKC RLE AR + 
Sbjct: 262 LNHTVSSVMLACSRSLALEVGKVIHAIAVKLSVVADTVVSTSVFDMYVKCDRLESARRVF 321

Query: 303 DQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYTRSLLWKEALD 362
           DQ   +++ SWTS +SGYA+SG  REARELF+ MPERN++SWNAML GY  +  W EALD
Sbjct: 322 DQTRSKDLKSWTSAMSGYAMSGLTREARELFDLMPERNIVSWNAMLGGYVHAHEWDEALD 381

Query: 363 FVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYR 422
           F+ LMR+  ++ID VTL  ILNVC+G+S+++MGK+ HGFI+R+ Y +N+ V+NALLDMY 
Sbjct: 382 FLTLMRQEIENIDNVTLVWILNVCSGISDVQMGKQAHGFIYRHGYDTNVIVANALLDMYG 441

Query: 423 KCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFET 482
           KCG L+SA IWF QMS+ RD+VSWNA+LTG AR G+SE+A++ F  MQ E +PSK+T  T
Sbjct: 442 KCGTLQSANIWFRQMSELRDEVSWNALLTGVARVGRSEQALSFFEGMQVEAKPSKYTLAT 501

Query: 483 LLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESSSLD 542
           LLA CANI +L  GK IH F+IR+ Y+I+VV RGA+V++Y+KC C +YAI VFKE+++ D
Sbjct: 502 LLAGCANIPALNLGKAIHGFLIRDGYKIDVVIRGAMVDMYSKCRCFDYAIEVFKEAATRD 561

Query: 543 VIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEGNVKLALQFFD 602
           +I+ NS+I G C N R +E  E+F L++ EG+KPDH+TF GIL ACI EG+V+L  Q+F 
Sbjct: 562 LILWNSIIRGCCRNGRSKEVFELFMLLENEGVKPDHVTFLGILQACIREGHVELGFQYFS 621

Query: 603 SMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYA 662
           SM  KY I PQ+EHY+CMI+LYC+YG + +LE+F+  MPF+P + ML +I D C++  ++
Sbjct: 622 SMSTKYHISPQVEHYDCMIELYCKYGCLHQLEEFLLLMPFDPPMQMLTRINDACQRYRWS 681

Query: 663 TLGEWAARRL 672
            LG WAA+RL
Sbjct: 682 KLGAWAAKRL 691





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LFL5|PP390_ARATH Pentatricopeptide repeat-containing protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein At3g53360, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E86 PE=2 SV=1 Back     alignment and function description
>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E88 PE=2 SV=1 Back     alignment and function description
>sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protein At3g03580 OS=Arabidopsis thaliana GN=PCMP-H23 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=3 SV=1 Back     alignment and function description
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containing protein At5g09950 OS=Arabidopsis thaliana GN=PCMP-H35 PE=3 SV=1 Back     alignment and function description
>sp|O49287|PP127_ARATH Putative pentatricopeptide repeat-containing protein At1g77010, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
225457865711 PREDICTED: pentatricopeptide repeat-cont 0.988 0.963 0.638 0.0
302142721 912 unnamed protein product [Vitis vinifera] 0.988 0.751 0.638 0.0
255578455718 pentatricopeptide repeat-containing prot 0.984 0.949 0.622 0.0
224066771709 predicted protein [Populus trichocarpa] 0.985 0.963 0.59 0.0
449453101697 PREDICTED: pentatricopeptide repeat-cont 0.975 0.969 0.592 0.0
356507622698 PREDICTED: pentatricopeptide repeat-cont 0.974 0.967 0.564 0.0
297818196693 pentatricopeptide repeat-containing prot 0.936 0.936 0.556 0.0
15231572700 pentatricopeptide repeat-containing prot 0.959 0.95 0.544 0.0
115458508717 Os04g0436800 [Oryza sativa Japonica Grou 0.942 0.910 0.450 1e-168
222628911717 hypothetical protein OsJ_14892 [Oryza sa 0.942 0.910 0.450 1e-168
>gi|225457865|ref|XP_002279206.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/703 (63%), Positives = 548/703 (77%), Gaps = 18/703 (2%)

Query: 1   MAGNAATILKNILSKSSPKP----TPSKT--------------LTKTISGHLKSDEPVSY 42
           M  NAA++L  +L +++ KP    T SK               L K +S    S  P  +
Sbjct: 1   MGVNAASVLNRLLQRNTHKPKALPTDSKALTTTTVLTHLNAGRLRKAVSILFASPVPFPF 60

Query: 43  SLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDE 102
           SLYA LFQ+C+S+ AIVEARK+ES+L+TF P PP+FLLNRAIE YGKC  LDDAR LF+E
Sbjct: 61  SLYARLFQICSSNLAIVEARKVESHLITFSPAPPIFLLNRAIETYGKCSCLDDARELFEE 120

Query: 103 MPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVS 162
           MP+RDGGSWNAM+ AY Q G   + L LF  MN  G+ AN+IT+A+VL S A  L L +S
Sbjct: 121 MPQRDGGSWNAMITAYAQGGCAEKALWLFSRMNRLGIWANEITFASVLGSCATVLALFLS 180

Query: 163 KQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVA 222
           KQ+HGLIVK GFC NVIL SSLVD YGKC VM+DARRMFD+I+N NA+SWNVIVRRYL  
Sbjct: 181 KQIHGLIVKYGFCWNVILGSSLVDIYGKCRVMSDARRMFDEIENPNAISWNVIVRRYLEM 240

