Citrus Sinensis ID: 043654


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MHIFKLSFIIVVISSSLSFFTATTTIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAARIAIMVGAGVPTMLCLLGLACIICAKLNSPDTRRRRRSNYNFPEFNPTVAPQPTVIAGLDGPTIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPARLPPLPAAAAAADDDDDDHA
ccHHHHHHHHHHHHHHccccccccccccccccccccccccEEEcEEccccccccccccccEEEEccccccEEEEcccccEEEEEEEcccEEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEccccccccccccccEEEEEEEEEEEcccccccccccccccEEEEEcccccccccccccccEEccccccccccccccccccHHHHHHEEEEccccccccccccEEEEEEEcccccccccccccccccccccccccccccEEccccccccccccEEEEcccccccccccccccEEccccccccEEccccccccccccccHHHHHcccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHccccHHHHcccccccccccccEEEEcEEccccccccccccccEEEEccccccEEEEcccccEEEEEEEEcEEEEEEEccccccHHHHHccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEccHHHHccccccccEEEEEcEcccccccHHHHHHHHHccccEEEcccccccccHHcccEEEEEccccccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccccHHHHHHccEEEEEcccccccccccccEEEEcccccccEEEEcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccc
MHIFKLSFIIVVISSSlsfftatttiqncssvscrrdepwirfpfrittrqpescgypgfnvscdssssqtilelpsgkfslqaidYDAQQIWindqsnclpqkilslnlsgspfkalynqqftffncsssylqyrlnpigclsganftifaTSSTRVVNNFIQSSSCRFVarvqvpvdwpfydqvvssdlsdnlrltwdepqcgdcekgggrcgfknnssteigclslhhreiPKAARIAIMVGAGVPTMLCLLGLACIICaklnspdtrrrrrsnynfpefnptvapqptviagldgptiesypkivlgesrrlpkpddntcpiclaeykpketlktipecthcfhaDCVDEWLRlnatcpvcrnsparlpplpaaaaaaddddddha
MHIFKLSFIIVVISSSLSFFTAtttiqncssvscrrdepWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAARIAIMVGAGVPTMLCLLGLACIICAKlnspdtrrRRRSNYnfpefnptvapqptvIAGLDGPTIESYPKIVlgesrrlpkpddntcpICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPARLPPLpaaaaaaddddDDHA
MHifklsfiivvissslsfftatttIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAARIAIMVGAGVPTMlcllglaciicaklNSPDTRRRRRSNYNFPEFNPTVAPQPTVIAGLDGPTIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPARLPPLPaaaaaaddddddHA
**IFKLSFIIVVISSSLSFFTATTTIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCD****QTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAARIAIMVGAGVPTMLCLLGLACIICAKLN****************F**TVAPQPTVIAGLDGPTIESYPKIVLGE********DNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCR************************
*HIFKLSFIIVVISSSLSFFTATTTIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGD******************GCLSLHHREIPKAARIAIMVGAGVPTMLCLLGLACIICAKLNSPDTRRRRRSNYNFPEFNPTVAPQPTVIAGLDGPTIESYPKIVLGESRR**KPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNS**********************
MHIFKLSFIIVVISSSLSFFTATTTIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAARIAIMVGAGVPTMLCLLGLACIICAKLNSPDTRRRRRSNYNFPEFNPTVAPQPTVIAGLDGPTIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPARLPPLP**************
MHIFKLSFIIVVISSSLSFFTATTTIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAARIAIMVGAGVPTMLCLLGLACIICAKLNSP**************************AGLDGPTIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSP*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHIFKLSFIIVVISSSLSFFTATTTIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAARIAIMVGAGVPTMLCLLGLACIICAKLNSPDTRRRRRSNYNFPEFNPTVAPQPTVIAGLDGPTIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPARLPPLPAAAAAADDDDDDHA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
P0CH01372 Putative RING-H2 finger p no no 0.856 0.897 0.396 3e-64
P0CH02362 Putative RING-H2 finger p no no 0.8 0.861 0.402 7e-61
Q9SKK8377 RING-H2 finger protein AT no no 0.853 0.883 0.374 2e-55
Q9C7E9299 RING-H2 finger protein AT no no 0.725 0.946 0.390 8e-51
P0CH03366 Putative RING-H2 finger p no no 0.8 0.852 0.362 2e-46
Q9FL42159 Putative RING-H2 finger p no no 0.320 0.786 0.469 6e-27
O82353214 RING-H2 finger protein AT no no 0.207 0.378 0.482 9e-17
Q9M313212 RING-H2 finger protein AT no no 0.210 0.386 0.450 3e-16
Q8RX29217 RING-H2 finger protein AT no no 0.194 0.350 0.512 6e-16
Q9FG21197 Putative RING-H2 finger p no no 0.223 0.441 0.442 3e-14
>sp|P0CH01|AT21A_ARATH Putative RING-H2 finger protein ATL21A OS=Arabidopsis thaliana GN=ATL21A PE=3 SV=1 Back     alignment and function desciption
 Score =  245 bits (626), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 140/353 (39%), Positives = 204/353 (57%), Gaps = 19/353 (5%)

Query: 27  QNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELP-SGKFSLQAI 85
           Q CSS SC RD+  +RFPF + ++QPE CG+ GFN+ C ++S +T L+LP SG F ++ I
Sbjct: 24  QQCSSSSCGRDDVHVRFPFWLLSKQPELCGHAGFNLQC-TASPKTALKLPNSGTFLVREI 82

Query: 86  DYDAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNCSSSYLQ-YRLNPIGCLS 144
           DY +QQI + D  NCL +K+L+ ++S SPF ALY   +TF +C +   +  R + I CL 
Sbjct: 83  DYLSQQIRLYDPENCLARKLLTFDISRSPFSALYLVSYTFLSCPNEVAKSSRFDSIPCLG 142

Query: 145 GANFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDWPFYDQV--VSSDLSD-NLRLTWDE 201
            +  +  AT+S  +  + +   SC+ V  + VPV      +    S+D++D +L L WD 
Sbjct: 143 NSTTSFLATTSLDLAKSML--PSCQIVKTLDVPVSRRVIAKKSRFSTDVNDKDLWLKWDS 200

Query: 202 PQCGDCEKGGGRCGFKNNSSTEIGCLSLH---HREIPKAARIAIMVGAGVPTMLCLLGLA 258
           P C DCE+   RCGF++N+S ++ C       +   P+  +I ++   G  T+       
Sbjct: 201 PSCSDCERDFLRCGFRSNTSLQVKCFPFENSGYNTEPQVLKIILLSIIGPLTIFA----T 256

Query: 259 CIICAKLNSPDTRRRRRSNYNFPEFNPTVAPQPTVIAGLDGPTIESYPKIVLGESRRLP- 317
           CI      S       + N       P    +  V  GLD   IESY K  LGESRRLP 
Sbjct: 257 CIAVGVCTSERFASLIQRNVAIAALQPN---EVIVTTGLDESIIESYKKTELGESRRLPG 313

Query: 318 KPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPA 370
             DD  CPICL+EY  KET++ IPEC HCFH++C+D WL+++ +CP+CRNSP+
Sbjct: 314 NNDDIVCPICLSEYASKETVRCIPECDHCFHSECIDVWLKIHGSCPLCRNSPS 366





Arabidopsis thaliana (taxid: 3702)
>sp|P0CH02|AT21B_ARATH Putative RING-H2 finger protein ATL21B OS=Arabidopsis thaliana GN=ATL21B PE=3 SV=1 Back     alignment and function description
>sp|Q9SKK8|ATL22_ARATH RING-H2 finger protein ATL22 OS=Arabidopsis thaliana GN=ATL22 PE=2 SV=2 Back     alignment and function description
>sp|Q9C7E9|ATL20_ARATH RING-H2 finger protein ATL20 OS=Arabidopsis thaliana GN=ATL20 PE=2 SV=2 Back     alignment and function description
>sp|P0CH03|AT21C_ARATH Putative RING-H2 finger protein ATL21C OS=Arabidopsis thaliana GN=ATL21C PE=3 SV=1 Back     alignment and function description
>sp|Q9FL42|ATL69_ARATH Putative RING-H2 finger protein ATL69 OS=Arabidopsis thaliana GN=ATL69 PE=3 SV=1 Back     alignment and function description
>sp|O82353|ATL67_ARATH RING-H2 finger protein ATL67 OS=Arabidopsis thaliana GN=ATL67 PE=2 SV=1 Back     alignment and function description
>sp|Q9M313|ATL68_ARATH RING-H2 finger protein ATL68 OS=Arabidopsis thaliana GN=ATL68 PE=2 SV=1 Back     alignment and function description
>sp|Q8RX29|ATL70_ARATH RING-H2 finger protein ATL70 OS=Arabidopsis thaliana GN=ATL70 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG21|ATL71_ARATH Putative RING-H2 finger protein ATL71 OS=Arabidopsis thaliana GN=ATL71 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
255544994377 ring finger protein, putative [Ricinus c 0.951 0.984 0.6 1e-125
224132906384 predicted protein [Populus trichocarpa] 0.943 0.958 0.583 1e-119
359490864 1054 PREDICTED: uncharacterized protein LOC10 0.876 0.324 0.586 1e-117
302144043381 unnamed protein product [Vitis vinifera] 0.879 0.900 0.584 1e-116
334188355382 RING/U-box domain-containing protein-lik 0.864 0.882 0.585 1e-109
357463879388 RING finger protein [Medicago truncatula 0.884 0.889 0.519 7e-96
356516041385 PREDICTED: putative RING-H2 finger prote 0.892 0.903 0.515 9e-95
255647206385 unknown [Glycine max] 0.892 0.903 0.512 2e-93
224067976373 predicted protein [Populus trichocarpa] 0.912 0.954 0.447 8e-83
449514611388 PREDICTED: putative RING-H2 finger prote 0.758 0.762 0.507 5e-78
>gi|255544994|ref|XP_002513558.1| ring finger protein, putative [Ricinus communis] gi|223547466|gb|EEF48961.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/380 (60%), Positives = 281/380 (73%), Gaps = 9/380 (2%)

Query: 1   MHIFKLSFIIVVISSSLSFFTATTTIQNCSSVSCRRDEPWIRFPFRITTRQPESCGYPGF 60
           M I KL F  + +    SF     +   C + +C R+EP IRFPFRI  RQ +SCGYPGF
Sbjct: 1   MDIVKLIFSTIFL---FSFLQIIASQHLCLNSACARNEPVIRFPFRIENRQFKSCGYPGF 57

Query: 61  NVSCDSSSSQTILELP-SGKFSLQAIDYDAQQIWINDQSNCLPQKILSLNLSGSPFKALY 119
           +VSCD++++ T+LELP SG F++QAIDY  Q++WIND +NCLP++ILSLNLS SPF  L+
Sbjct: 58  DVSCDTNTNHTLLELPYSGTFTVQAIDYATQELWINDPNNCLPKRILSLNLSNSPFVGLF 117

Query: 120 NQQFTFFNCS-SSYLQYRLNPIGCLSGANFTIFATSSTRVVNNFIQSSSCRFVARVQVPV 178
            Q FTFFNCS ++Y  ++LNPI CLS +  T+FATSS RV+N+    SSC   A ++VPV
Sbjct: 118 YQNFTFFNCSLTNYTNFQLNPIACLSSSTNTVFATSSLRVINHLSGLSSCEAFASMEVPV 177

Query: 179 DWPFYDQVVSSDLSDNLRLTWDEPQCGDCEKGGGRCGFKNNSSTEIGCLSLHHREIPKAA 238
           +WPFY Q++SSDLSD+LRLTW  P+CG CE  GGRCG ++NSS  I C +   R IPK+A
Sbjct: 178 EWPFYGQILSSDLSDDLRLTWAVPRCGKCESHGGRCGPRSNSSRLIVCANPKLRGIPKSA 237

Query: 239 RIAIMVGAGVPTMLCLLGLACIICAKLNSPDTRRRRRSNYNFPEFNPTVAPQPTVIA-GL 297
           R  I +G G+P  LC+LGL C IC + +    RRR   ++ FPE N  V  QPTV A GL
Sbjct: 238 RYIITIGGGIPVALCVLGLLCFICNRASYYTGRRR---SHLFPESNFVVNQQPTVSARGL 294

Query: 298 DGPTIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLR 357
           DG T+ESYPKIVLGESRRLPKPDD TC ICL+EYKPKETLKTIPEC HCFHADC+DEWL+
Sbjct: 295 DGQTLESYPKIVLGESRRLPKPDDITCSICLSEYKPKETLKTIPECQHCFHADCIDEWLK 354

Query: 358 LNATCPVCRNSPARLPPLPA 377
           LNA+CP+CR SP RLPP PA
Sbjct: 355 LNASCPICRKSPDRLPPPPA 374




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224132906|ref|XP_002321438.1| predicted protein [Populus trichocarpa] gi|222868434|gb|EEF05565.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490864|ref|XP_002267722.2| PREDICTED: uncharacterized protein LOC100262465 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302144043|emb|CBI23148.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|334188355|ref|NP_200123.2| RING/U-box domain-containing protein-like protein [Arabidopsis thaliana] gi|332008921|gb|AED96304.1| RING/U-box domain-containing protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357463879|ref|XP_003602221.1| RING finger protein [Medicago truncatula] gi|355491269|gb|AES72472.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356516041|ref|XP_003526705.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Glycine max] Back     alignment and taxonomy information
>gi|255647206|gb|ACU24071.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224067976|ref|XP_002302627.1| predicted protein [Populus trichocarpa] gi|222844353|gb|EEE81900.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449514611|ref|XP_004164427.1| PREDICTED: putative RING-H2 finger protein ATL21B-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
TAIR|locus:2040085377 AT2G25410 [Arabidopsis thalian 0.502 0.519 0.357 1.6e-59
TAIR|locus:2010489299 AT1G28040 [Arabidopsis thalian 0.733 0.956 0.380 3.2e-49
TAIR|locus:2169399159 AT5G07040 [Arabidopsis thalian 0.212 0.522 0.638 1.2e-28
TAIR|locus:2039170217 AT2G35910 [Arabidopsis thalian 0.202 0.364 0.518 1.9e-19
TAIR|locus:2062892214 AT2G46160 [Arabidopsis thalian 0.207 0.378 0.482 3.5e-18
TAIR|locus:2144088197 AT5G06490 [Arabidopsis thalian 0.279 0.553 0.409 7.9e-18
TAIR|locus:2082762212 AT3G61550 [Arabidopsis thalian 0.207 0.382 0.455 9e-17
TAIR|locus:2122348132 AT4G09100 [Arabidopsis thalian 0.182 0.537 0.486 1.3e-15
TAIR|locus:2074678158 AT3G11110 [Arabidopsis thalian 0.184 0.455 0.410 1.6e-15
TAIR|locus:2062008227 AT2G47560 [Arabidopsis thalian 0.256 0.440 0.333 1.4e-12
TAIR|locus:2040085 AT2G25410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 347 (127.2 bits), Expect = 1.6e-59, Sum P(2) = 1.6e-59
 Identities = 73/204 (35%), Positives = 108/204 (52%)

Query:    29 CSSVSCRRDEPWIRFPFRITTRQPESCGYPGFNVSCDSSSSQTILELPSGK-FSLQAIDY 87
             C S SC ++    RFPF + + QPESCGY GFN+ C   ++ T L+LP  + F ++ IDY
Sbjct:    29 CYSFSCSQESVVARFPFSLFSYQPESCGYSGFNLICKDDANTT-LKLPKSEPFLVKEIDY 87

Query:    88 DAQQIWINDQSNCLPQKILSLNLSGSPFKALYNQQFTFFNC-SSSYLQYRLNPIGCLSGA 146
             + Q+I +ND  NCL +++L+ + SGSPF  L ++ +TF  C   + +      I CL   
Sbjct:    88 ETQRIRLNDPENCLARRLLNFDPSGSPFSFLRSRNYTFLICPKEANITASFRAIDCLGNT 147

Query:   147 NFTIFATSSTRVVNNFIQSSSCRFVARVQVPVDW-PFYDQVVSSDLSDNLRLTWDEPQCG 205
               + F      + +     SSC     + +P  W   Y        S ++ L WD P C 
Sbjct:   148 TSSFFVVQFENLGS---MPSSCHIFKILPLPFSWFVAYTTYPDGQNSRDMWLKWDSPDCR 204

Query:   206 DCEKG-GGRCGFKNNSSTEIGCLS 228
             DCE+    RCGFKNN+S ++ C S
Sbjct:   205 DCERRTNSRCGFKNNTSHQVECFS 228


GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2010489 AT1G28040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169399 AT5G07040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039170 AT2G35910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062892 AT2G46160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144088 AT5G06490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082762 AT3G61550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122348 AT4G09100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074678 AT3G11110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062008 AT2G47560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-12
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-08
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 8e-08
pfam13947106 pfam13947, GUB_WAK_bind, Wall-associated receptor 3e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-06
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 9e-06
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 9e-06
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 1e-04
smart0018440 smart00184, RING, Ring finger 2e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 3e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-04
pfam1438094 pfam14380, WAK_assoc, Wall-associated receptor kin 0.001
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 0.002
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 0.002
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 60.5 bits (147), Expect = 3e-12
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 1/45 (2%)

Query: 322 NTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCR 366
           + CPICL E++P E +  +P C H FH +C+D+WLR + TCP+CR
Sbjct: 1   DECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|222467 pfam13947, GUB_WAK_bind, Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222721 pfam14380, WAK_assoc, Wall-associated receptor kinase C-terminal Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
PF13947106 GUB_WAK_bind: Wall-associated receptor kinase gala 99.77
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.74
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.55
PF1438094 WAK_assoc: Wall-associated receptor kinase C-termi 99.52
PHA02929238 N1R/p28-like protein; Provisional 99.34
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.3
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.23
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.02
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.0
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.96
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.95
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.91
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.89
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.88
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.87
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.81
PHA02926242 zinc finger-like protein; Provisional 98.79
PF1463444 zf-RING_5: zinc-RING finger domain 98.77
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.7
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.7
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.67
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.63
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.59
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.51
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.42
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.36
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.32
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.3
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.3
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.15
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.09
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.99
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.98
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.94
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.84
COG52191525 Uncharacterized conserved protein, contains RING Z 97.76
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.7
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.6
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.58
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.58
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.57
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.57
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.57
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.45
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.4
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.31
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.31
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.16
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.09
KOG1941518 consensus Acetylcholine receptor-associated protei 96.83
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.8
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.77
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.7
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.7
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.59
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.56
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.52
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.42
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.28
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.21
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.2
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.17
PHA02862156 5L protein; Provisional 96.02
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.97
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.81
PHA02825162 LAP/PHD finger-like protein; Provisional 95.61
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.32
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.09
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.03
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.78
COG5152259 Uncharacterized conserved protein, contains RING a 94.65
KOG2660 331 consensus Locus-specific chromosome binding protei 94.53
PHA03096284 p28-like protein; Provisional 94.32
KOG1940276 consensus Zn-finger protein [General function pred 94.26
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.26
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 94.08
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 93.7
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.49
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 93.49
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.9
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 92.86
PF04641260 Rtf2: Rtf2 RING-finger 92.36
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 92.29
COG5175 480 MOT2 Transcriptional repressor [Transcription] 91.93
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 91.32
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.3
KOG4739 233 consensus Uncharacterized protein involved in syna 91.15
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 91.1
PLN02189 1040 cellulose synthase 91.01
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 90.72
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.66
PLN02436 1094 cellulose synthase A 89.58
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 88.53
COG5222427 Uncharacterized conserved protein, contains RING Z 88.47
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 88.18
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 87.17
PLN02400 1085 cellulose synthase 86.74
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 86.24
KOG3053 293 consensus Uncharacterized conserved protein [Funct 86.17
KOG3002 299 consensus Zn finger protein [General function pred 85.34
KOG03091081 consensus Conserved WD40 repeat-containing protein 85.18
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 85.14
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 83.96
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 83.58
KOG3899381 consensus Uncharacterized conserved protein [Funct 82.42
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 81.75
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 81.47
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 81.26
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 80.21
>PF13947 GUB_WAK_bind: Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information
Probab=99.77  E-value=1.3e-18  Score=139.95  Aligned_cols=96  Identities=34%  Similarity=0.753  Sum_probs=75.8

Q ss_pred             CCCCCCCCCCCCCceecceeeCCCCCCCCCC-CCceEEecCCCCCceEeeCCceEEEEEEEcCCcEEEEecC--CCCCcc
Q 043654           27 QNCSSVSCRRDEPWIRFPFRITTRQPESCGY-PGFNVSCDSSSSQTILELPSGKFSLQAIDYDAQQIWINDQ--SNCLPQ  103 (390)
Q Consensus        27 ~~C~~~~CG~~~~~I~yPF~~~~~~~~~Cg~-p~f~L~C~~~~~~~~l~~~~~~~~V~~I~~~~~~i~v~~~--~~C~~~  103 (390)
                      ++|+ .+||  +++|+||||+++    +|++ |+|+|.|+++.+.++|.+..+.|+|++|+|++++|+|.++  ..|...
T Consensus         2 ~~C~-~~CG--nv~IpYPFgi~~----~C~~~~~F~L~C~~~~~~~~l~l~~~~~~V~~I~~~~~~i~v~~~~~~~~~~~   74 (106)
T PF13947_consen    2 PGCP-SSCG--NVSIPYPFGIGP----GCGRDPGFELTCNNNTSPPKLLLSSGNYEVLSISYENGTIRVSDPISSNCYSS   74 (106)
T ss_pred             CCCC-CccC--CEeecCCCccCC----CCCCCCCcEEECCCCCCCceeEecCCcEEEEEEecCCCEEEEEeccccceecC
Confidence            5797 4999  688999999975    5999 9999999988667888888899999999999999999995  344332


Q ss_pred             cc-----cccccCCCCc-eeecccceEEEecCC
Q 043654          104 KI-----LSLNLSGSPF-KALYNQQFTFFNCSS  130 (390)
Q Consensus       104 ~~-----~~~~~~~~~f-~~~~~~~~~~~~C~~  130 (390)
                      ..     .++++.. || .+...|.++++||++
T Consensus        75 ~~~~~~~~~~~~~~-~~~~s~~~N~~~~~GC~t  106 (106)
T PF13947_consen   75 SSSNSSNSNLSLNG-PFFFSSSSNKFTVVGCNT  106 (106)
T ss_pred             CCCcccccEEeecC-CceEccCCcEEEEECCCC
Confidence            11     2334444 66 667778899999974



>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14380 WAK_assoc: Wall-associated receptor kinase C-terminal Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 9e-09
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 7e-08
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-05
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 2e-05
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-05
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 3e-05
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure

Iteration: 1

Score = 57.8 bits (138), Expect = 9e-09, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 31/47 (65%) Query: 320 DDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCR 366 D C +CLAE + E + +P C H FHA+CVD WL ++TCP+CR Sbjct: 4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 50
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-21
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-21
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 8e-21
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-18
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-18
2ect_A78 Ring finger protein 126; metal binding protein, st 1e-16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-16
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 5e-16
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-13
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 4e-12
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-10
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 6e-10
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 1e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-09
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 7e-09
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 5e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 5e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 8e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-06
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 2e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-04
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 3e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 4e-06
3nw0_A238 Non-structural maintenance of chromosomes element 2e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 3e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 4e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 5e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 7e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 86.6 bits (215), Expect = 2e-21
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 301 TIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNA 360
           +    P      +    + +   C +C+ +++ ++ L+ +P C H FHA CVD+WL+ N 
Sbjct: 5   SSGQLPSYRFNPNNH--QSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANR 61

Query: 361 TCPVCRNSPA 370
           TCP+CR    
Sbjct: 62  TCPICRADSG 71


>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.69
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.61
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.55
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.55
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.53
2ect_A78 Ring finger protein 126; metal binding protein, st 99.53
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.48
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.43
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.39
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.38
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.38
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.37
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.35
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.35
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.35
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.3
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.29
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.26
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.26
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.22
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.21
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.2
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.19
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.18
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.16
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.15
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.13
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.11
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.11
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.09
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.08
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.03
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.02
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.02
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.01
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.0
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.99
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.97
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.94
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.94
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.88
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.87
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.86
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.85
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.84
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.84
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.83
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.82
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.81
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.74
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.71
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.71
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.7
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.64
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.62
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.62
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.57
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.52
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.48
2ea5_A68 Cell growth regulator with ring finger domain prot 98.45
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.44
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.42
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.33
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.24
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.22
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.1
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.04
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.98
3nw0_A238 Non-structural maintenance of chromosomes element 97.63
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 95.07
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.53
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.26
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 92.59
1we9_A64 PHD finger family protein; structural genomics, PH 89.47
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 86.53
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 85.24
2klu_A70 T-cell surface glycoprotein CD4; cell membrane, di 83.79
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 83.65
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 83.47
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 82.52
1wil_A89 KIAA1045 protein; ring finger domain, structural g 80.99
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.69  E-value=4.2e-17  Score=126.26  Aligned_cols=83  Identities=30%  Similarity=0.660  Sum_probs=70.1

Q ss_pred             CCCCCcccCCCChhhhhcCCceeeccCCCCCCCCCCcccccccccCCCCcEEEcCCCCCcccHhhHHHHHhCCCCCcccC
Q 043654          287 VAPQPTVIAGLDGPTIESYPKIVLGESRRLPKPDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCR  366 (390)
Q Consensus       287 ~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~C~ICl~~~~~~~~~~~l~~C~H~FH~~Ci~~wl~~~~~CP~CR  366 (390)
                      .........+++++.++.+|.+.+..... ....+..|+||+++|..++.++.++ |+|.||..||+.|++.+.+||+||
T Consensus         7 ~~~~~~~~~~~s~~~i~~lp~~~~~~~~~-~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr   84 (91)
T 2l0b_A            7 HHSHMVANPPASKESIDALPEILVTEDHG-AVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCR   84 (91)
T ss_dssp             CSCCSSCCCCCCHHHHHTSCEEECCTTCS-SSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTC
T ss_pred             cCCCCcCCCCCCHHHHHhCCCeeeccccc-ccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcC
Confidence            33444555689999999999988775432 2456788999999999999999999 999999999999999999999999


Q ss_pred             CcCCC
Q 043654          367 NSPAR  371 (390)
Q Consensus       367 ~~~~~  371 (390)
                      +++..
T Consensus        85 ~~~~~   89 (91)
T 2l0b_A           85 CMFPP   89 (91)
T ss_dssp             CBSSC
T ss_pred             ccCCC
Confidence            98765



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2klu_A T-cell surface glycoprotein CD4; cell membrane, disulfide bond, HOST- virus interaction, immune response, immunoglobulin domain, lipoprotein; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 390
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-16
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-10
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-09
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 3e-07
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 6e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-04
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 4e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 71.1 bits (174), Expect = 1e-16
 Identities = 23/49 (46%), Positives = 32/49 (65%)

Query: 320 DDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNS 368
           D   C +CLAE +  E  + +P C H FHA+CVD WL  ++TCP+CR +
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.7
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.53
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.45
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.42
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.37
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.35
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.27
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.19
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.11
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.06
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.03
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.89
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.83
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.82
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.65
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.45
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 95.25
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 91.24
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 90.87
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 83.63
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 82.81
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 81.95
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 80.78
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 80.04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.70  E-value=2.5e-18  Score=117.81  Aligned_cols=52  Identities=44%  Similarity=0.993  Sum_probs=47.7

Q ss_pred             CCCCcccccccccCCCCcEEEcCCCCCcccHhhHHHHHhCCCCCcccCCcCC
Q 043654          319 PDDNTCPICLAEYKPKETLKTIPECTHCFHADCVDEWLRLNATCPVCRNSPA  370 (390)
Q Consensus       319 ~~~~~C~ICl~~~~~~~~~~~l~~C~H~FH~~Ci~~wl~~~~~CP~CR~~~~  370 (390)
                      +++.+|+||+++|..++.+++++.|+|.||.+||++|++.+.+||+||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            4567899999999999999988779999999999999999999999999874



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure