Citrus Sinensis ID: 043643
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 634 | ||||||
| 147776143 | 686 | hypothetical protein VITISV_014218 [Viti | 0.992 | 0.916 | 0.636 | 0.0 | |
| 359495321 | 722 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.871 | 0.633 | 0.0 | |
| 224072363 | 587 | predicted protein [Populus trichocarpa] | 0.911 | 0.984 | 0.582 | 0.0 | |
| 224057976 | 595 | predicted protein [Populus trichocarpa] | 0.927 | 0.988 | 0.589 | 0.0 | |
| 302143246 | 630 | unnamed protein product [Vitis vinifera] | 0.810 | 0.815 | 0.574 | 0.0 | |
| 255587116 | 728 | protein binding protein, putative [Ricin | 0.943 | 0.821 | 0.453 | 1e-151 | |
| 225449026 | 710 | PREDICTED: uncharacterized protein LOC10 | 0.921 | 0.822 | 0.449 | 1e-150 | |
| 147815707 | 715 | hypothetical protein VITISV_016246 [Viti | 0.922 | 0.818 | 0.450 | 1e-149 | |
| 224113057 | 714 | predicted protein [Populus trichocarpa] | 0.919 | 0.816 | 0.453 | 1e-149 | |
| 224097862 | 713 | predicted protein [Populus trichocarpa] | 0.927 | 0.824 | 0.452 | 1e-148 |
| >gi|147776143|emb|CAN69721.1| hypothetical protein VITISV_014218 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 788 bits (2035), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 417/655 (63%), Positives = 503/655 (76%), Gaps = 26/655 (3%)
Query: 1 KTCPICLGSLRRGQGVAIFTAECSHSFHFCCIAANVQHGNRICPICRCEWKDVPFQAPGS 60
KTC ICLG+L+ GQG AIFTAECSHSFHF CIA++V+HGN++CPICR +W+DVPFQAP +
Sbjct: 28 KTCAICLGNLKTGQGQAIFTAECSHSFHFNCIASSVRHGNQLCPICRSKWRDVPFQAPAN 87
Query: 61 VIDARRNNMARARVSPFNAAPEDASAPGARRNVPTTFQLPAEPEQFTDDEQLSVNSIGPA 120
+ D + N M +ARVSPF+ PED R P + Q P EP F+DDE L VNS
Sbjct: 88 IGDPQCNGMGQARVSPFHPPPEDFHGQTPRNLQPXSPQSP-EPRHFSDDEPLVVNSAEST 146
Query: 121 SP------SRAQALAVKAFPEFGAVAAAECPPKFAVLLRVCAPSLPNDA---DRAPIDLV 171
P SR Q + VKA PE+ A++A+E FAVL+ + AP+L +DA DRAPIDLV
Sbjct: 147 DPTSLVSLSRPQLVTVKALPEWPAISASESFRTFAVLVGIKAPALLDDAHLLDRAPIDLV 206
Query: 172 TVLDVSGSMS-SKLPLLKRAVHFIIQNLGSADRLSIVIFSSVARRIFPLQRMTDSGRENA 230
VLDVSGSM+ SKL LLKRAV F+IQNLG +DRLSIV FSS ARRIFPL+RM+D+GRE A
Sbjct: 207 AVLDVSGSMAGSKLSLLKRAVCFLIQNLGPSDRLSIVSFSSTARRIFPLRRMSDNGREAA 266
Query: 231 IRAINTLSSNGGTNIVEGLKKGARVLEERRERSPVASIILLSDGQDTHNV--LRNSYTQD 288
AIN+L S+GGTNIVEGLKKG RVLEER E++PVASIILLSDG+DT+N + T
Sbjct: 267 GLAINSLXSSGGTNIVEGLKKGVRVLEERSEQNPVASIILLSDGKDTYNCDNVNRRQTSH 326
Query: 289 EASSIPSNELAYLNLLPSSICLSKREAG----QPTFPVHTFGFGLEHDSEAMHAIADASG 344
ASS P L YLNLLP+SIC RE+G Q PVHTFGFG +HDS AMHAI+D SG
Sbjct: 327 CASSNPRQVLEYLNLLPASICPRNRESGDEGRQAIIPVHTFGFGSDHDSTAMHAISDESG 386
Query: 345 GTFSFIETLSILQDAFARCIGGLLSVVSQDVKLTIRSKSAGVRIGSIPSGRYNSEVLDEG 404
GTFSFIE+++ +QDAFA CIGGLLSVV+Q+++LT++S S GV I SIPSG+Y SE+ D+G
Sbjct: 387 GTFSFIESVAXVQDAFAMCIGGLLSVVAQELRLTVKSVSPGVHIESIPSGKYLSEICDQG 446
Query: 405 QQAVIDIGNLYADEEKEFMVYLSIP-VSSAEGEQRPECTALLDVFCTHKDSASMEIHQVE 463
QQ VID+G+LYA+E KEF++YL++P +SSAEGE+R + T LLDV C++KDS S E+ QVE
Sbjct: 447 QQGVIDVGDLYAEEGKEFLIYLTVPELSSAEGEERVKRTTLLDVMCSYKDSVSKEVVQVE 506
Query: 464 GEKVEIRRPEVLSTADKKVNLQVDRQRSRLLVAETIADAQRMAEVGDLESAQALLAERRS 523
E+VEIRRPEVLS D V L+VDRQR+RL VAE IA+AQRMAE G+LE A+A+LA RRS
Sbjct: 507 CERVEIRRPEVLSPMDMIVCLEVDRQRNRLWVAEGIAEAQRMAETGNLEGAKAVLAHRRS 566
Query: 524 GLLSSAAAQAGDVLCNWLEAELREIRERMASMDLYERTGRAYLLSGLSSHSWQRATTRGD 583
LLSSA+AQAGD LCNWLE+ELREIR+RMASM+LYE+TGRAY+LSGLSSHSWQRATTRGD
Sbjct: 567 TLLSSASAQAGDGLCNWLESELREIRQRMASMELYEQTGRAYVLSGLSSHSWQRATTRGD 626
Query: 584 -TTQILATN---GDRGHSGSIDSTRSYETPWMTTMVTRSQTLNFTSGEQQSQANK 634
TTQI + GD SG I YETP M +MVT+SQTLN T +Q + NK
Sbjct: 627 STTQITLLSRECGDSSTSGVI----GYETPSMVSMVTKSQTLNLTPAQQSRRLNK 677
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359495321|ref|XP_002271188.2| PREDICTED: uncharacterized protein LOC100266793 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224072363|ref|XP_002303700.1| predicted protein [Populus trichocarpa] gi|222841132|gb|EEE78679.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224057976|ref|XP_002299418.1| predicted protein [Populus trichocarpa] gi|222846676|gb|EEE84223.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|302143246|emb|CBI20541.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255587116|ref|XP_002534143.1| protein binding protein, putative [Ricinus communis] gi|223525789|gb|EEF28236.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225449026|ref|XP_002273050.1| PREDICTED: uncharacterized protein LOC100253096 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147815707|emb|CAN70517.1| hypothetical protein VITISV_016246 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224113057|ref|XP_002316375.1| predicted protein [Populus trichocarpa] gi|222865415|gb|EEF02546.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224097862|ref|XP_002311085.1| predicted protein [Populus trichocarpa] gi|222850905|gb|EEE88452.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 634 | ||||||
| TAIR|locus:2102445 | 675 | AT3G54780 "AT3G54780" [Arabido | 0.531 | 0.499 | 0.441 | 1e-124 | |
| TAIR|locus:2064945 | 692 | AT2G38970 "AT2G38970" [Arabido | 0.763 | 0.699 | 0.419 | 5.2e-97 | |
| TAIR|locus:2175796 | 704 | AT5G60710 "AT5G60710" [Arabido | 0.651 | 0.586 | 0.477 | 8.4e-97 | |
| TAIR|locus:2205160 | 641 | AT1G08050 "AT1G08050" [Arabido | 0.484 | 0.478 | 0.415 | 1.2e-77 | |
| TAIR|locus:504954897 | 740 | AT5G49665 "AT5G49665" [Arabido | 0.282 | 0.241 | 0.405 | 2.8e-54 | |
| TAIR|locus:2121008 | 739 | EDA40 "AT4G37890" [Arabidopsis | 0.328 | 0.281 | 0.342 | 1.3e-42 | |
| TAIR|locus:2065999 | 683 | WAVH1 "AT2G22680" [Arabidopsis | 0.436 | 0.405 | 0.344 | 5.8e-42 | |
| TAIR|locus:504954891 | 717 | WAVH2 "AT5G65683" [Arabidopsis | 0.406 | 0.359 | 0.332 | 2.4e-33 | |
| UNIPROTKB|Q8E999 | 451 | SO_4385 "von Willebrand factor | 0.264 | 0.372 | 0.252 | 2.7e-16 | |
| TIGR_CMR|SO_4385 | 451 | SO_4385 "von Willebrand factor | 0.264 | 0.372 | 0.252 | 2.7e-16 |
| TAIR|locus:2102445 AT3G54780 "AT3G54780" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 658 (236.7 bits), Expect = 1.0e-124, Sum P(2) = 1.0e-124
Identities = 158/358 (44%), Positives = 217/358 (60%)
Query: 1 KTCPICLGSLRRGQGVAIFTAECSHSFHFCCIAANVQHGNRICPICRCEWKDVPFQAPGS 60
KTC ICL ++ G G AIFTAECSH FHF CIA+NV+HGN++CP+CR +WK++P Q P
Sbjct: 72 KTCSICLNKMKEGCGHAIFTAECSHMFHFHCIASNVKHGNQVCPVCRAKWKEIPIQKPSL 131
Query: 61 VIDA----RRNNMARARVSPFNAAPEDASAPGARRNVPTTFQLPAE-PEQFTDDEQLSVN 115
+ R NN A +S F P A P TF EQ D + V
Sbjct: 132 DLPYYPFDRCNN--DAAISLFRCLPPSQRAITQGHPEPATFDDDERLEEQIVFDGETEV- 188
Query: 116 SIGPASPSRAQALAVKAFPEFGAVAAAECPPKFAVLLRVCAPSLPNDAD--RAPIDLVTV 173
+ + + + +K +PE AV ++ F VL+ + A + + RAPIDLVTV
Sbjct: 189 -LKKENRDYVRMMDMKVYPEVSAVPQSKSCENFDVLVHLKAVTGDQISQYRRAPIDLVTV 247
Query: 174 LDVSGSMS-SKLPLLKRAVHFIIQNLGSADRLSIVIFSSVARRIFPLQRMTDSGRENAIR 232
LD+SGSM +KL LLKRA+ F+IQNLGS+DRLS++ FSS ARR+FPL RM+D+GR+ A++
Sbjct: 248 LDISGSMGGTKLALLKRAMGFVIQNLGSSDRLSVIAFSSTARRLFPLTRMSDAGRQLALQ 307
Query: 233 AINTLSSNGGTNIVEGLKKGARVLEERRERSPVASIILLSDGQDTH--NVLRNSYTQDEA 290
A+N+L +NGGTNIV+GL+KGA+V+E+R ER+ VASIILLSDG+DT+ N SY +
Sbjct: 308 AVNSLVANGGTNIVDGLRKGAKVMEDRLERNSVASIILLSDGRDTYTTNHPDPSY-KVML 366
Query: 291 SSIPSNELAYLNLLPSSICLSKREAGQPTFPVHTFGFGLEHDSEAMHAIADASGGTFS 348
I + + + +S+ S E TF +F +E +S A+A GG S
Sbjct: 367 PQISVHSFGFGSDHDASVMHSVSEVSGGTF---SF---IESESVIQDALAQCIGGLLS 418
|
|