Query: 223 GNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGDDVVL 282
           GN KEAVVMFFKM+R +IRPLNFTF+NAL ACS +S+  EG+QIHGV I+I ++ D+VV 
Sbjct: 241 GNEKEAVVMFFKMIRANIRPLNFTFSNALIACSSISALQEGIQIHGVAIRIGYDEDEVVS 300

Query: 283 GSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVI 342
            SL +MY KCG LE A  + + P  +N+ISWTSIVSGYA+SG+ REAR LF+EMPER+VI
Sbjct: 301 SSLIDMYAKCGDLESACRIFELPSSKNLISWTSIVSGYAMSGQTREARVLFDEMPERSVI 360

Query: 343 SWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFI 402
           SWNAMLAGYT    W+EAL+FVFLMRK T+DID VT+GLILNVCAGLS+++ GK+VHGFI
Sbjct: 361 SWNAMLAGYTHFCQWEEALEFVFLMRKATQDIDHVTVGLILNVCAGLSDVESGKQVHGFI 420

Query: 403 HRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQSEEA 462
           +R+   SN+FV NALL MY KCGNLRS R+WFYQMS  RD++SWNA+LT +AR G SEEA
Sbjct: 421 YRHGLYSNLFVGNALLHMYGKCGNLRSTRLWFYQMSHWRDRISWNALLTSHARHGLSEEA 480

Query: 463 MTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVY 522
           MT F EMQWET PSKFT  TLL+ACANI +LEQGKQIH F+IRN YEI+VV RGALV++Y
Sbjct: 481 MTIFGEMQWETTPSKFTLGTLLSACANIFALEQGKQIHGFMIRNGYEIDVVARGALVDMY 540

Query: 523 TKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFH 582
           +KC CLEYA++VFKE+ S D+I+ NSMILG CHN RGR+ L +FGLM++EG+KPDHITF 
Sbjct: 541 SKCRCLEYALKVFKEAPSRDLILWNSMILGCCHNGRGRDVLGLFGLMEEEGVKPDHITFQ 600

Query: 583 GILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPF 642
           GILL CI EG   L  ++F+SM  KY IIP+LEHYE MI+LY R+G+M ELEDF+ RMPF
Sbjct: 601 GILLGCICEGLAGLGTEYFNSMSNKYCIIPRLEHYESMIELYGRHGFMDELEDFIKRMPF 660

Query: 643 NPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKI 685
            PTV ML ++F+ C ++G++ LG+WAA +LNELNP  PF F+I
Sbjct: 661 EPTVAMLTRVFNACSEHGHSRLGKWAAEQLNELNPSTPFHFQI 703




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302142721|emb|CBI19924.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255578455|ref|XP_002530092.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530403|gb|EEF32291.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224066771|ref|XP_002302207.1| predicted protein [Populus trichocarpa] gi|222843933|gb|EEE81480.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449453101|ref|XP_004144297.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26540-like [Cucumis sativus] gi|449521874|ref|XP_004167954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26540-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356507622|ref|XP_003522563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26540-like [Glycine max] Back     alignment and taxonomy information
>gi|297818196|ref|XP_002876981.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322819|gb|EFH53240.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15231572|ref|NP_189286.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273843|sp|Q9LRV2.1|PP256_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g26540 gi|9293933|dbj|BAB01836.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332643655|gb|AEE77176.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115458508|ref|NP_001052854.1| Os04g0436800 [Oryza sativa Japonica Group] gi|38344064|emb|CAD40816.2| OSJNBa0006B20.8 [Oryza sativa Japonica Group] gi|113564425|dbj|BAF14768.1| Os04g0436800 [Oryza sativa Japonica Group] gi|116310780|emb|CAH67572.1| H0315A08.2 [Oryza sativa Indica Group] gi|215704891|dbj|BAG94919.1| unnamed protein product [Oryza sativa Japonica Group] gi|218194892|gb|EEC77319.1| hypothetical protein OsI_15984 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|222628911|gb|EEE61043.1| hypothetical protein OsJ_14892 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
TAIR|locus:2088827700 AT3G26540 [Arabidopsis thalian 0.919 0.91 0.563 7.8e-197
TAIR|locus:2122551834 AT4G39530 [Arabidopsis thalian 0.536 0.446 0.322 2.2e-88
TAIR|locus:2134842729 AT4G04370 [Arabidopsis thalian 0.523 0.497 0.314 3.5e-86
TAIR|locus:2205425 743 AT1G68930 "AT1G68930" [Arabido 0.735 0.686 0.330 2.8e-84
TAIR|locus:2119440 1064 AT4G13650 [Arabidopsis thalian 0.536 0.349 0.298 5.1e-83
TAIR|locus:2089333654 AT3G16610 "AT3G16610" [Arabido 0.525 0.556 0.332 1.3e-82
TAIR|locus:2205200 741 OTP82 "AT1G08070" [Arabidopsis 0.702 0.657 0.340 4.8e-78
TAIR|locus:505006130 970 AT1G18485 [Arabidopsis thalian 0.541 0.386 0.291 6.6e-78
TAIR|locus:2078653 825 AT3G02010 [Arabidopsis thalian 0.513 0.431 0.329 2e-77
TAIR|locus:20952891028 AT3G09040 "AT3G09040" [Arabido 0.546 0.368 0.299 2.8e-77
TAIR|locus:2088827 AT3G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1906 (676.0 bits), Expect = 7.8e-197, P = 7.8e-197
 Identities = 359/637 (56%), Positives = 474/637 (74%)

Query:    36 SDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDD 95
             S EPVSY LY  LF+ C+S   +V+ARK++S+LVTF P PP+FLLNRAIE YGKCG +DD
Sbjct:    55 SPEPVSYWLYERLFRSCSSKALVVQARKVQSHLVTFSPLPPIFLLNRAIEAYGKCGCVDD 114

Query:    96 ARGLFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAE 155
             AR LF+EMPERDGGSWNA++ A  QNG       +F  MN  GV A + ++A VL+S   
Sbjct:   115 ARELFEEMPERDGGSWNAVITACAQNGVSDEVFRMFRRMNRDGVRATETSFAGVLKSCGL 174

Query:   156 ELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVI 215
              L+L + +QLH  +VK G+ GNV LE+S+VD YGKC VM+DARR+FD+I N + VSWNVI
Sbjct:   175 ILDLRLLRQLHCAVVKYGYSGNVDLETSIVDVYGKCRVMSDARRVFDEIVNPSDVSWNVI 234

Query:   216 VRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDF 275
             VRRYL  G   EAVVMFFKML  ++RPLN T ++ + ACS   +   G  IH + +K+  
Sbjct:   235 VRRYLEMGFNDEAVVMFFKMLELNVRPLNHTVSSVMLACSRSLALEVGKVIHAIAVKLSV 294

Query:   276 EGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNE 335
               D VV  S+ +MYVKC RLE AR + DQ   +++ SWTS +SGYA+SG  REARELF+ 
Sbjct:   295 VADTVVSTSVFDMYVKCDRLESARRVFDQTRSKDLKSWTSAMSGYAMSGLTREARELFDL 354

Query:   336 MPERNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMG 395
             MPERN++SWNAML GY  +  W EALDF+ LMR+  ++ID VTL  ILNVC+G+S+++MG
Sbjct:   355 MPERNIVSWNAMLGGYVHAHEWDEALDFLTLMRQEIENIDNVTLVWILNVCSGISDVQMG 414

Query:   396 KEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYAR 455
             K+ HGFI+R+ Y +N+ V+NALLDMY KCG L+SA IWF QMS+ RD+VSWNA+LTG AR
Sbjct:   415 KQAHGFIYRHGYDTNVIVANALLDMYGKCGTLQSANIWFRQMSELRDEVSWNALLTGVAR 474

Query:   456 RGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCR 515
              G+SE+A++ F  MQ E +PSK+T  TLLA CANI +L  GK IH F+IR+ Y+I+VV R
Sbjct:   475 VGRSEQALSFFEGMQVEAKPSKYTLATLLAGCANIPALNLGKAIHGFLIRDGYKIDVVIR 534

Query:   516 GALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIK 575
             GA+V++Y+KC C +YAI VFKE+++ D+I+ NS+I G C N R +E  E+F L++ EG+K
Sbjct:   535 GAMVDMYSKCRCFDYAIEVFKEAATRDLILWNSIIRGCCRNGRSKEVFELFMLLENEGVK 594

Query:   576 PDHITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELED 635
             PDH+TF GIL ACI EG+V+L  Q+F SM  KY I PQ+EHY+CMI+LYC+YG + +LE+
Sbjct:   595 PDHVTFLGILQACIREGHVELGFQYFSSMSTKYHISPQVEHYDCMIELYCKYGCLHQLEE 654

Query:   636 FVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRL 672
             F+  MPF+P + ML +I D C++  ++ LG WAA+RL
Sbjct:   655 FLLLMPFDPPMQMLTRINDACQRYRWSKLGAWAAKRL 691




GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134842 AT4G04370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205425 AT1G68930 "AT1G68930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089333 AT3G16610 "AT3G16610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095289 AT3G09040 "AT3G09040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LRV2PP256_ARATHNo assigned EC number0.54470.95950.95yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00014353001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (711 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-109
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-71
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-53
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-36
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-30
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-29
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-20
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-06
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  351 bits (901), Expect = e-109
 Identities = 193/639 (30%), Positives = 325/639 (50%), Gaps = 33/639 (5%)

Query: 39  PVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARG 98
           PV    Y  LF+LC   +A+ E  ++ S  ++ +P+  V L N  +  + + G L  A  
Sbjct: 83  PVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWY 142

Query: 99  LFDEMPERDGGSWNAMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELE 158
           +F +MPERD  SWN ++G Y + G+    L L+  M  +GV  +  T+  VLR+     +
Sbjct: 143 VFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPD 202

Query: 159 LGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCMVMTDARRMFDDIQNKNAVSWNVIVRR 218
           L   +++H  +V+ GF  +V + ++L+  Y KC  +  AR +FD +  ++ +SWN ++  
Sbjct: 203 LARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISG 262

Query: 219 YLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIKIDFEGD 278
           Y   G   E + +FF M    + P   T  + + AC  L     G ++HG ++K  F  D
Sbjct: 263 YFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVD 322

Query: 279 DVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPE 338
             V  SL +MY+  G                                  EA ++F+ M  
Sbjct: 323 VSVCNSLIQMYLSLGSW-------------------------------GEAEKVFSRMET 351

Query: 339 RNVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEV 398
           ++ +SW AM++GY ++ L  +AL+   LM +     D++T+  +L+ CA L ++ +G ++
Sbjct: 352 KDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKL 411

Query: 399 HGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQRRDKVSWNAVLTGYARRGQ 458
           H    R    S + V+NAL++MY KC  +  A   F+ +   +D +SW +++ G     +
Sbjct: 412 HELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIP-EKDVISWTSIIAGLRLNNR 470

Query: 459 SEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGAL 518
             EA+  F +M    +P+  T    L+ACA I +L  GK+IH  V+R     +     AL
Sbjct: 471 CFEALIFFRQMLLTLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNAL 530

Query: 519 VEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDH 578
           +++Y +C  + YA   F  S   DV+  N ++ G+  + +G  A+E+F  M + G+ PD 
Sbjct: 531 LDLYVRCGRMNYAWNQFN-SHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDE 589

Query: 579 ITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVN 638
           +TF  +L AC   G V   L++F SM  KY I P L+HY C++ L  R G + E  +F+N
Sbjct: 590 VTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFIN 649

Query: 639 RMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNP 677
           +MP  P   +   + + CR + +  LGE AA+ + EL+P
Sbjct: 650 KMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDP 688


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.89
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
KOG2076895 consensus RNA polymerase III transcription factor 99.82
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.8
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.77
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.76
KOG2076 895 consensus RNA polymerase III transcription factor 99.72
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.68
KOG2003840 consensus TPR repeat-containing protein [General f 99.66
KOG2003 840 consensus TPR repeat-containing protein [General f 99.64
KOG1915677 consensus Cell cycle control protein (crooked neck 99.57
KOG1126638 consensus DNA-binding cell division cycle control 99.55
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.55
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.54
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.52
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.51
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.5
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.49
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.49
KOG0547606 consensus Translocase of outer mitochondrial membr 99.48
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.47
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.46
KOG0547606 consensus Translocase of outer mitochondrial membr 99.45
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.45
KOG1126638 consensus DNA-binding cell division cycle control 99.43
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.41
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.4
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.4
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.39
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.34
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.33
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.33
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.33
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.31
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.27
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.26
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.26
PF1304150 PPR_2: PPR repeat family 99.25
PRK12370553 invasion protein regulator; Provisional 99.23
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.22
PF1304150 PPR_2: PPR repeat family 99.22
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.21
KOG2376652 consensus Signal recognition particle, subunit Srp 99.21
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.2
KOG1129478 consensus TPR repeat-containing protein [General f 99.19
PRK11189296 lipoprotein NlpI; Provisional 99.16
PRK12370553 invasion protein regulator; Provisional 99.15
KOG1129478 consensus TPR repeat-containing protein [General f 99.15
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.14
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.12
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.09
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.04
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.03
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.03
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.01
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.99
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.99
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.98
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.98
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.91
PRK11189296 lipoprotein NlpI; Provisional 98.87
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.85
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.83
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.8
PRK15359144 type III secretion system chaperone protein SscB; 98.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.79
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.79
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.62
KOG1125579 consensus TPR repeat-containing protein [General f 98.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.61
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.6
PRK04841 903 transcriptional regulator MalT; Provisional 98.58
PRK10370198 formate-dependent nitrite reductase complex subuni 98.55
PLN02789320 farnesyltranstransferase 98.55
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.55
PLN02789320 farnesyltranstransferase 98.55
PF1285434 PPR_1: PPR repeat 98.54
PF1285434 PPR_1: PPR repeat 98.54
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.49
PRK04841903 transcriptional regulator MalT; Provisional 98.47
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.46
KOG1125579 consensus TPR repeat-containing protein [General f 98.46
KOG1128777 consensus Uncharacterized conserved protein, conta 98.45
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.41
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.4
PRK15359144 type III secretion system chaperone protein SscB; 98.38
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.38
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.37
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.37
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.37
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.34
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.34
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.31
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.26
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.26
PRK10370198 formate-dependent nitrite reductase complex subuni 98.23
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.19
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.17
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.16
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.15
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.14
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.13
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.1
KOG0553 304 consensus TPR repeat-containing protein [General f 98.07
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.06
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.05
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.99
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.98
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.98
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.97
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.96
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.96
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.96
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.93
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.88
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.87
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.78
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.74
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.7
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.63
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.63
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.63
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.62
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.61
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.6
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.6
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.59
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.57
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.55
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.53
KOG20411189 consensus WD40 repeat protein [General function pr 97.49
KOG20411189 consensus WD40 repeat protein [General function pr 97.46
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.45
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.44
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.43
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.43
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.4
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.4
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.34
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.32
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.32
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.3
KOG0553304 consensus TPR repeat-containing protein [General f 97.3
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.29
PF12688120 TPR_5: Tetratrico peptide repeat 97.29
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.28
PRK10803263 tol-pal system protein YbgF; Provisional 97.27
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.26
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.26
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.25
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.23
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.23
PF1342844 TPR_14: Tetratricopeptide repeat 97.19
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.18
PF1337173 TPR_9: Tetratricopeptide repeat 97.18
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.17
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.17
COG4700251 Uncharacterized protein conserved in bacteria cont 97.16
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.15
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.11
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.03
COG4700251 Uncharacterized protein conserved in bacteria cont 96.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.96
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.8
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.8
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.74
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.74
PRK10803263 tol-pal system protein YbgF; Provisional 96.74
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.69
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.68
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.63
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.63
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 96.62
PF12688120 TPR_5: Tetratrico peptide repeat 96.45
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.39
PRK15331165 chaperone protein SicA; Provisional 96.3
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.29
COG3898531 Uncharacterized membrane-bound protein [Function u 96.26
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.25
PRK15331165 chaperone protein SicA; Provisional 96.22
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.2
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.16
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.11
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.09
PF1337173 TPR_9: Tetratricopeptide repeat 96.01
KOG3941406 consensus Intermediate in Toll signal transduction 96.0
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.96
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.95
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.86
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.78
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.74
PF13512142 TPR_18: Tetratricopeptide repeat 95.58
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.55
PRK11906458 transcriptional regulator; Provisional 95.5
KOG1586288 consensus Protein required for fusion of vesicles 95.2
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.16
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.15
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.13
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.01
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.0
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.99
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.96
PF13512142 TPR_18: Tetratricopeptide repeat 94.95
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.92
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.83
smart00299140 CLH Clathrin heavy chain repeat homology. 94.76
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.74
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.73
PF1343134 TPR_17: Tetratricopeptide repeat 94.72
PRK11906458 transcriptional regulator; Provisional 94.68
smart00299140 CLH Clathrin heavy chain repeat homology. 94.67
KOG3941406 consensus Intermediate in Toll signal transduction 94.54
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.38
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.22
KOG1585308 consensus Protein required for fusion of vesicles 94.14
KOG4555175 consensus TPR repeat-containing protein [Function 94.13
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.1
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.05
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.9
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.78
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.76
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.58
KOG4555175 consensus TPR repeat-containing protein [Function 93.51
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.49
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.49
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.48
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.31
PRK12798 421 chemotaxis protein; Reviewed 93.25
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.25
KOG1585308 consensus Protein required for fusion of vesicles 93.16
PRK09687280 putative lyase; Provisional 93.03
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 92.85
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.8
COG3629280 DnrI DNA-binding transcriptional activator of the 92.77
PF1342844 TPR_14: Tetratricopeptide repeat 92.71
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.66
COG1747 711 Uncharacterized N-terminal domain of the transcrip 92.39
KOG1550552 consensus Extracellular protein SEL-1 and related 92.31
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.1
KOG1258577 consensus mRNA processing protein [RNA processing 92.09
KOG1258577 consensus mRNA processing protein [RNA processing 91.48
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.3
KOG4234271 consensus TPR repeat-containing protein [General f 91.06
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.05
KOG2610 491 consensus Uncharacterized conserved protein [Funct 90.88
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.82
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.75
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.65
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.64
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.43
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 90.33
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.32
COG0457291 NrfG FOG: TPR repeat [General function prediction 90.14
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.13
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.91
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 89.73
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.39
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.11
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.06
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.03
COG3629280 DnrI DNA-binding transcriptional activator of the 88.98
PF1343134 TPR_17: Tetratricopeptide repeat 88.5
KOG2062 929 consensus 26S proteasome regulatory complex, subun 88.39
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.31
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 88.25
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 87.97
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.96
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 87.83
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 87.38
PRK09687280 putative lyase; Provisional 87.3
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 87.25
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 86.85
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 86.7
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.47
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 86.05
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.95
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.89
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.78
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 85.75
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.74
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.24
KOG2062 929 consensus 26S proteasome regulatory complex, subun 85.12
KOG4570418 consensus Uncharacterized conserved protein [Funct 84.98
COG1747 711 Uncharacterized N-terminal domain of the transcrip 84.87
PRK11619 644 lytic murein transglycosylase; Provisional 84.21
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.76
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 83.62
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.76
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.48
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 82.29
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.29
KOG4570418 consensus Uncharacterized conserved protein [Funct 81.45
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 81.12
PRK10941269 hypothetical protein; Provisional 81.09
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.9e-89  Score=754.22  Aligned_cols=627  Identities=31%  Similarity=0.564  Sum_probs=607.9

Q ss_pred             hccCCCCCChhHHHHHHHHhhcCccHHHHHHHHHHHHHhCCCCCchhhhHHHHHHhccCChhhHHHhhccCCCCCcccHH
Q 043637           33 HLKSDEPVSYSLYAHLFQLCASSKAIVEARKLESNLVTFYPTPPVFLLNRAIECYGKCGNLDDARGLFDEMPERDGGSWN  112 (693)
Q Consensus        33 ~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~  112 (693)
                      +...+.+|+..+|..++.+|.+.+.+..+.+++..+.+.++.++..+++.++..|++.|+++.|+++|++|.+||..+||
T Consensus        77 m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~~~A~~~f~~m~~~d~~~~n  156 (857)
T PLN03077         77 MQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWN  156 (857)
T ss_pred             HHhcCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCChHHHHHHHhcCCCCCeeEHH
Confidence            44567889999999999999999999999999999999888889999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCChhhHHHHHHHhhhCCCCCCHhhHHHHHHHhhccCChHHHHHHHHHHHHhCCCCchhhHhHHHHHhhcCC
Q 043637          113 AMLGAYTQNGFPGRTLELFLDMNHSGVSANQITYANVLRSSAEELELGVSKQLHGLIVKRGFCGNVILESSLVDAYGKCM  192 (693)
Q Consensus       113 ~li~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~l~~~~~~~g  192 (693)
                      .+|.+|++.|++++|+++|++|.+.|+.||..||+.++++|+..+++..+.+++..+.+.|+.||..++++|+.+|+++|
T Consensus       157 ~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g  236 (857)
T PLN03077        157 VLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCG  236 (857)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHhccCCCCcccHHHHHHHHHhcCCchHHHHHHHHHHHCCCCCCHHhHHHHHHHhcCCCCcchhHHHHHHHHH
Q 043637          193 VMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIHGVIIK  272 (693)
Q Consensus       193 ~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~  272 (693)
                      ++++|.++|++|+++|..+||++|.+|++.|++++|+++|++|...|+.||..||+.++.+|++.|+.+.+.+++..+.+
T Consensus       237 ~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~  316 (857)
T PLN03077        237 DVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVK  316 (857)
T ss_pred             CHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCchHHHHHHHHHHHHcCChhHHHhhhcCCCCCCchhHHHHHHHHHhcCCHHHHHHHHhhCCCCCcccHHHHHHHHH
Q 043637          273 IDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDERNIISWTSIVSGYAISGRIREARELFNEMPERNVISWNAMLAGYT  352 (693)
Q Consensus       273 ~g~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~  352 (693)
                      .|+.||..+|+.|+.+|++.|+++                               +|.++|++|.+||..+|+.++.+|+
T Consensus       317 ~g~~~d~~~~n~Li~~y~k~g~~~-------------------------------~A~~vf~~m~~~d~~s~n~li~~~~  365 (857)
T PLN03077        317 TGFAVDVSVCNSLIQMYLSLGSWG-------------------------------EAEKVFSRMETKDAVSWTAMISGYE  365 (857)
T ss_pred             hCCccchHHHHHHHHHHHhcCCHH-------------------------------HHHHHHhhCCCCCeeeHHHHHHHHH
Confidence            999999999999999999999999                               8888888888899999999999999


Q ss_pred             hCCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHhcccchhhHHHHHHHHHHhCCCCchhHHHHHHHHHHHcCChHHHHH
Q 043637          353 RSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARI  432 (693)
Q Consensus       353 ~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~  432 (693)
                      +.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.+.++++.+.+.|+.|+..+++.++++|++.|++++|.+
T Consensus       366 ~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~  445 (857)
T PLN03077        366 KNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALE  445 (857)
T ss_pred             hCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999977


Q ss_pred             HHHhhcCCCChhhHHHHHHHHHhcCChHHHHHHHHHhhhCCCCCHHHHHHHHHHhcccCChHHHHHHHHHHHHhCCCcch
Q 043637          433 WFYQMSQRRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINV  512 (693)
Q Consensus       433 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~  512 (693)
                      ++.++ .++|..+|+.++.+|++.|+.++|+++|++|.....||..||..++.+|++.|+.+.+.+++..+.+.|+.++.
T Consensus       446 vf~~m-~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~  524 (857)
T PLN03077        446 VFHNI-PEKDVISWTSIIAGLRLNNRCFEALIFFRQMLLTLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDG  524 (857)
T ss_pred             HHHhC-CCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHhCCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccc
Confidence            77665 56899999999999999999999999999998645999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHhhCCHHHHHHHHhcCCCCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHCCCCCChHHHHHHHHHHhccC
Q 043637          513 VCRGALVEVYTKCCCLEYAIRVFKESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFHGILLACIHEG  592 (693)
Q Consensus       513 ~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g  592 (693)
                      .++++|+++|+++|++++|.++|+++ .+|..+||++|.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|.+.|
T Consensus       525 ~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g  603 (857)
T PLN03077        525 FLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSG  603 (857)
T ss_pred             eechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcC
Confidence            99999999999999999999999999 99999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHhHHhcCCCCChhHHHHHHHHHHhcCChHHHHHHHHhCCCCCCHHhHHHHHHHHHhcCCccHHHHHHHHH
Q 043637          593 NVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPFNPTVPMLRKIFDKCRKNGYATLGEWAARRL  672 (693)
Q Consensus       593 ~~~~A~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~  672 (693)
                      ++++|.++|+.|.++.|+.|+..+|+.++.+|++.|++++|.+++++|+..|+...|.+++.+|..+|+.+.|+.+.+++
T Consensus       604 ~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l  683 (857)
T PLN03077        604 MVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHI  683 (857)
T ss_pred             hHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHH
Confidence            99999999999996689999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCcchhhhhhcccC
Q 043637          673 NELNPWAPFQFKITTNRFDR  692 (693)
Q Consensus       673 ~~~~p~~~~~~~~l~~~y~~  692 (693)
                      ++++|++++.|+.|+|+|+.
T Consensus       684 ~~l~p~~~~~y~ll~n~ya~  703 (857)
T PLN03077        684 FELDPNSVGYYILLCNLYAD  703 (857)
T ss_pred             HhhCCCCcchHHHHHHHHHH
Confidence            99999999999999999973



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 61.4 bits (147), Expect = 8e-10
 Identities = 31/223 (13%), Positives = 67/223 (30%), Gaps = 14/223 (6%)

Query: 470 QWETRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLE 529
           Q    P +     LL       SL+  +       +           A  +       L 
Sbjct: 85  QAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLP 144

Query: 530 YAIRVF-------KESSSLDVIICNSMILGFCHNERGREALEVFGLMKKEGIKPDHITFH 582
            A  +        ++   L + + N+++LG+      +E + V  ++K  G+ PD +++ 
Sbjct: 145 LAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYA 204

Query: 583 GILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYGYMKELEDFVNRMPF 642
             L     +      ++       + G+  Q      ++    R   +K +         
Sbjct: 205 AALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSL 264

Query: 643 NPTVP-------MLRKIFDKCRKNGYATLGEWAARRLNELNPW 678
            P +P       +LR ++ K  +  Y  L              
Sbjct: 265 PPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQ 307


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.74
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.67
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.63
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.61
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.56
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.52
3u4t_A272 TPR repeat-containing protein; structural genomics 99.51
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.45
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.44
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.43
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.42
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.41
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.4
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.39
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.39
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.37
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.34
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.34
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.33
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.33
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.33
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.32
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.27
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.22
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.2
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.2
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.17
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.16
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.13
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.13
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.1
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.07
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.03
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.01
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.01
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.98
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.95
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.93
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.93
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.91
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.91
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.9
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.9
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.88
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.83
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.83
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.82
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.82
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.78
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.78
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.78
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.74
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.74
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.74
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.72
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.72
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.71
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.71
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.67
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.65
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.63
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.63
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.63
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.59
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.58
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.58
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.57
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.56
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.56
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.53
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.52
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.5
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.49
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.48
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.44
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.44
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.43
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.43
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.42
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.41
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.41
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.4
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.4
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.4
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.39
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.37
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.37
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.37
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.35
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.35
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.3
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.3
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.27
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.27
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.27
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.26
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.25
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.23
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.22
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.2
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.19
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.19
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.19
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.18
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.14
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.13
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.11
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.08
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.08
3k9i_A117 BH0479 protein; putative protein binding protein, 98.04
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.03
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.02
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.0
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.0
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.99
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.93
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.92
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.9
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.89
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.84
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.83
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.83
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.81
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.76
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.73
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.71
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.7
3k9i_A117 BH0479 protein; putative protein binding protein, 97.7
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.65
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.65
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.65
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.47
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.45
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.43
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.37
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.36
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.33
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.28
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.24
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.24
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.23
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.22
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.22
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.08
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.92
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.9
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.81
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.63
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.46
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.23
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.12
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.02
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.84
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.81
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.69
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.4
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.29
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.18
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.17
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.91
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.02
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.94
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.44
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.83
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.8
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 92.59
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.59
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.25
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.01
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.0
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.96
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.9
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 91.73
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.32
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.85
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.95
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.92
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.72
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 88.28
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.45
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 86.35
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 86.3
2p58_C116 Putative type III secretion protein YSCG; type III 85.93
2uwj_G115 Type III export protein PSCG; virulence, chaperone 85.24
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 85.13
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.2
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 83.58
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 82.54
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.04
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 80.96
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.24
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=7.4e-41  Score=360.04  Aligned_cols=495  Identities=8%  Similarity=-0.067  Sum_probs=409.9

Q ss_pred             hhcCCCHHHHHHHHhccCCCCcccHHHHHHHHHhcCCchHHHHHHHHHHHCCCCCCHHhHHHHHHHhcCCCCcchhHHHH
Q 043637          188 YGKCMVMTDARRMFDDIQNKNAVSWNVIVRRYLVAGNGKEAVVMFFKMLREDIRPLNFTFANALFACSFLSSPYEGMQIH  267 (693)
Q Consensus       188 ~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~  267 (693)
                      +.+.|....+...+..++.+++..|+.++..+.+.|++++|+.+|++|..  ..|+..++..++.++...|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            34566677777778887778888899999999999999999999999985  5678888899999999999999999999


Q ss_pred             HHHHHhcCCCchHHHHHHHHHHHHcCChhHHHhhhcCCCCC-------------------CchhHHHHHHHHHhcCCHHH
Q 043637          268 GVIIKIDFEGDDVVLGSLTEMYVKCGRLEDARGLLDQPDER-------------------NIISWTSIVSGYAISGRIRE  328 (693)
Q Consensus       268 ~~~~~~g~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~-------------------~~~~~~~li~~~~~~g~~~~  328 (693)
                      +.+...  +++..+++.++.+|.+.|++++|.++|+++...                   +..+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            877543  678889999999999999999999999965443                   36789999999999999999


Q ss_pred             HHHHHhhCCC--CC-cccHHHHHHHHHhCCCHHHHH--HH-HHHHHHcCCCCCHhhHHHHHHHHhcccchhhHHHHHHHH
Q 043637          329 ARELFNEMPE--RN-VISWNAMLAGYTRSLLWKEAL--DF-VFLMRKTTKDIDQVTLGLILNVCAGLSEIKMGKEVHGFI  402 (693)
Q Consensus       329 A~~~~~~~~~--~~-~~~~~~l~~~~~~~~~~~~a~--~~-~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~  402 (693)
                      |.+.|+++.+  |+ ...+..+...+...+..+.+.  .+ +..+...+..+...+|..++..+.+.|++++|.++++.+
T Consensus       219 A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~  298 (597)
T 2xpi_A          219 AKECYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSI  298 (597)
T ss_dssp             HHHHHHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHh
Confidence            9999999876  32 334444444443333222221  11 455555555556667777788899999999999999998


Q ss_pred             HHhCCCCchhHHHHHHHHHHHcCChHHHHHHHHhhcC--CCChhhHHHHHHHHHhcCChHHHHHHHHHhhhCCCCCHHHH
Q 043637          403 HRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQ--RRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWETRPSKFTF  480 (693)
Q Consensus       403 ~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~--~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~p~~~~~  480 (693)
                      .+.  +++..+++.++.+|.+.|++++|...+.++..  ..+..+|+.++.++.+.|++++|.++++++....+.+..++
T Consensus       299 ~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~  376 (597)
T 2xpi_A          299 NGL--EKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTW  376 (597)
T ss_dssp             TTG--GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHH
T ss_pred             hcC--CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHH
Confidence            766  58899999999999999999999999998875  34778899999999999999999999999986667789999


Q ss_pred             HHHHHHhcccCChHHHHHHHHHHHHhCCCcchhHHHHHHHHHHhhCCHHHHHHHHhcCC---CCCHHHHHHHHHHHHhCC
Q 043637          481 ETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESS---SLDVIICNSMILGFCHNE  557 (693)
Q Consensus       481 ~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~---~~~~~~~~~l~~~~~~~g  557 (693)
                      ..++..|.+.|++++|.++|+++.+.... +..++..++.+|.+.|++++|.++|+++.   +.+..+|+.++.+|.+.|
T Consensus       377 ~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g  455 (597)
T 2xpi_A          377 LAVGIYYLCVNKISEARRYFSKSSTMDPQ-FGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLG  455 (597)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHhccHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcC
Confidence            99999999999999999999999986543 67799999999999999999999999865   568889999999999999


Q ss_pred             ChHHHHHHHHHHHHCCCCC-ChHHHHHHHHHHhccCcHHHHHHHHHHhHHhc---CCCCC--hhHHHHHHHHHHhcCChH
Q 043637          558 RGREALEVFGLMKKEGIKP-DHITFHGILLACIHEGNVKLALQFFDSMRCKY---GIIPQ--LEHYECMIKLYCRYGYMK  631 (693)
Q Consensus       558 ~~~~A~~~~~~m~~~g~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~---~~~p~--~~~~~~l~~~~~~~g~~~  631 (693)
                      ++++|.++|+++.+.  .| +..+|..++..|.+.|++++|.++|+++.+..   +..|+  ..+|..++.+|.+.|+++
T Consensus       456 ~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~  533 (597)
T 2xpi_A          456 NILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYD  533 (597)
T ss_dssp             CHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHH
T ss_pred             CHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHH
Confidence            999999999999984  44 57899999999999999999999999998632   66787  789999999999999999


Q ss_pred             HHHHHHHhCC--CCCCHHhHHHHHHHHHhcCCccHHHHHHHHHhhcCCCCCcchhhhhhccc
Q 043637          632 ELEDFVNRMP--FNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFD  691 (693)
Q Consensus       632 ~A~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~y~  691 (693)
                      +|+..++++.  .+.+...|..++..|...|++++|...++++++++|+++.++..|+++|.
T Consensus       534 ~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~  595 (597)
T 2xpi_A          534 AAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALE  595 (597)
T ss_dssp             HHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHh
Confidence            9999999885  45678899999999999999999999999999999999999999999986



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.58
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.44
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.15
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.09
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.07
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.06
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.99
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.96
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.79
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.77
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.64
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.57
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.57
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.48
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.46
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.46
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.44
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.27
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.23
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.13
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.08
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.04
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.04
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.01
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.98
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.93
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.92
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.85
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.77
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.77
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.76
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.6
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.59
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.58
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.58
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.5
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.48
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.25
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.06
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.88
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.87
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.39
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.39
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.3
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.03
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.69
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.51
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.08
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.16
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 86.07
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.06
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 84.19
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=2e-21  Score=193.81  Aligned_cols=367  Identities=10%  Similarity=-0.001  Sum_probs=265.7

Q ss_pred             HHHHhcCCHHHHHHHHhhCCC--C-CcccHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHhcccchhh
Q 043637          318 SGYAISGRIREARELFNEMPE--R-NVISWNAMLAGYTRSLLWKEALDFVFLMRKTTKDIDQVTLGLILNVCAGLSEIKM  394 (693)
Q Consensus       318 ~~~~~~g~~~~A~~~~~~~~~--~-~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~  394 (693)
                      ..+.+.|++++|.+.++++.+  | +...+..+...+.+.|++++|+..|++..+.. +-+...+..+...+...|++++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhccccc
Confidence            344445555566655555543  2 33455555666666666666666666665542 1134455555566666666666


Q ss_pred             HHHHHHHHHHhCCCCchhHHHHHHHHHHHcCChHHHHHHHHhhcC--CCChhhHHHHHHHHHhcCChHHHHHHHHHhhhC
Q 043637          395 GKEVHGFIHRNDYSSNIFVSNALLDMYRKCGNLRSARIWFYQMSQ--RRDKVSWNAVLTGYARRGQSEEAMTSFSEMQWE  472 (693)
Q Consensus       395 a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~--~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~  472 (693)
                      |...+....+... .+..............+....+.........  .................+....+...+......
T Consensus        86 A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (388)
T d1w3ba_          86 AIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIET  164 (388)
T ss_dssp             HHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHH
T ss_pred             ccccccccccccc-ccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhcc
Confidence            6666666655442 2222333333333333433333233222222  233444455555666677777777777776665


Q ss_pred             CCCCHHHHHHHHHHhcccCChHHHHHHHHHHHHhCCCcchhHHHHHHHHHHhhCCHHHHHHHHhcCC---CCCHHHHHHH
Q 043637          473 TRPSKFTFETLLAACANISSLEQGKQIHCFVIRNCYEINVVCRGALVEVYTKCCCLEYAIRVFKESS---SLDVIICNSM  549 (693)
Q Consensus       473 ~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~---~~~~~~~~~l  549 (693)
                      .+.+...+..+...+...|+++.|...++...+..+. +...+..+...+...|++++|...+++..   +.+...+..+
T Consensus       165 ~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l  243 (388)
T d1w3ba_         165 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL  243 (388)
T ss_dssp             CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred             CcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHH
Confidence            5666777788888888888999998888888876543 56677788888889999999988888765   5667788889


Q ss_pred             HHHHHhCCChHHHHHHHHHHHHCCCCCC-hHHHHHHHHHHhccCcHHHHHHHHHHhHHhcCCCCChhHHHHHHHHHHhcC
Q 043637          550 ILGFCHNERGREALEVFGLMKKEGIKPD-HITFHGILLACIHEGNVKLALQFFDSMRCKYGIIPQLEHYECMIKLYCRYG  628 (693)
Q Consensus       550 ~~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g  628 (693)
                      ...+.+.|++++|+..|++..+  +.|+ ..++..+...+...|++++|.+.++....  ..+.+...+..+..++.+.|
T Consensus       244 ~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~~~~l~~~~~~~~  319 (388)
T d1w3ba_         244 ACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALR--LCPTHADSLNNLANIKREQG  319 (388)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHHTTT
T ss_pred             HHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhc--cCCccchhhhHHHHHHHHCC
Confidence            9999999999999999999999  6775 57888899999999999999999999985  45667788899999999999


Q ss_pred             ChHHHHHHHHhCC--CCCCHHhHHHHHHHHHhcCCccHHHHHHHHHhhcCCCCCcchhhhhhccc
Q 043637          629 YMKELEDFVNRMP--FNPTVPMLRKIFDKCRKNGYATLGEWAARRLNELNPWAPFQFKITTNRFD  691 (693)
Q Consensus       629 ~~~~A~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~y~  691 (693)
                      ++++|+..+++..  .+.++..+..++..+...|++++|...++++++++|+++.++..||++|.
T Consensus       320 ~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~  384 (388)
T d1w3ba_         320 NIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLK  384 (388)
T ss_dssp             CHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Confidence            9999999999875  34567788899999999999999999999999999999999999999884



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure