Citrus Sinensis ID: 043717

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MGTRMIGPQPLIFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIGQFPGLESVKKEQVQAYQLTS
cccEEEccccEEEEccccEEEEccHHHHHHHHHcccHHHcccccccHHHHcccccccccccccccccccccccccccccEEEEEccccccccEEEEcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccccccccEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHcc
cccEEccccccEEcccHEEEEcccHHHHHHHHccccccccccccccEEEEEccEEEcccccccccEEEcccccccccEcEEEEEcccccHHHHHccccHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccccEEEccccccEEcccHcccccHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccccHHHHHHHHcc
mgtrmigpqplifdhaaqfftvTDSRFMSWLMVGWREvwcdhgktsmvsivrpcwisnlepfngmwhlrenvkprgqFDVVVIAHNGKcanwllgssglPQIARQMKENIPTATAEKVKKGMLEGVEAalgrpkgslqkpiytRVHLwgaalptntpsipcifdphgragicgnwllgSSVESAALSGMALANHIADylgsggvrpeefavglhnefqlleghdigqfpglesvkKEQVQAYQLTS
mgtrmigpqpliFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLEGVEAalgrpkgslqKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIGQFPGLESVKKEQVQAYQLTS
MGTRMIGPQPLIFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIGQFPGLESVKKEQVQAYQLTS
********QPLIFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQI**********************************LQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIGQFPG****************
**TR***PQPLIFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIAD****************HNEFQLLEGHDIG********************
MGTRMIGPQPLIFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIGQFPGLESV************
*GTRMIGPQPLIFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIGQFPGLESV************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTRMIGPQPLIFDHAAQFFTVTDSRFMSWLMVGWREVWCDHGKTSMVSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIGQFPGLESVKKEQVQAYQLTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
224130614 496 predicted protein [Populus trichocarpa] 0.569 0.282 0.801 5e-59
225463946 467 PREDICTED: uncharacterized protein LOC10 0.569 0.299 0.751 3e-56
296087896 518 unnamed protein product [Vitis vinifera] 0.560 0.266 0.762 4e-56
449443231 545 PREDICTED: uncharacterized protein LOC10 0.386 0.174 0.765 9e-53
449483109 536 PREDICTED: uncharacterized protein LOC10 0.386 0.177 0.765 1e-52
18396966 486 FAD/NAD(P)-binding oxidoreductase domain 0.560 0.283 0.705 2e-51
297828968 485 oxidoreductase [Arabidopsis lyrata subsp 0.560 0.284 0.697 2e-51
115489414 497 Os12g0597400 [Oryza sativa Japonica Grou 0.560 0.277 0.697 1e-49
125537277 497 hypothetical protein OsI_38983 [Oryza sa 0.560 0.277 0.697 1e-49
326493132 469 predicted protein [Hordeum vulgare subsp 0.560 0.294 0.690 1e-49
>gi|224130614|ref|XP_002328333.1| predicted protein [Populus trichocarpa] gi|222838048|gb|EEE76413.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (87%), Gaps = 1/141 (0%)

Query: 107 KENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPH 166
           +ENIPTATAEKVK GMLEGVEAALG PK SLQ+P Y+RV LWGAALPTNTP IPCIFDPH
Sbjct: 356 QENIPTATAEKVKTGMLEGVEAALGLPKDSLQQPFYSRVQLWGAALPTNTPGIPCIFDPH 415

Query: 167 GRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIG 226
           GRAGICG+WLLGS++ESAALSGMALANHIADYL SGG RPEEFA+GL+ EFQ LEGHDIG
Sbjct: 416 GRAGICGDWLLGSNLESAALSGMALANHIADYLRSGGARPEEFALGLNKEFQTLEGHDIG 475

Query: 227 QFPGLE-SVKKEQVQAYQLTS 246
           QF GLE S     +QAYQL++
Sbjct: 476 QFSGLESSTGASPIQAYQLST 496

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225463946|ref|XP_002268010.1| PREDICTED: uncharacterized protein LOC100241002 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087896|emb|CBI35179.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449443231|ref|XP_004139383.1| PREDICTED: uncharacterized protein LOC101219713 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483109|ref|XP_004156495.1| PREDICTED: uncharacterized protein LOC101226129 [Cucumis sativus] Back     alignment and taxonomy information
>gi|18396966|ref|NP_566235.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|6175169|gb|AAF04895.1|AC011437_10 unknown protein [Arabidopsis thaliana] gi|15215628|gb|AAK91359.1| AT3g04650/F7O18_13 [Arabidopsis thaliana] gi|28416461|gb|AAO42761.1| At3g04650/F7O18_13 [Arabidopsis thaliana] gi|332640593|gb|AEE74114.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828968|ref|XP_002882366.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297328206|gb|EFH58625.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|115489414|ref|NP_001067194.1| Os12g0597400 [Oryza sativa Japonica Group] gi|77556443|gb|ABA99239.1| expressed protein [Oryza sativa Japonica Group] gi|113649701|dbj|BAF30213.1| Os12g0597400 [Oryza sativa Japonica Group] gi|215701342|dbj|BAG92766.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125537277|gb|EAY83765.1| hypothetical protein OsI_38983 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|326493132|dbj|BAJ85027.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
TAIR|locus:2084903486 AT3G04650 [Arabidopsis thalian 0.560 0.283 0.705 3.3e-89
TAIR|locus:2012030384 AT1G56000 [Arabidopsis thalian 0.479 0.307 0.261 3.7e-06
TAIR|locus:2084903 AT3G04650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 532 (192.3 bits), Expect = 3.3e-89, Sum P(3) = 3.3e-89
 Identities = 98/139 (70%), Positives = 116/139 (83%)

Query:   107 KENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPH 166
             +ENIPT TAEKVK GML+GVE ALG P+GSL KP+YTR+ LWGAALP NTP++PCIFDP 
Sbjct:   347 QENIPTVTAEKVKAGMLQGVEIALGLPEGSLPKPVYTRLQLWGAALPKNTPAVPCIFDPQ 406

Query:   167 GRAGICGNWLLGSSVESAALSGMALANHIADYLGSGGVRPEEFAVGLHNEFQLLEGHDIG 226
             GRAGICG+WLLGS++ESAA+SG AL NHIA++L +G   PEEFA+GLH+    L GHDIG
Sbjct:   407 GRAGICGDWLLGSNLESAAISGAALGNHIAEFLQNGEANPEEFAIGLHDRLSPLAGHDIG 466

Query:   227 QFPGLESV-KKEQVQAYQL 244
             QFPGL SV +KE+  AYQL
Sbjct:   467 QFPGLTSVGEKEEANAYQL 485
GO:0005739 "mitochondrion" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2012030 AT1G56000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 5e-09
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
 Score = 55.6 bits (134), Expect = 5e-09
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 137 LQKPIYTRVHLWGAALPTNTPSIPCIF-DPHGRAGICGNWLLGSSVESAALSGMALANHI 195
           L +P ++  H W  A+P +  + P +  D       CG+W  G  VE A LSG+A A+HI
Sbjct: 268 LPEPDWSDAHRWRYAIPNDAVAGPPLDADRELPLYACGDWCAGGRVEGAVLSGLAAADHI 327

Query: 196 ADYL 199
            + L
Sbjct: 328 LNGL 331

Length = 331

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 100.0
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.84
PRK12416463 protoporphyrinogen oxidase; Provisional 99.81
PLN02576496 protoporphyrinogen oxidase 99.75
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.69
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.68
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.62
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.51
PRK07233434 hypothetical protein; Provisional 99.49
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.44
PLN02612567 phytoene desaturase 99.4
PLN02268435 probable polyamine oxidase 99.36
PLN02487569 zeta-carotene desaturase 99.29
PLN02529738 lysine-specific histone demethylase 1 99.26
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.26
PLN02328808 lysine-specific histone demethylase 1 homolog 99.23
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.23
PRK07208479 hypothetical protein; Provisional 99.15
PLN03000 881 amine oxidase 99.09
PLN02676487 polyamine oxidase 99.05
PLN02976 1713 amine oxidase 98.93
PLN02568539 polyamine oxidase 98.85
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.57
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.39
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.33
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.3
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 98.21
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.05
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.85
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.95
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.31
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 95.19
PRK11445351 putative oxidoreductase; Provisional 94.69
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 94.37
PRK06116450 glutathione reductase; Validated 94.26
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.02
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 94.01
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.98
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 93.81
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 93.57
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 93.56
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 93.53
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 92.93
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 92.86
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 92.62
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 92.45
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 92.22
COG2081408 Predicted flavoproteins [General function predicti 92.05
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 92.02
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 91.65
PRK14727479 putative mercuric reductase; Provisional 91.21
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 90.87
PRK06327475 dihydrolipoamide dehydrogenase; Validated 90.59
COG3349485 Uncharacterized conserved protein [Function unknow 90.58
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 90.23
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 90.11
PRK09897 534 hypothetical protein; Provisional 89.53
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 89.24
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 89.17
PLN02463 447 lycopene beta cyclase 88.44
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 88.18
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 88.17
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 87.9
PTZ00383497 malate:quinone oxidoreductase; Provisional 87.52
PTZ00052 499 thioredoxin reductase; Provisional 87.39
PRK11259376 solA N-methyltryptophan oxidase; Provisional 87.11
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 86.82
PRK06185407 hypothetical protein; Provisional 86.4
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 86.36
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 86.03
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 85.88
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 85.75
PRK08244 493 hypothetical protein; Provisional 85.74
PRK07588391 hypothetical protein; Provisional 85.25
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 85.2
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 84.69
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 84.67
PRK06847375 hypothetical protein; Provisional 84.62
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 84.54
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 84.44
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 84.28
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 83.56
PRK11728393 hydroxyglutarate oxidase; Provisional 83.52
PRK07236386 hypothetical protein; Provisional 82.4
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 82.11
PRK05976472 dihydrolipoamide dehydrogenase; Validated 81.91
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 81.81
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 81.35
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 80.56
PRK13339497 malate:quinone oxidoreductase; Reviewed 80.5
COG0579429 Predicted dehydrogenase [General function predicti 80.47
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 80.26
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 80.22
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 80.04
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-38  Score=274.51  Aligned_cols=194  Identities=28%  Similarity=0.458  Sum_probs=164.8