| TAIR|locus:2064945 AT2G38970 "AT2G38970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175796 AT5G60710 "AT5G60710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205160 AT1G08050 "AT1G08050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954897 AT5G49665 "AT5G49665" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121008 EDA40 "AT4G37890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065999 WAVH1 "AT2G22680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954891 WAVH2 "AT5G65683" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8E999 SO_4385 "von Willebrand factor type A domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4385 SO_4385 "von Willebrand factor type A domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 634 | |||
| cd01466 | 155 | cd01466, vWA_C3HC4_type, VWA C3HC4-type: Von Wille | 1e-47 | |
| cd01465 | 170 | cd01465, vWA_subgroup, VWA subgroup: Von Willebran | 3e-26 | |
| cd00198 | 161 | cd00198, vWFA, Von Willebrand factor type A (vWA) | 3e-21 | |
| cd01461 | 171 | cd01461, vWA_interalpha_trypsin_inhibitor, vWA_int | 2e-20 | |
| pfam00092 | 178 | pfam00092, VWA, von Willebrand factor type A domai | 6e-20 | |
| smart00327 | 175 | smart00327, VWA, von Willebrand factor (vWF) type | 7e-19 | |
| pfam13768 | 156 | pfam13768, VWA_3, von Willebrand factor type A dom | 2e-16 | |
| pfam13519 | 172 | pfam13519, VWA_2, von Willebrand factor type A dom | 4e-13 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 1e-10 | |
| cd01450 | 161 | cd01450, vWFA_subfamily_ECM, Von Willebrand factor | 1e-10 | |
| TIGR00868 | 863 | TIGR00868, hCaCC, calcium-activated chloride chann | 2e-09 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 6e-09 | |
| TIGR03788 | 596 | TIGR03788, marine_srt_targ, marine proteobacterial | 1e-08 | |
| cd01456 | 206 | cd01456, vWA_ywmD_type, VWA ywmD type:Von Willebra | 3e-08 | |
| cd01474 | 185 | cd01474, vWA_ATR, ATR (Anthrax Toxin Receptor): An | 2e-07 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 2e-07 | |
| COG2304 | 399 | COG2304, COG2304, Uncharacterized protein containi | 3e-07 | |
| cd01463 | 190 | cd01463, vWA_VGCC_like, VWA Voltage gated Calcium | 1e-06 | |
| pfam05762 | 223 | pfam05762, VWA_CoxE, VWA domain containing CoxE-li | 5e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 6e-06 | |
| TIGR03436 | 296 | TIGR03436, acidobact_VWFA, VWFA-related Acidobacte | 1e-05 | |
| cd01462 | 152 | cd01462, VWA_YIEM_type, VWA YIEM type: Von Willebr | 1e-05 | |
| cd01471 | 186 | cd01471, vWA_micronemal_protein, Micronemal protei | 2e-05 | |
| cd01472 | 164 | cd01472, vWA_collagen, von Willebrand factor (vWF) | 3e-05 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-05 | |
| cd01467 | 180 | cd01467, vWA_BatA_type, VWA BatA type: Von Willebr | 3e-05 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 4e-05 | |
| cd01476 | 163 | cd01476, VWA_integrin_invertebrates, VWA_integrin | 5e-05 | |
| COG1240 | 261 | COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme | 8e-05 | |
| cd01464 | 176 | cd01464, vWA_subfamily, VWA subfamily: Von Willebr | 1e-04 | |
| COG2425 | 437 | COG2425, COG2425, Uncharacterized protein containi | 0.001 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 0.003 |
| >gnl|CDD|238743 cd01466, vWA_C3HC4_type, VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
Score = 164 bits (416), Expect = 1e-47
Identities = 82/185 (44%), Positives = 111/185 (60%), Gaps = 31/185 (16%)
Query: 168 IDLVTVLDVSGSMSS-KLPLLKRAVHFIIQNLGSADRLSIVIFSSVARRIFPLQRMTDSG 226
+DLV VLDVSGSM+ KL L+K A+ F+I +LG ADRLSIV FS+ A+R+ PL+RMT G
Sbjct: 1 VDLVAVLDVSGSMAGDKLQLVKHALRFVISSLGDADRLSIVTFSTSAKRLSPLRRMTAKG 60
Query: 227 RENAIRAINTLSSNGGTNIVEGLKKGARVLEERRERSPVASIILLSDGQDTHNVLRNSYT 286
+ +A R ++ L + GGTN+V GLKK +VL +RR+++PVASI+LLSDGQD H
Sbjct: 61 KRSAKRVVDGLQAGGGTNVVGGLKKALKVLGDRRQKNPVASIMLLSDGQDNHGA------ 114
Query: 287 QDEASSIPSNELAYLNLLPSSICLSKREAGQPTFPVHTFGFGLEHDSEAMHAIADASGGT 346
A P+HTFG G HD + IA+ +GGT
Sbjct: 115 ------------------------VVLRADNAPIPIHTFGLGASHDPALLAFIAEITGGT 150
Query: 347 FSFIE 351
FS+++
Sbjct: 151 FSYVK 155
|
Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Membes of this subgroup belong to Zinc-finger family as they are found fused to RING finger domains. The MIDAS motif is not conserved in all the members of this family. The function of vWA domains however is not known. Length = 155 |
| >gnl|CDD|238742 cd01465, vWA_subgroup, VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|238119 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|238738 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) | Back alignment and domain information |
|---|
| >gnl|CDD|215711 pfam00092, VWA, von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >gnl|CDD|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain | Back alignment and domain information |
|---|
| >gnl|CDD|222367 pfam13768, VWA_3, von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >gnl|CDD|222192 pfam13519, VWA_2, von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|238727 cd01450, vWFA_subfamily_ECM, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|129946 TIGR00868, hCaCC, calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|234353 TIGR03788, marine_srt_targ, marine proteobacterial sortase target protein | Back alignment and domain information |
|---|
| >gnl|CDD|238733 cd01456, vWA_ywmD_type, VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|238751 cd01474, vWA_ATR, ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|225187 COG2304, COG2304, Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238740 cd01463, vWA_VGCC_like, VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta | Back alignment and domain information |
|---|
| >gnl|CDD|147747 pfam05762, VWA_CoxE, VWA domain containing CoxE-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|234208 TIGR03436, acidobact_VWFA, VWFA-related Acidobacterial domain | Back alignment and domain information |
|---|
| >gnl|CDD|238739 cd01462, VWA_YIEM_type, VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|238748 cd01471, vWA_micronemal_protein, Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell | Back alignment and domain information |
|---|
| >gnl|CDD|238749 cd01472, vWA_collagen, von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238744 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|238753 cd01476, VWA_integrin_invertebrates, VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions | Back alignment and domain information |
|---|
| >gnl|CDD|224161 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238741 cd01464, vWA_subfamily, VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|225281 COG2425, COG2425, Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 634 | |||
| TIGR03788 | 596 | marine_srt_targ marine proteobacterial sortase tar | 99.93 | |
| cd01466 | 155 | vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact | 99.93 | |
| cd01465 | 170 | vWA_subgroup VWA subgroup: Von Willebrand factor t | 99.92 | |
| cd01463 | 190 | vWA_VGCC_like VWA Voltage gated Calcium channel li | 99.92 | |
| cd01470 | 198 | vWA_complement_factors Complement factors B and C2 | 99.91 | |
| PRK13685 | 326 | hypothetical protein; Provisional | 99.9 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 99.9 | |
| cd01461 | 171 | vWA_interalpha_trypsin_inhibitor vWA_interalpha tr | 99.9 | |
| PF13768 | 155 | VWA_3: von Willebrand factor type A domain | 99.89 | |
| cd01456 | 206 | vWA_ywmD_type VWA ywmD type:Von Willebrand factor | 99.88 | |
| cd01451 | 178 | vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch | 99.87 | |
| cd01480 | 186 | vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI | 99.86 | |
| TIGR03436 | 296 | acidobact_VWFA VWFA-related Acidobacterial domain. | 99.86 | |
| cd01453 | 183 | vWA_transcription_factor_IIH_type Transcription fa | 99.86 | |
| cd01474 | 185 | vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi | 99.86 | |
| cd01467 | 180 | vWA_BatA_type VWA BatA type: Von Willebrand factor | 99.84 | |
| cd01472 | 164 | vWA_collagen von Willebrand factor (vWF) type A do | 99.83 | |
| cd01464 | 176 | vWA_subfamily VWA subfamily: Von Willebrand factor | 99.82 | |
| PF13519 | 172 | VWA_2: von Willebrand factor type A domain; PDB: 3 | 99.82 | |
| cd01477 | 193 | vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand | 99.81 | |
| cd01471 | 186 | vWA_micronemal_protein Micronemal proteins: The To | 99.81 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 99.8 | |
| cd01469 | 177 | vWA_integrins_alpha_subunit Integrins are a class | 99.79 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 99.78 | |
| cd01473 | 192 | vWA_CTRP CTRP for CS protein-TRAP-related protein: | 99.77 | |
| PTZ00441 | 576 | sporozoite surface protein 2 (SSP2); Provisional | 99.76 | |
| cd01482 | 164 | vWA_collagen_alphaI-XII-like Collagen: The extrace | 99.76 | |
| COG1240 | 261 | ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis | 99.75 | |
| cd01476 | 163 | VWA_integrin_invertebrates VWA_integrin (invertebr | 99.74 | |
| cd01455 | 191 | vWA_F11C1-5a_type Von Willebrand factor type A (vW | 99.74 | |
| cd01450 | 161 | vWFA_subfamily_ECM Von Willebrand factor type A (v | 99.73 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 99.73 | |
| PF14624 | 80 | Vwaint: VWA / Hh protein intein-like | 99.72 | |
| cd01454 | 174 | vWA_norD_type norD type: Denitrifying bacteria con | 99.71 | |
| PF00092 | 178 | VWA: von Willebrand factor type A domain; InterPro | 99.68 | |
| cd01462 | 152 | VWA_YIEM_type VWA YIEM type: Von Willebrand factor | 99.68 | |
| smart00327 | 177 | VWA von Willebrand factor (vWF) type A domain. VWA | 99.68 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 99.64 | |
| cd01481 | 165 | vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V | 99.63 | |
| cd00198 | 161 | vWFA Von Willebrand factor type A (vWA) domain was | 99.59 | |
| PLN00162 | 761 | transport protein sec23; Provisional | 99.57 | |
| COG4245 | 207 | TerY Uncharacterized protein encoded in toxicity p | 99.54 | |
| cd01452 | 187 | VWA_26S_proteasome_subunit 26S proteasome plays a | 99.53 | |
| KOG1985 | 887 | consensus Vesicle coat complex COPII, subunit SEC2 | 99.53 | |
| cd01457 | 199 | vWA_ORF176_type VWA ORF176 type: Von Willebrand fa | 99.51 | |
| PTZ00395 | 1560 | Sec24-related protein; Provisional | 99.5 | |
| KOG2353 | 1104 | consensus L-type voltage-dependent Ca2+ channel, a | 99.42 | |
| KOG1984 | 1007 | consensus Vesicle coat complex COPII, subunit SFB3 | 99.35 | |
| PF10138 | 200 | vWA-TerF-like: vWA found in TerF C terminus ; Inte | 99.35 | |
| cd01460 | 266 | vWA_midasin VWA_Midasin: Midasin is a member of th | 99.34 | |
| cd01458 | 218 | vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter | 99.25 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.17 | |
| COG5028 | 861 | Vesicle coat complex COPII, subunit SEC24/subunit | 99.13 | |
| cd01479 | 244 | Sec24-like Sec24-like: Protein and membrane traffi | 99.07 | |
| PRK10997 | 487 | yieM hypothetical protein; Provisional | 99.06 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.02 | |
| cd01468 | 239 | trunk_domain trunk domain. COPII-coated vesicles c | 99.02 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.0 | |
| COG2425 | 437 | Uncharacterized protein containing a von Willebran | 98.97 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.95 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.91 | |
| PF04811 | 243 | Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I | 98.9 | |
| cd01478 | 267 | Sec23-like Sec23-like: Protein and membrane traffi | 98.88 | |
| COG2304 | 399 | Uncharacterized protein containing a von Willebran | 98.83 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 98.79 | |
| PF04056 | 193 | Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro | 98.78 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.77 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.73 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.72 | |
| PF05762 | 222 | VWA_CoxE: VWA domain containing CoxE-like protein; | 98.71 | |
| KOG1986 | 745 | consensus Vesicle coat complex COPII, subunit SEC2 | 98.7 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.7 | |
| KOG3768 | 888 | consensus DEAD box RNA helicase [General function | 98.68 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.65 | |
| PF11775 | 219 | CobT_C: Cobalamin biosynthesis protein CobT VWA do | 98.64 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.57 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.55 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.55 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.53 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.52 | |
| COG4867 | 652 | Uncharacterized protein with a von Willebrand fact | 98.52 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.52 | |
| PF06707 | 205 | DUF1194: Protein of unknown function (DUF1194); In | 98.44 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.4 | |
| COG4548 | 637 | NorD Nitric oxide reductase activation protein [In | 98.4 | |
| PF09967 | 126 | DUF2201: VWA-like domain (DUF2201); InterPro: IPR0 | 98.37 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.36 | |
| KOG2807 | 378 | consensus RNA polymerase II transcription initiati | 98.36 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.35 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.33 | |
| TIGR01651 | 600 | CobT cobaltochelatase, CobT subunit. This model de | 98.3 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.27 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.27 | |
| smart00187 | 423 | INB Integrin beta subunits (N-terminal portion of | 98.26 | |
| KOG2884 | 259 | consensus 26S proteasome regulatory complex, subun | 98.24 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.23 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.19 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.13 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.1 | |
| cd01459 | 254 | vWA_copine_like VWA Copine: Copines are phospholip | 98.07 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.06 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.02 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.99 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 97.86 | |
| PRK05325 | 401 | hypothetical protein; Provisional | 97.85 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.84 | |
| TIGR00627 | 279 | tfb4 transcription factor tfb4. This family is bas | 97.77 | |
| PF03731 | 224 | Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte | 97.69 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.67 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.67 | |
| PF00362 | 426 | Integrin_beta: Integrin, beta chain; InterPro: IPR | 97.65 | |
| PF04285 | 421 | DUF444: Protein of unknown function (DUF444); Inte | 97.63 | |
| TIGR02877 | 371 | spore_yhbH sporulation protein YhbH. This protein | 97.57 | |
| COG3552 | 395 | CoxE Protein containing von Willebrand factor type | 97.51 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.49 | |
| COG5148 | 243 | RPN10 26S proteasome regulatory complex, subunit R | 97.43 | |
| PF12034 | 183 | DUF3520: Domain of unknown function (DUF3520); Int | 97.42 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.39 | |
| PF03850 | 276 | Tfb4: Transcription factor Tfb4; InterPro: IPR0046 | 97.39 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.39 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.36 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.32 | |
| PF11443 | 534 | DUF2828: Domain of unknown function (DUF2828); Int | 97.28 | |
| COG5242 | 296 | TFB4 RNA polymerase II transcription initiation/nu | 97.26 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.21 | |
| TIGR00578 | 584 | ku70 ATP-dependent DNA helicase ii, 70 kDa subunit | 97.19 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.19 | |
| COG4547 | 620 | CobT Cobalamin biosynthesis protein CobT (nicotina | 97.16 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.0 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 96.83 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.74 | |
| KOG1327 | 529 | consensus Copine [Signal transduction mechanisms] | 96.67 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 96.64 | |
| COG5047 | 755 | SEC23 Vesicle coat complex COPII, subunit SEC23 [I | 96.64 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.62 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.55 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.52 | |
| PF11265 | 226 | Med25_VWA: Mediator complex subunit 25 von Willebr | 96.51 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.48 | |
| PF07002 | 146 | Copine: Copine; InterPro: IPR010734 This represent | 96.45 | |
| COG2718 | 423 | Uncharacterized conserved protein [Function unknow | 96.39 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.32 | |
| COG5151 | 421 | SSL1 RNA polymerase II transcription initiation/nu | 96.31 | |
| KOG2487 | 314 | consensus RNA polymerase II transcription initiati | 96.14 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.95 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.92 | |
| PF08033 | 96 | Sec23_BS: Sec23/Sec24 beta-sandwich domain; InterP | 95.89 | |
| COG3864 | 396 | Uncharacterized protein conserved in bacteria [Fun | 95.87 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 95.8 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.47 | |
| KOG1226 | 783 | consensus Integrin beta subunit (N-terminal portio | 95.3 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.11 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 94.79 | |
| PHA03096 | 284 | p28-like protein; Provisional | 94.57 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 94.18 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.14 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 93.9 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 93.8 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 93.62 | |
| PHA02862 | 156 | 5L protein; Provisional | 93.48 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 93.47 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 93.41 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.2 | |
| COG1721 | 416 | Uncharacterized conserved protein (some members co | 93.12 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 92.92 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 92.91 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 92.81 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 92.75 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.57 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 92.13 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 92.01 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 91.88 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 91.87 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 91.72 | |
| KOG4465 | 598 | consensus Uncharacterized conserved protein [Funct | 91.15 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.09 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 89.88 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 89.71 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 88.92 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.62 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 87.86 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 86.84 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.84 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 86.71 | |
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 86.03 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.79 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 84.51 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 82.5 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 82.0 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.82 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.74 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 80.5 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.23 |
| >TIGR03788 marine_srt_targ marine proteobacterial sortase target protein | Back alignment and domain information |
|---|
Probab=99.93 E-value=2.9e-24 Score=244.15 Aligned_cols=232 Identities=25% Similarity=0.332 Sum_probs=187.2
Q ss_pred eEEEEEEeCCCCCCCCCCCCceEEEEEeCCCCCCc-cHHHHHHHHHHHHHhcCCCCeEEEEEeCCCcEEEEcCc-ccCHH
Q 043643 148 FAVLLRVCAPSLPNDADRAPIDLVTVLDVSGSMSS-KLPLLKRAVHFIIQNLGSADRLSIVIFSSVARRIFPLQ-RMTDS 225 (634)
Q Consensus 148 ~~v~v~~~ap~~~~~~~r~p~dlv~VlD~SgSM~g-kl~~~K~al~~li~~L~~~drvsIV~Fs~~a~~~~pl~-~~t~~ 225 (634)
.++++.+.+|.......+.|.+++||||+||||.| +++.+|.++..++..|.++|+|+||.|++.+..++|.. ..+..
T Consensus 252 ~y~~~~~~pp~~~~~~~~~p~~vvfvlD~SgSM~g~~i~~ak~al~~~l~~L~~~d~~~ii~F~~~~~~~~~~~~~~~~~ 331 (596)
T TIGR03788 252 RYGLAMVMPPTEAAVAQVLPRELVFVIDTSGSMAGESIEQAKSALLLALDQLRPGDRFNIIQFDSDVTLLFPVPVPATAH 331 (596)
T ss_pred cEEEEEEeCCCccccccCCCceEEEEEECCCCCCCccHHHHHHHHHHHHHhCCCCCEEEEEEECCcceEeccccccCCHH
Confidence 34566676665334557888999999999999999 99999999999999999999999999999999988753 56677
Q ss_pred HHHHHHHHHhcCCCCCCCcHHHHHHHHHHHHHhhccCCCCcEEEEEeCCCCCCCCCCCcccccccCCCCCCHHHHHhhch
Q 043643 226 GRENAIRAINTLSSNGGTNIVEGLKKGARVLEERRERSPVASIILLSDGQDTHNVLRNSYTQDEASSIPSNELAYLNLLP 305 (634)
Q Consensus 226 ~~~~~~~~I~~l~~~GgT~i~~aL~~A~~~l~~~~~~~~~~~IILlTDG~~~~g~~~~~~~~~~~~~~~~~~~~~~~lv~ 305 (634)
+++.+..+|+.+.++|||+++.||..|++... ....+..+.|||||||..+ +...+.+.+.
T Consensus 332 ~~~~a~~~i~~l~a~GgT~l~~aL~~a~~~~~-~~~~~~~~~iillTDG~~~------------------~~~~~~~~~~ 392 (596)
T TIGR03788 332 NLARARQFVAGLQADGGTEMAGALSAALRDDG-PESSGALRQVVFLTDGAVG------------------NEDALFQLIR 392 (596)
T ss_pred HHHHHHHHHhhCCCCCCccHHHHHHHHHHhhc-ccCCCceeEEEEEeCCCCC------------------CHHHHHHHHH
Confidence 88899999999999999999999999998742 2223556789999999753 1223333322
Q ss_pred hhhhccccccCCCCeeEEEEEccCCCChHHHHHHHhhcCCeEEEcCChhhHHHHHHHHhhccccceeeeeEEEEEecCCC
Q 043643 306 SSICLSKREAGQPTFPVHTFGFGLEHDSEAMHAIADASGGTFSFIETLSILQDAFARCIGGLLSVVSQDVKLTIRSKSAG 385 (634)
Q Consensus 306 ~~i~~~~~~~~~~~i~I~t~G~G~~~d~~~L~~iA~~tgG~~~~i~~~~~l~~~f~~~l~~l~s~va~~~~l~v~~~~~~ 385 (634)
. ...+++||+||||.+.|..+|+.||+.++|.|+++.+.+++...+.+.+..+.+++.+++++.+..
T Consensus 393 ----~-----~~~~~ri~tvGiG~~~n~~lL~~lA~~g~G~~~~i~~~~~~~~~~~~~l~~~~~p~l~~v~v~~~~---- 459 (596)
T TIGR03788 393 ----T-----KLGDSRLFTVGIGSAPNSYFMRKAAQFGRGSFTFIGSTDEVQRKMSQLFAKLEQPALTDIALTFDN---- 459 (596)
T ss_pred ----H-----hcCCceEEEEEeCCCcCHHHHHHHHHcCCCEEEECCCHHHHHHHHHHHHHhhcCeEEEEEEEEEcC----
Confidence 1 234689999999999999999999999999999999999999999999999999999999988752
Q ss_pred eEEEEecCCCCCcccccCCceeEEEcCCccCCcEEEEEEEE
Q 043643 386 VRIGSIPSGRYNSEVLDEGQQAVIDIGNLYADEEKEFMVYL 426 (634)
Q Consensus 386 v~i~~v~~~~~~~~~~~~~~~~~i~lg~l~~~e~r~~lv~l 426 (634)
..+..+ ..-.+++||.|++..+..++
T Consensus 460 ~~~~~v---------------~P~~~p~L~~g~~l~v~g~~ 485 (596)
T TIGR03788 460 GNAADV---------------YPSPIPDLYRGEPLQIAIKL 485 (596)
T ss_pred Ccccee---------------ccCCCccccCCCEEEEEEEe
Confidence 111112 22347899999987777664
|
Members of this protein family are restricted to the Proteobacteria. Each contains a C-terminal sortase-recognition motif, transmembrane domain, and basic residues cluster at the the C-terminus, and is encoded adjacent to a sortase gene. This protein is frequently the only sortase target in its genome, which is as unusual its occurrence in Gram-negative rather than Gram-positive genomes. Many bacteria with this system are marine. In addition to the LPXTG signal, members carry a vault protein inter-alpha-trypsin inhibitor domain (pfam08487) and a von Willebrand factor type A domain (pfam00092). |
| >cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta | Back alignment and domain information |
|---|
| >cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation | Back alignment and domain information |
|---|
| >PRK13685 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) | Back alignment and domain information |
|---|
| >PF13768 VWA_3: von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) | Back alignment and domain information |
|---|
| >cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain | Back alignment and domain information |
|---|
| >cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme | Back alignment and domain information |
|---|
| >cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax | Back alignment and domain information |
|---|
| >cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins | Back alignment and domain information |
|---|
| >cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A | Back alignment and domain information |
|---|
| >cd01477 vWA_F09G8-8_type VWA F09G8 | Back alignment and domain information |
|---|
| >cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology | Back alignment and domain information |
|---|
| >PTZ00441 sporozoite surface protein 2 (SSP2); Provisional | Back alignment and domain information |
|---|
| >cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions | Back alignment and domain information |
|---|
| >cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PF14624 Vwaint: VWA / Hh protein intein-like | Back alignment and domain information |
|---|
| >cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases | Back alignment and domain information |
|---|
| >PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma | Back alignment and domain information |
|---|
| >cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >smart00327 VWA von Willebrand factor (vWF) type A domain | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >PLN00162 transport protein sec23; Provisional | Back alignment and domain information |
|---|
| >COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins | Back alignment and domain information |
|---|
| >KOG1985 consensus Vesicle coat complex COPII, subunit SEC24/subunit SFB2 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >PTZ00395 Sec24-related protein; Provisional | Back alignment and domain information |
|---|
| >KOG2353 consensus L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts | Back alignment and domain information |
|---|
| >cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family | Back alignment and domain information |
|---|
| >cd01458 vWA_ku Ku70/Ku80 N-terminal domain | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles | Back alignment and domain information |
|---|
| >PRK10997 yieM hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >cd01468 trunk_domain trunk domain | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] | Back alignment and domain information |
|---|
| >cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles | Back alignment and domain information |
|---|
| >COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown | Back alignment and domain information |
|---|
| >KOG1986 consensus Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG3768 consensus DEAD box RNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF11775 CobT_C: Cobalamin biosynthesis protein CobT VWA domain | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >TIGR01651 CobT cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) | Back alignment and domain information |
|---|
| >KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00627 tfb4 transcription factor tfb4 | Back alignment and domain information |
|---|
| >PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF00362 Integrin_beta: Integrin, beta chain; InterPro: IPR002369 Integrins are the major metazoan receptors for cell adhesion to extracellular matrix proteins and, in vertebrates, also play important roles in certain cell-cell adhesions, make transmembrane connections to the cytoskeleton and activate many intracellular signalling pathways [, ] | Back alignment and domain information |
|---|
| >PF04285 DUF444: Protein of unknown function (DUF444); InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56 | Back alignment and domain information |
|---|
| >TIGR02877 spore_yhbH sporulation protein YhbH | Back alignment and domain information |
|---|
| >COG3552 CoxE Protein containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12034 DUF3520: Domain of unknown function (DUF3520); InterPro: IPR021908 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03850 Tfb4: Transcription factor Tfb4; InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF11443 DUF2828: Domain of unknown function (DUF2828); InterPro: IPR024553 This uncharacterised domain is found in eukaryotic, bacterial and viral proteins | Back alignment and domain information |
|---|
| >COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70) | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4547 CobT Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1327 consensus Copine [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >COG5047 SEC23 Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF07002 Copine: Copine; InterPro: IPR010734 This represents a conserved region approximately 180 residues long within eukaryotic copines | Back alignment and domain information |
|---|
| >COG2718 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2487 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08033 Sec23_BS: Sec23/Sec24 beta-sandwich domain; InterPro: IPR012990 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] | Back alignment and domain information |
|---|
| >COG3864 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4465 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 634 | ||||
| 2ecl_A | 81 | Solution Structure Of The Ring Domain Of The Human | 3e-04 |
| >pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 634 | |||
| 4fx5_A | 464 | VON willebrand factor type A; structural genomics, | 7e-79 | |
| 1shu_X | 182 | Anthrax toxin receptor 2; alpha/beta rossmann fold | 5e-28 | |
| 2x31_A | 189 | Magnesium-chelatase 60 kDa subunit; ligase, bacter | 3e-21 | |
| 3n2n_F | 185 | Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho | 1e-14 | |
| 3rag_A | 242 | Uncharacterized protein; structural genomics, PSI- | 1e-13 | |
| 3ibs_A | 218 | Conserved hypothetical protein BATB; structural ge | 2e-12 | |
| 1q0p_A | 223 | Complement factor B; VON willebrand factor, MAC-1, | 2e-11 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 1e-10 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 1e-08 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 1e-08 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 1e-08 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 2e-08 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 3e-08 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 6e-08 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 8e-08 | |
| 1mf7_A | 194 | Integrin alpha M; cell adhesion; 1.25A {Homo sapie | 9e-08 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 2e-07 | |
| 1n3y_A | 198 | Integrin alpha-X; alpha/beta rossmann fold, cell a | 3e-07 | |
| 1ijb_A | 202 | VON willebrand factor; dinucleotide-binding fold, | 3e-07 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 7e-07 | |
| 1mjn_A | 179 | Integrin alpha-L; rossmann fold, immune system; 1. | 1e-06 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 1e-06 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-06 | |
| 2xgg_A | 178 | Microneme protein 2; A/I domain, cell adhesion, hy | 2e-06 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 2e-06 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 2e-06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 3e-06 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 3e-06 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 5e-06 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 6e-06 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 9e-06 | |
| 1pt6_A | 213 | Integrin alpha-1; cell adhesion; 1.87A {Homo sapie | 9e-06 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 1e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 1e-05 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 1e-05 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 1e-05 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-05 | |
| 2b2x_A | 223 | Integrin alpha-1; computational design, antibody-a | 2e-05 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 2e-05 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 2e-05 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 2e-05 | |
| 1v7p_C | 200 | Integrin alpha-2; snake venom, C-type lectin, anta | 3e-05 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 3e-05 | |
| 1atz_A | 189 | VON willebrand factor; collagen-binding, hemostasi | 3e-05 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 4e-05 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 4e-05 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 5e-05 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 6e-05 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 6e-05 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 7e-05 | |
| 3zqk_A | 199 | VON willebrand factor; blood clotting, adamts-13, | 7e-05 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 9e-05 | |
| 2x5n_A | 192 | SPRPN10, 26S proteasome regulatory subunit RPN10; | 9e-05 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 1e-04 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 1e-04 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 1e-04 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 2e-04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-04 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 3e-04 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 3e-04 | |
| 3k6s_A | 1095 | Integrin alpha-X; cell receptor, adhesion molecule | 3e-04 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 4e-04 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 4e-04 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 5e-04 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 5e-04 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 6e-04 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 7e-04 | |
| 2nvo_A | 535 | RO sixty-related protein, RSR; alpha helical repea | 8e-04 |
| >4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Length = 464 | Back alignment and structure |
|---|
Score = 256 bits (656), Expect = 7e-79
Identities = 80/411 (19%), Positives = 134/411 (32%), Gaps = 51/411 (12%)
Query: 156 APSLPNDADRAPIDLVTVLDVSGSMS---SKLPLLKRAVHFIIQNLGSADRLSIVIFSSV 212
A S A + V ++D SGSM +K+ K A I L ++V +
Sbjct: 66 AASYGAPASGSENVEVIIIDCSGSMDYPRTKMMAAKEATKVAIDTLTDGAFFAVVAGTEG 125
Query: 213 ARRIFP----LQRMTDSGRENAIRAINTLSSNGGTNIVEGLKKGARVLEERRERSPVASI 268
AR ++P L R R A A+ L +NGGT + L + R+ + +
Sbjct: 126 ARVVYPTGGQLLRADYQSRAAAKEAVGRLHANGGTAMGRWLAQAGRIFDTAPSA--IKHA 183
Query: 269 ILLSDGQDTHNVLRNSYTQDEASSIPSNELAYLNLLPSSICLSKREAGQPTFPVHTFGFG 328
ILL+DG+D + ++ F G G
Sbjct: 184 ILLTDGKDESE-------------------------TPADLARAIQSSIGNFTADCRGIG 218
Query: 329 LEHDSEAMHAIADASGGTFSFIETLSILQDAFARCIGGLLSVVSQDVKLTIRSKSAGVRI 388
+ + + + IADA GT I + L + F + DV L + + G I
Sbjct: 219 EDWEPKELRKIADALLGTVGIIRDPATLAEDFREMTAKSMGKEVADVALRLWA-PKGATI 277
Query: 389 GSIPSGRYNSEVL-------DEGQQAVIDIGNLYADEEKEFMVYLSIPVSSAEGEQRPEC 441
+ N L D G + E +E+ + + + + E+
Sbjct: 278 RYVKQVSPNLADLSGMRVPGDNPLTGDYPTGA-WGAESREYHICVEVEPGNIGQEKL--- 333
Query: 442 TALLDVFCTHKDSASMEIHQVEGEKVEIRRPEVLSTADKKVNLQVDRQRSRLLVAETIAD 501
V KD+ + + LST +N +V + +A I +
Sbjct: 334 --AGRVQLVAKDAGGATLLGEGKIRAVWTEDTDLSTR---INGRVAHYTGQAEMAAAIQE 388
Query: 502 AQRMAEVGDLESAQALLAERRSGLLSSAAAQAGDVLCNWLEAELREIRERM 552
GDL++A A L + S +L E + + R
Sbjct: 389 GLDAQAAGDLDTATARLGRAMDLAVESGHEDTVKMLRKVTEVDPATSKVRA 439
|
| >1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Length = 182 | Back alignment and structure |
|---|
| >2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Length = 189 | Back alignment and structure |
|---|
| >3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Length = 242 | Back alignment and structure |
|---|
| >3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Length = 218 | Back alignment and structure |
|---|
| >1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Length = 223 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G Length = 194 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Length = 198 | Back alignment and structure |
|---|
| >1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Length = 202 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Length = 179 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Length = 178 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Length = 213 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Length = 223 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Length = 200 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A Length = 189 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* Length = 199 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Length = 192 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Length = 1095 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} Length = 535 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 634 | |||
| 4fx5_A | 464 | VON willebrand factor type A; structural genomics, | 100.0 | |
| 1ijb_A | 202 | VON willebrand factor; dinucleotide-binding fold, | 99.91 | |
| 1q0p_A | 223 | Complement factor B; VON willebrand factor, MAC-1, | 99.91 | |
| 4hqo_A | 266 | Sporozoite surface protein 2; malaria, gliding mot | 99.9 | |
| 3zqk_A | 199 | VON willebrand factor; blood clotting, adamts-13, | 99.89 | |
| 3ibs_A | 218 | Conserved hypothetical protein BATB; structural ge | 99.88 | |
| 1shu_X | 182 | Anthrax toxin receptor 2; alpha/beta rossmann fold | 99.88 | |
| 1mf7_A | 194 | Integrin alpha M; cell adhesion; 1.25A {Homo sapie | 99.88 | |
| 4hqf_A | 281 | Thrombospondin-related anonymous protein, trap; ma | 99.87 | |
| 2x31_A | 189 | Magnesium-chelatase 60 kDa subunit; ligase, bacter | 99.87 | |
| 2b2x_A | 223 | Integrin alpha-1; computational design, antibody-a | 99.87 | |
| 3n2n_F | 185 | Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho | 99.87 | |
| 1n3y_A | 198 | Integrin alpha-X; alpha/beta rossmann fold, cell a | 99.86 | |
| 1v7p_C | 200 | Integrin alpha-2; snake venom, C-type lectin, anta | 99.86 | |
| 1pt6_A | 213 | Integrin alpha-1; cell adhesion; 1.87A {Homo sapie | 99.86 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 99.86 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 99.86 | |
| 1mjn_A | 179 | Integrin alpha-L; rossmann fold, immune system; 1. | 99.85 | |
| 1atz_A | 189 | VON willebrand factor; collagen-binding, hemostasi | 99.84 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 99.84 | |
| 2xgg_A | 178 | Microneme protein 2; A/I domain, cell adhesion, hy | 99.83 | |
| 4b4t_W | 268 | RPN10, 26S proteasome regulatory subunit RPN10; hy | 99.76 | |
| 2x5n_A | 192 | SPRPN10, 26S proteasome regulatory subunit RPN10; | 99.72 | |
| 3k6s_A | 1095 | Integrin alpha-X; cell receptor, adhesion molecule | 99.71 | |
| 1pcx_A | 810 | Protein transport protein SEC24; 2.50A {Saccharomy | 99.7 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 99.67 | |
| 2nut_A | 769 | Protein transport protein SEC23A; human copii SEC2 | 99.66 | |
| 2ww8_A | 893 | RRGA, cell WALL surface anchor family protein; IGG | 99.65 | |
| 3eh1_A | 751 | Protein transport protein SEC24B; copii coat prote | 99.64 | |
| 1m2o_A | 768 | SEC23, protein transport protein SEC23, SEC23P; zi | 99.63 | |
| 3efo_B | 770 | SEC24 related gene family, member D; copii, coat p | 99.57 | |
| 3eh2_A | 766 | Protein transport protein SEC24C; copii-coat prote | 99.57 | |
| 1jey_B | 565 | KU80; double-strand DNA break repair, non-homologo | 99.47 | |
| 1yvr_A | 538 | RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, | 99.39 | |
| 3rag_A | 242 | Uncharacterized protein; structural genomics, PSI- | 99.22 | |
| 1jey_A | 609 | KU70; double-strand DNA break repair, non-homologo | 99.14 | |
| 2nvo_A | 535 | RO sixty-related protein, RSR; alpha helical repea | 99.13 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.1 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.09 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.08 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.08 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.08 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.05 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.03 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.03 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.02 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.02 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.01 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.01 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.01 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.99 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.99 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.98 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.98 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.98 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.97 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.95 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.95 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.95 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.95 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.9 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.9 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.89 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.89 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.88 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.85 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.84 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.84 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.84 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.84 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.84 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.82 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.81 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.81 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.81 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.8 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.78 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.77 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.77 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.77 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.76 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.74 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.74 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.72 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.71 | |
| 2iue_A | 212 | Pactolus I-domain; membrane protein, CD, ITC, limb | 98.7 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.68 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.68 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.64 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.63 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.62 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.61 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 98.59 | |
| 3v4v_B | 503 | Integrin beta-7; cell adhesion, madcam-1, membrane | 98.54 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.54 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.53 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.53 | |
| 3vi3_B | 454 | Integrin beta-1; beta propeller fold, rossman fold | 98.49 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.45 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.42 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.41 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.39 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.38 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.38 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.33 | |
| 3rag_A | 242 | Uncharacterized protein; structural genomics, PSI- | 98.31 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.19 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.11 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.08 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.06 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.05 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.98 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.69 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 97.5 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.31 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 94.28 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 89.89 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 89.25 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 87.72 |
| >4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-41 Score=369.08 Aligned_cols=328 Identities=22% Similarity=0.270 Sum_probs=273.6
Q ss_pred CCCCCceEEEEEeCCCCCC--c-cHHHHHHHHHHHHHhcCCCCeEEEEEeCCCcEEEEcC----cccCHHHHHHHHHHHh
Q 043643 163 ADRAPIDLVTVLDVSGSMS--S-KLPLLKRAVHFIIQNLGSADRLSIVIFSSVARRIFPL----QRMTDSGRENAIRAIN 235 (634)
Q Consensus 163 ~~r~p~dlv~VlD~SgSM~--g-kl~~~K~al~~li~~L~~~drvsIV~Fs~~a~~~~pl----~~~t~~~~~~~~~~I~ 235 (634)
..++++|++||||+||||. + ||+.+|+++..+++.|.++||++||+|++.+..++|+ .+++..++..++..|+
T Consensus 73 ~~~~~~dvv~VLD~SGSM~~~~~rl~~ak~a~~~ll~~L~~~drv~lV~Fs~~a~~~~p~t~~l~~~~~~~~~~l~~~I~ 152 (464)
T 4fx5_A 73 ASGSENVEVIIIDCSGSMDYPRTKMMAAKEATKVAIDTLTDGAFFAVVAGTEGARVVYPTGGQLLRADYQSRAAAKEAVG 152 (464)
T ss_dssp ---CCEEEEEEEECCGGGGTTTHHHHHHHHHHHHHHHHSCTTCEEEEEEESSSEEEEESSSSSCEECSHHHHHHHHHHHH
T ss_pred CCCCCceEEEEEEcCcccCCCCchHHHHHHHHHHHHHhCCCCCEEEEEEEcCceEEEecCCcccccCCHHHHHHHHHHHH
Confidence 3468899999999999999 8 9999999999999999999999999999999999995 4567889999999999
Q ss_pred cCCCCCCCcHHHHHHHHHHHHHhhccCCCCcEEEEEeCCCCCCCCCCCcccccccCCCCCCHHHHHhhchhhhhcccccc
Q 043643 236 TLSSNGGTNIVEGLKKGARVLEERRERSPVASIILLSDGQDTHNVLRNSYTQDEASSIPSNELAYLNLLPSSICLSKREA 315 (634)
Q Consensus 236 ~l~~~GgT~i~~aL~~A~~~l~~~~~~~~~~~IILlTDG~~~~g~~~~~~~~~~~~~~~~~~~~~~~lv~~~i~~~~~~~ 315 (634)
.|.++|||+++.||..|++.|..+ ++..+.|||||||.++.+. ...+...+. +
T Consensus 153 ~L~~~GgT~l~~aL~~A~~~l~~~--~~~~~~IILLTDG~~~~~~----------------~~~l~~~~~---------a 205 (464)
T 4fx5_A 153 RLHANGGTAMGRWLAQAGRIFDTA--PSAIKHAILLTDGKDESET----------------PADLARAIQ---------S 205 (464)
T ss_dssp TCCCCSCCCHHHHHHHHHHHHTTC--TTSEEEEEEEESSCCTTSC----------------HHHHHHHHH---------H
T ss_pred cCCCCCCCcHHHHHHHHHHHHhcC--CCCCCEEEEEcCCCCCCCC----------------hHHHHHHHH---------H
Confidence 999999999999999999999753 3566889999999988531 122332221 1
Q ss_pred CCCCeeEEEEEccCCCChHHHHHHHhhcCCeEEEcCChhhHHHHHHHHhhccccceeeeeEEEEEecCCCeEEEEecCCC
Q 043643 316 GQPTFPVHTFGFGLEHDSEAMHAIADASGGTFSFIETLSILQDAFARCIGGLLSVVSQDVKLTIRSKSAGVRIGSIPSGR 395 (634)
Q Consensus 316 ~~~~i~I~t~G~G~~~d~~~L~~iA~~tgG~~~~i~~~~~l~~~f~~~l~~l~s~va~~~~l~v~~~~~~v~i~~v~~~~ 395 (634)
...++.||+||||.++|...|+.||+.++|.|+++.+.++|.++|.+++..++++++++++|.+++ ++|+++..++...
T Consensus 206 ~~~~i~i~tiGiG~~~d~~~L~~IA~~tgG~~~~v~d~~~L~~~f~~i~~~~~s~~~~dv~l~l~~-~~g~~v~~v~~v~ 284 (464)
T 4fx5_A 206 SIGNFTADCRGIGEDWEPKELRKIADALLGTVGIIRDPATLAEDFREMTAKSMGKEVADVALRLWA-PKGATIRYVKQVS 284 (464)
T ss_dssp HTTTCEEEEEEESSSSCHHHHHHHHHHTTCCEEEESSGGGHHHHHHHHHHHHHTCCEEEEEEEEEC-CTTCEEEEEEEEE
T ss_pred hcCCCeEEEEEeCCccCHHHHHHHHHhCCCEEEEcCCHHHHHHHHHHHHHHhhchheeeeEEEEEe-CCCcEEEEEEeec
Confidence 246899999999999999999999999999999999999999999999999999999999999995 7899988875432
Q ss_pred ------CCcccc-cCCceeEEEcCCccCCcEEEEEEEEEcCCCCCCCCCCCCccceEEEEEEEecCCCCceeeeecceeE
Q 043643 396 ------YNSEVL-DEGQQAVIDIGNLYADEEKEFMVYLSIPVSSAEGEQRPECTALLDVFCTHKDSASMEIHQVEGEKVE 468 (634)
Q Consensus 396 ------~~~~~~-~~~~~~~i~lg~l~~~e~r~~lv~l~~p~~~~~~~~~~~~~~l~~v~~~Y~~~~~~~~~~~~~~~~~ 468 (634)
+..... .+++.+.|.+|+| +||+|+|+|+|.+|+...+. ...+++|+|+|.+|.+. . ......+.
T Consensus 285 P~~~~l~~~~~~~~~~~~~~v~lG~l-~~e~r~~lv~l~v~~~~~g~-----~~~~~~v~~~y~~~~~~-~-~~~~~~v~ 356 (464)
T 4fx5_A 285 PNLADLSGMRVPGDNPLTGDYPTGAW-GAESREYHICVEVEPGNIGQ-----EKLAGRVQLVAKDAGGA-T-LLGEGKIR 356 (464)
T ss_dssp SBCEECGGGCEECSSTTEEEEEEEEE-SSEEEEEEEEEECCCCCTTC-----EEEEEEEEEEEEETTEE-E-EEEEEEEE
T ss_pred ccccccCcccccCCCCcEEEEECCcC-CCCeEEEEEEEEcCCCCCCc-----eeEEEEEEEEEcCCCcc-c-cccccceE
Confidence 112222 3567899999999 99999999999999866541 13348999999999865 2 23444566
Q ss_pred EeCCCccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhh
Q 043643 469 IRRPEVLSTADKKVNLQVDRQRSRLLVAETIADAQRMAEVGDLESAQALLAERRSGLLS 527 (634)
Q Consensus 469 v~rp~~~~~~~~~~~~~V~~~~~r~~a~~~i~~a~~~a~~g~~~~A~~~L~~~~~~l~~ 527 (634)
+.++..... ...++++|+++..+..+++++++|+.++++||+++|.++|+.+.+.+.+
T Consensus 357 ~~~~~~~~~-~~~~~~~V~~~~~~~~~a~~~~~a~~~~~~gd~~~A~~~L~~A~~~~~~ 414 (464)
T 4fx5_A 357 AVWTEDTDL-STRINGRVAHYTGQAEMAAAIQEGLDAQAAGDLDTATARLGRAMDLAVE 414 (464)
T ss_dssp EEECSCHHH-HSCCCHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHH
T ss_pred EEEEccccc-cCCCCHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHH
Confidence 666554221 1347899999999999999999999999999999999999999988865
|
| >1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C | Back alignment and structure |
|---|
| >1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* | Back alignment and structure |
|---|
| >3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* | Back alignment and structure |
|---|
| >3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* | Back alignment and structure |
|---|
| >1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G | Back alignment and structure |
|---|
| >4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A | Back alignment and structure |
|---|
| >2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A | Back alignment and structure |
|---|
| >1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... | Back alignment and structure |
|---|
| >1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* | Back alignment and structure |
|---|
| >1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 | Back alignment and structure |
|---|
| >2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A | Back alignment and structure |
|---|
| >2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B | Back alignment and structure |
|---|
| >1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* | Back alignment and structure |
|---|
| >3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B | Back alignment and structure |
|---|
| >3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* | Back alignment and structure |
|---|
| >1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A | Back alignment and structure |
|---|
| >3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B | Back alignment and structure |
|---|
| >2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 634 | ||||
| d1q0pa_ | 209 | c.62.1.1 (A:) Complement factor B domain {Human (H | 2e-16 | |
| d1shux_ | 181 | c.62.1.1 (X:) Capillary morphogenesis protein 2 do | 3e-15 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 1e-10 | |
| d1mf7a_ | 194 | c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, M | 5e-10 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-09 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 4e-09 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 1e-08 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 2e-08 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 2e-08 | |
| d1mjna_ | 179 | c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte funct | 2e-08 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-07 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 1e-07 | |
| d1jeya2 | 220 | c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain | 3e-07 | |
| d1yvra2 | 174 | c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprot | 8e-07 | |
| d1atza_ | 184 | c.62.1.1 (A:) von Willebrand factor A3 domain, vWA | 1e-06 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 2e-06 | |
| d1ijba_ | 202 | c.62.1.1 (A:) von Willebrand factor A1 domain, vWA | 3e-06 | |
| d1jeyb2 | 236 | c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain | 1e-05 | |
| d1n3ya_ | 189 | c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo | 4e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 4e-05 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 2e-04 | |
| d1tyeb2 | 248 | c.62.1.1 (B:107-354) Integrin beta A domain {Human | 6e-04 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 0.001 | |
| d1pt6a_ | 192 | c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo s | 0.001 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 0.002 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 0.003 |
| >d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Length = 209 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: vWA-like superfamily: vWA-like family: Integrin A (or I) domain domain: Complement factor B domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 76.6 bits (187), Expect = 2e-16
Identities = 33/214 (15%), Positives = 77/214 (35%), Gaps = 30/214 (14%)
Query: 168 IDLVTVLDVSGSMS-SKLPLLKRAVHFIIQNLGSAD---RLSIVIFSSVARRIFPLQRMT 223
+++ VLD S S+ S K+++ +I+ + S R +V +++ + +
Sbjct: 2 MNIYLVLDGSDSIGASNFTGAKKSLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEAD 61
Query: 224 DSGRENAIRAINTLSSN-----GGTNIVEGLKKGARVLEERRERSPVAS------IILLS 272
S + + +N ++ GTN + L+ ++ + P IIL++
Sbjct: 62 SSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVIILMT 121
Query: 273 DGQDTHNVLRNSYTQDEASSIPSNELAYLNLLPSSICLSKREAGQPTFPVHTFGFGLEHD 332
DG + + + + + + V+ FG G +
Sbjct: 122 DGLHNMGGDPITVIDEIRDLLYIGKDR-------------KNPREDYLDVYVFGVGPLVN 168
Query: 333 SEAMHAIADASGGT--FSFIETLSILQDAFARCI 364
++A+A ++ + L+D F + I
Sbjct: 169 QVNINALASKKDNEQHVFKVKDMENLEDVFYQMI 202
|
| >d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 179 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 220 | Back information, alignment and structure |
|---|
| >d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 174 | Back information, alignment and structure |
|---|
| >d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 184 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 202 | Back information, alignment and structure |
|---|
| >d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 634 | |||
| d1q0pa_ | 209 | Complement factor B domain {Human (Homo sapiens) [ | 99.87 | |
| d1shux_ | 181 | Capillary morphogenesis protein 2 domain {Human (H | 99.86 | |
| d1atza_ | 184 | von Willebrand factor A3 domain, vWA3 {Human (Homo | 99.79 | |
| d1ijba_ | 202 | von Willebrand factor A1 domain, vWA1 {Human (Homo | 99.78 | |
| d1mf7a_ | 194 | Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub | 99.77 | |
| d1n3ya_ | 189 | Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI | 99.76 | |
| d1mjna_ | 179 | Integrin CD11a/CD18 (Leukocyte function associated | 99.75 | |
| d1v7pc_ | 193 | Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId | 99.73 | |
| d1pt6a_ | 192 | Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId | 99.71 | |
| d1jeya2 | 220 | Ku70 subunit N-terminal domain {Human (Homo sapien | 99.58 | |
| d1jeyb2 | 236 | Ku80 subunit N-terminal domain {Human (Homo sapien | 99.42 | |
| d1yvra2 | 174 | 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c | 99.36 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.21 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.19 | |
| d1tyeb2 | 248 | Integrin beta A domain {Human (Homo sapiens) [TaxI | 99.17 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.17 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.15 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.14 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.08 | |
| d2qtva3 | 271 | Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T | 99.05 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.04 | |
| d1pd0a3 | 252 | Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T | 99.01 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.97 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.88 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.87 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.85 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.83 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.73 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.71 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.39 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.99 | |
| d1pd0a2 | 177 | Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T | 93.74 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 90.37 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 85.68 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 84.52 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 82.4 |
| >d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: vWA-like superfamily: vWA-like family: Integrin A (or I) domain domain: Complement factor B domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=9.3e-22 Score=190.41 Aligned_cols=188 Identities=18% Similarity=0.235 Sum_probs=133.0
Q ss_pred ceEEEEEeCCCCCCc-cHHHHHHHHHHHHHhcC---CCCeEEEEEeCCCcEEEEcCcccCHHHHHHHHHHHhcCC-----
Q 043643 168 IDLVTVLDVSGSMSS-KLPLLKRAVHFIIQNLG---SADRLSIVIFSSVARRIFPLQRMTDSGRENAIRAINTLS----- 238 (634)
Q Consensus 168 ~dlv~VlD~SgSM~g-kl~~~K~al~~li~~L~---~~drvsIV~Fs~~a~~~~pl~~~t~~~~~~~~~~I~~l~----- 238 (634)
+||+||||.||||.+ +++.+|+++..+++.|. .++||+||+|++.+..+++++......+..+...|+.+.
T Consensus 2 lDivfvlD~SgSm~~~~~~~~k~~~~~li~~l~~~~~~~rv~lv~f~~~~~~~~~l~~~~~~~~~~l~~~i~~i~~~~~~ 81 (209)
T d1q0pa_ 2 MNIYLVLDGSDSIGASNFTGAKKSLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHK 81 (209)
T ss_dssp EEEEEEEECSTTTCHHHHHHHHHHHHHHHHHHHTTTCCCEEEEEEESSSEEEEECTTSGGGGCHHHHHHHHHTCCTTSCS
T ss_pred cCEEEEEeCCCCCChHHHHHHHHHHHHHHHhcccCCCCcEEEEEEecCceeEEecCccchhhHHHHHHHHHHHhhhcccc
Confidence 799999999999998 99999999999999884 578999999999999999998766667888888998874
Q ss_pred CCCCCcHHHHHHHHHHHHHhhcc------CCCCcEEEEEeCCCCCCCCCCCcccccccCCCCCCHHHHHhhchhhhhccc
Q 043643 239 SNGGTNIVEGLKKGARVLEERRE------RSPVASIILLSDGQDTHNVLRNSYTQDEASSIPSNELAYLNLLPSSICLSK 312 (634)
Q Consensus 239 ~~GgT~i~~aL~~A~~~l~~~~~------~~~~~~IILlTDG~~~~g~~~~~~~~~~~~~~~~~~~~~~~lv~~~i~~~~ 312 (634)
.+|+|+++.||+.+.+.+..... ++..+.|||+|||.++.+.... ........... ....+
T Consensus 82 ~~g~t~~~~al~~a~~~~~~~~~~~~~~~~~~~kvvvl~TDG~~~~~~~~~-----------~~~~~~~~~~~--~~~~~ 148 (209)
T d1q0pa_ 82 LKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPI-----------TVIDEIRDLLY--IGKDR 148 (209)
T ss_dssp CTTCCCHHHHHHHHHHHHCCTTSSCCTTGGGCEEEEEEEECSCCCSSSCTH-----------HHHHHHHHHTT--CSCBT
T ss_pred CCCCchHHHHHHHHHHHHHhhhccCccccCCCceEEEEEcCCCccCCCChH-----------HHHHHHHHhhh--hHHHH
Confidence 57899999999999999964322 1233579999999998764321 00111111110 11112
Q ss_pred cccCCCCeeEEEEEccCCCChHHHHHHHhhcCCe--EEEcCChhhHHHHHHHHhhccc
Q 043643 313 REAGQPTFPVHTFGFGLEHDSEAMHAIADASGGT--FSFIETLSILQDAFARCIGGLL 368 (634)
Q Consensus 313 ~~~~~~~i~I~t~G~G~~~d~~~L~~iA~~tgG~--~~~i~~~~~l~~~f~~~l~~l~ 368 (634)
...+..++.|++||+|.+.+...|+.||..++|. ||.+.+.++|.++|.+++....
T Consensus 149 ~~~~~~gi~i~~vgvg~~~~~~~L~~iAs~~~~~~~~f~~~~~~~L~~~~~~ii~~~~ 206 (209)
T d1q0pa_ 149 KNPREDYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQ 206 (209)
T ss_dssp TBCCGGGEEEEEEECSSCCCHHHHHHHSCCCTTCCCEEETTC----------------
T ss_pred HHHHhcCCceEEecCCccCCHHHHHHHHcCCCCCeeEEEeCCHHHHHHHHHHHHHhhc
Confidence 2345678999999999999999999999887664 8889999999999998876543
|
| >d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd0a2 b.2.8.1 (A:133-215,A:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|