Q ss_pred             CcccccCCCCceeccCCceeeeCChhHHh----HHHcCceeccccC-------------------CCCcc----------
Q 043717            1 MGTRMIGPQPLIFDHAAQFFTVTDSRFMS----WLMVGWREVWCDH-------------------GKTSM----------   47 (246)
Q Consensus         1 matrR~~~~~~~~DhGAqyft~~~~~f~~----~~~~g~~~~W~~~-------------------g~p~m----------   47 (246)
                      |||||++++  .||||||||+++++.|..    |.++|++++|...                   |.|+|          
T Consensus        40 lAtRRl~~g--~~DhGAqYfk~~~~~F~~~Ve~~~~~glV~~W~~~~~~~~~~~~~~~~d~~pyvg~pgmsalak~LAtd  117 (331)
T COG3380          40 LATRRLDGG--RFDHGAQYFKPRDELFLRAVEALRDDGLVDVWTPAVWTFTGDGSPPRGDEDPYVGEPGMSALAKFLATD  117 (331)
T ss_pred             hheeccCCc--cccccceeecCCchHHHHHHHHHHhCCceeeccccccccccCCCCCCCCCCccccCcchHHHHHHHhcc
Confidence            799999976  599999999999999977    8999999999521                   45788          


Q ss_pred             eeeecCceeeEEEEeCCeEEEEeCCc-eeeccCEEEEcCCHHHHHHhhccCC--hHH-HHHHhh----------------
Q 043717           48 VSIVRPCWISNLEPFNGMWHLRENVK-PRGQFDVVVIAHNGKCANWLLGSSG--LPQ-IARQMK----------------  107 (246)
Q Consensus        48 ~~I~l~t~V~~I~~~~~~w~l~~~~g-~~~~aD~VVlA~Pa~~A~~LL~~~~--~~~-la~~L~----------------  107 (246)
                      ++|++++||+.|.+.++.|+|.++++ +...||.||||.|+||++.||....  .+. +...+.                
T Consensus       118 L~V~~~~rVt~v~~~~~~W~l~~~~g~~~~~~d~vvla~PAPQ~~~LLt~~~~~~p~~l~~~~a~V~y~Pc~s~~lg~~q  197 (331)
T COG3380         118 LTVVLETRVTEVARTDNDWTLHTDDGTRHTQFDDVVLAIPAPQTATLLTTDADDLPAALRAALADVVYAPCWSAVLGYPQ  197 (331)
T ss_pred             chhhhhhhhhhheecCCeeEEEecCCCcccccceEEEecCCCcchhhcCcccccchHHHHHhhccceehhHHHHHhcCCc
Confidence            69999999999999999999998544 6678999999999999999996521  222 221111                


Q ss_pred             --------------------------------------------hhCCCCCHHHHHHHHHHHHHHHhCCCCCCCCCCcee
Q 043717          108 --------------------------------------------ENIPTATAEKVKKGMLEGVEAALGRPKGSLQKPIYT  143 (246)
Q Consensus       108 --------------------------------------------~~~~~~~~eel~~~ll~eL~~llg~~~~~~~~p~~~  143 (246)
                                                                  +.|.+.++|.++..+...+.++.+-   .+++|.+.
T Consensus       198 ~l~~P~~G~~vdg~~laWla~d~sK~g~~p~~~~~vvqasp~wSr~h~~~~~e~~i~~l~aA~~~~~~~---~~~~p~~s  274 (331)
T COG3380         198 PLDRPWPGNFVDGHPLAWLARDASKKGHVPDGEIWVVQASPDWSREHLDHPAEQVIVALRAAAQELDGD---RLPEPDWS  274 (331)
T ss_pred             cCCCCCCCcccCCCeeeeeeccccCCCCCCcCceEEEEeCchHHHHhhcCCHHHHHHHHHHhhhhccCC---CCCcchHH
Confidence                                                        3466788999998888888888873   35689999


Q ss_pred             eeeecCccCCCCCCCCCCcc-CCCCCEEEEcCCCCCCCHHHHHHHHHHHHHHHHHHh
Q 043717          144 RVHLWGAALPTNTPSIPCIF-DPHGRAGICGNWLLGSSVESAALSGMALANHIADYL  199 (246)
Q Consensus       144 ~v~RW~~A~P~~~~g~~~~~-~~~~gL~laGDw~~G~~ie~Av~SG~~aA~~l~~~l  199 (246)
                      .+|||+||+|+...+.+++. +...+||+|||||.|+++|+|+.||.++|++|++.|
T Consensus       275 ~~H~WrYA~P~~~~~~~~L~ad~~~~l~~cGDwc~GgrVEgA~LSGlAaA~~i~~~L  331 (331)
T COG3380         275 DAHRWRYAIPNDAVAGPPLDADRELPLYACGDWCAGGRVEGAVLSGLAAADHILNGL  331 (331)
T ss_pred             HhhccccccccccccCCccccCCCCceeeecccccCcchhHHHhccHHHHHHHHhcC
Confidence            99999999999999988888 788899999999999999999999999999998754

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 5e-19
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 8e-16
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 1e-04
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 4e-04
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 4e-04
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.96
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.87
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.79
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.78
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.77
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.64
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.61
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.61
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.59
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.56
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.38
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.35
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.35
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.32
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.31
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.28
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.27
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.27
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.24
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.18
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.16
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.12
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.01
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.66
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.59
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.72
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.18
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 96.32
2cul_A232 Glucose-inhibited division protein A-related PROT 95.93
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 95.59
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 95.35
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 95.33
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 95.3
3r9u_A315 Thioredoxin reductase; structural genomics, center 95.03
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 94.65
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 94.22
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 94.0
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 93.97
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 93.78
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 93.77
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 93.42
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 93.38
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 92.83
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 92.59
3dme_A369 Conserved exported protein; structural genomics, P 92.55
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 92.45
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 92.44
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 92.43
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 92.27
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 91.95
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 91.5
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 91.47
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 91.39
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 90.6
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 90.55
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 90.53
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 90.37
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 90.1
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 89.95
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 89.78
2ywl_A180 Thioredoxin reductase related protein; uncharacter 89.69
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 89.6
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 89.51
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 88.82
2gqf_A401 Hypothetical protein HI0933; structural genomics, 88.8
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 88.6
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 88.29
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 88.24
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 88.18
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 88.16
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 87.38
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 87.01
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 86.99
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 86.92
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 86.92
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 86.55
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 85.77
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 85.71
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 85.66
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 85.44
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 85.28
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 84.71
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 84.53
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 84.38
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 84.19
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 84.17
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 84.15
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 84.1
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 84.01
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 84.0
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 83.89
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 83.87
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 83.85
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 83.81
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 83.56
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 83.53
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 83.42
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 83.21
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 83.09
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 82.71
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 82.24
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 82.16
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 81.76
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 80.37
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 80.17
1fec_A490 Trypanothione reductase; redox-active center, oxid 80.04
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=8.4e-28  Score=215.76  Aligned_cols=193  Identities=16%  Similarity=0.190  Sum_probs=150.7

Q ss_pred             cccccC-CCCceeccCCceeeeCCh---hHHh----HHHcCceeccccC--------------CCCcc------------
Q 043717            2 GTRMIG-PQPLIFDHAAQFFTVTDS---RFMS----WLMVGWREVWCDH--------------GKTSM------------   47 (246)
Q Consensus         2 atrR~~-~~~~~~DhGAqyft~~~~---~f~~----~~~~g~~~~W~~~--------------g~p~m------------   47 (246)
                      ++++.. ...+.+|||++||+.+++   .|..    |.+.|++.+|...              ..++|            
T Consensus        44 ~~~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~~l~~~~g  123 (342)
T 3qj4_A           44 TTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESG  123 (342)
T ss_dssp             CEEECSSCTTCEEESSCCCEEECSSHHHHTHHHHHHHHHTTSCEECCSCEETCCC--CCEEEECTTCTTHHHHHHHHHHT
T ss_pred             eeeecCCCCCceEecCCceEEcCchHHHHHHHHHHHHHhCCCeecCchhhcceeccCCccceecCCCHHHHHHHHHHhcC
Confidence            455543 223479999999999987   4543    7788999999632              11222            


Q ss_pred             eeeecCceeeEEEEeCCeEEEEeCCceeeccCEEEEcCCHHHHHHhhccCC--hH-HHHHHhh-----------------
Q 043717           48 VSIVRPCWISNLEPFNGMWHLRENVKPRGQFDVVVIAHNGKCANWLLGSSG--LP-QIARQMK-----------------  107 (246)
Q Consensus        48 ~~I~l~t~V~~I~~~~~~w~l~~~~g~~~~aD~VVlA~Pa~~A~~LL~~~~--~~-~la~~L~-----------------  107 (246)
                      ++|+++++|++|++.+++|+|.+++|..+.||.||+|+|++++.+||....  ++ .....+.                 
T Consensus       124 ~~i~~~~~V~~i~~~~~~~~v~~~~g~~~~ad~vV~A~p~~~~~~ll~~~~~~l~~~~~~~l~~~~~~~~~~v~l~~~~~  203 (342)
T 3qj4_A          124 AEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAG  203 (342)
T ss_dssp             CEEESSCCEEEEEECSSSEEEEESSSCCEEESEEEECSCHHHHTTCBSTHHHHSCHHHHHHHHTCCBCCEEEEEEECSSC
T ss_pred             CEEEeCCEEEEEEEcCCEEEEEECCCCEEEcCEEEECCCHHHHHHHhcccccccCHHHHHHHhcCCccccEEEEEEECCC
Confidence            689999999999999999999887775678999999999999999997421  00 1111111                 


Q ss_pred             ------------------------------------------------hhCCCCCHHHHHHHHHHHHHHHhCCCCCCCCC
Q 043717          108 ------------------------------------------------ENIPTATAEKVKKGMLEGVEAALGRPKGSLQK  139 (246)
Q Consensus       108 ------------------------------------------------~~~~~~~~eel~~~ll~eL~~llg~~~~~~~~  139 (246)
                                                                      +++.+.+++++.+.++++|+++||..    .+
T Consensus       204 ~~~~~~~~g~~~~~~~~~~~~~~~~~k~~r~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~g~~----~~  279 (342)
T 3qj4_A          204 TKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGL----PQ  279 (342)
T ss_dssp             C--CCSCSEEECSSCSSEEEEEEHHHHTTCCCC-CCCEEEEEECHHHHHHTTTSCHHHHHHHHHHHHHHHSCSC----CC
T ss_pred             CccCCceeeEEccCCcceEEEEccccCCCCCCCCCCceEEEECCHHHHHHhhcCCHHHHHHHHHHHHHHhccCC----CC
Confidence                                                            12346789999999999999999853    37


Q ss_pred             CceeeeeecCccCCCCCCC--CCCcc-CCCCCEEEEcCCCCCCCHHHHHHHHHHHHHHHHHH
Q 043717          140 PIYTRVHLWGAALPTNTPS--IPCIF-DPHGRAGICGNWLLGSSVESAALSGMALANHIADY  198 (246)
Q Consensus       140 p~~~~v~RW~~A~P~~~~g--~~~~~-~~~~gL~laGDw~~G~~ie~Av~SG~~aA~~l~~~  198 (246)
                      |.++++|||++|+|+|.+.  ..++. +..|+|++||||+.|++||+||+||+++|++|++.
T Consensus       280 p~~~~v~rW~~a~p~~~~~~~~~~~~~~~~~~l~laGd~~~g~~v~~ai~sg~~aa~~i~~~  341 (342)
T 3qj4_A          280 PIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNY  341 (342)
T ss_dssp             CSEEEEEEETTCSBSSCCSSSCSCEEEETTTEEEECSGGGSCSSHHHHHHHHHHHHHHHTTC
T ss_pred             CceeeeccccccccccccCCCcceeEecCCccEEEEccccCCCCccHHHHHHHHHHHHHHhh
Confidence            9999999999999999772  23444 67799999999999999999999999999998764
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 246
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 0.004
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Protoporphyrinogen oxidase
species: Tobacco (Nicotiana tabacum) [TaxId: 4097]

 Score = 35.6 bits (80), Expect = 0.004
 Identities = 14/57 (24%), Positives = 20/57 (35%), Gaps = 7/57 (12%)

Query: 143 TRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIADYL 199
                   A+     ++P +F         GN   G SV  A  SG   A+ +  YL
Sbjct: 320 HNYDSVLDAIDKMEKNLPGLF-------YAGNHRGGLSVGKALSSGCNAADLVISYL 369

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.16
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.58
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.31
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.3
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.96
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.6
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.3
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.17
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 96.5
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 96.26
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.54
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 95.44
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 94.67
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.33
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.32
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.04
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.01
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.88
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.71
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.32
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.57
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.35
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.87
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 91.64
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.23
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.83
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.81
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.47
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 89.01
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.76
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.36
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 85.08
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 84.36
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.1
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 83.83
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 83.69
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 83.23
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 83.11
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 83.03
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 82.2
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Protoporphyrinogen oxidase
species: Myxococcus xanthus [TaxId: 34]

Probab=99.16  E-value=1.2e-10  Score=96.17  Aligned_cols=110  Identities=16%  Similarity=0.130  Sum_probs=73.8

Q ss_pred             eeeecCceeeEEEEeCCeEEEEe-CCc--eeeccCEEEEcCCHHHHHHhhccCChHHHHHHhhhhCCCCCHHHHHHHHHH
Q 043717           48 VSIVRPCWISNLEPFNGMWHLRE-NVK--PRGQFDVVVIAHNGKCANWLLGSSGLPQIARQMKENIPTATAEKVKKGMLE  124 (246)
Q Consensus        48 ~~I~l~t~V~~I~~~~~~w~l~~-~~g--~~~~aD~VVlA~Pa~~A~~LL~~~~~~~la~~L~~~~~~~~~eel~~~ll~  124 (246)
                      ++|+++++|++|+..+++|.+.. +++  .++.||.||+|+|++.+.+||++.. +.+...+                  
T Consensus       234 ~~i~~~~~V~~I~~~~~~~~v~~~~~~~~~~~~ad~VV~a~p~~~~~~Ll~~~~-~~~~~~~------------------  294 (347)
T d2ivda1         234 DAAHVGARVEGLAREDGGWRLIIEEHGRRAELSVAQVVLAAPAHATAKLLRPLD-DALAALV------------------  294 (347)
T ss_dssp             GGEESSEEEEEEECC--CCEEEEEETTEEEEEECSEEEECSCHHHHHHHHTTTC-HHHHHHH------------------
T ss_pred             cccccCCEEEEEEEeCCeEEEEEEcCCeEEEEECCEEEECCCHHHHHHhccCCC-HHHHHHh------------------
Confidence            47999999999999988888765 332  4678999999999999999998652 2221111                  


Q ss_pred             HHHHHhCCCCCCCCCCceeeeeecCccCCCCCCCCCCccCCCCCEEEEcCCCCCCCHHHHHHHHHHHHHHHH
Q 043717          125 GVEAALGRPKGSLQKPIYTRVHLWGAALPTNTPSIPCIFDPHGRAGICGNWLLGSSVESAALSGMALANHIA  196 (246)
Q Consensus       125 eL~~llg~~~~~~~~p~~~~v~RW~~A~P~~~~g~~~~~~~~~gL~laGDw~~G~~ie~Av~SG~~aA~~l~  196 (246)
                        ..++.       .+....+.....           .....|+|++|||++.|.++++|+.+|..+|++|.
T Consensus       295 --~~~~~-------~~~~~~~~~~~~-----------~~~~~p~~~~~G~~~~g~~~~~~~~~g~~~a~~~~  346 (347)
T d2ivda1         295 --AGIYN-------LGHLERVAAIDA-----------ALQRLPGLHLIGNAYKGVGLNDCIRNAAQLADALV  346 (347)
T ss_dssp             --HTCCB-------TTHHHHHHHHHH-----------HHHTSTTEEECSTTTSCCSHHHHHHHHHHHHHHHC
T ss_pred             --hccee-------cCcccceecccc-----------cccCCCCEEEecccccCCCHHHHHHHHHHHHHHhh
Confidence              11110       000000000000           11334799999999999999999999999999875
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure