Citrus Sinensis ID: 043903


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MKLEKLKGNFSRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFGVGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK
cccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHcccccccEEEEcccEEEEEEEEEcccEEEEEccccEEEcccccc
ccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccEEEccEEEEccEEEEEccccEEEEccccc
mkleklkgnfsrpsratlVPIVTLIKILSLQitkkpvlslrrvgfsgaegalfnpatcvaglpgdqylpkrkVVMSIkdfgvgdgttsTTEVFRKAVRYVQAFgdkggtqlnvpeglwltgsfiltsnfTLFLQKGAVILGSQELK
mkleklkgnfsrpsratlvPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDfgvgdgttstteVFRKAVRYVQAFgdkggtqlNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK
MKLEKLKGNFSRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFGVGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK
***************ATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFGVGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVIL******
*************SRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFGVGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQE**
MKLEKLKGNFSRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFGVGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK
*KLEKLKGNFSRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFGVGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLEKLKGNFSRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFGVGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
A7PZL3 491 Probable polygalacturonas no no 0.479 0.142 0.563 2e-15
P15922 602 Exo-poly-alpha-D-galactur N/A no 0.438 0.106 0.385 0.0001
>sp|A7PZL3|PGLR_VITVI Probable polygalacturonase OS=Vitis vinifera GN=GSVIVT00026920001 PE=1 SV=1 Back     alignment and function desciption
 Score = 81.3 bits (199), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (71%), Gaps = 1/71 (1%)

Query: 76  SIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQ 134
           S+ DFG VGDG T  T+ F+ AV  +  +G +GG QL VP G WLTGSF LTS+FTLFL 
Sbjct: 64  SLVDFGGVGDGQTLNTKAFQDAVSELSKYGSEGGAQLYVPAGKWLTGSFSLTSHFTLFLH 123

Query: 135 KGAVILGSQEL 145
           + AV+L SQ++
Sbjct: 124 RDAVLLASQDI 134





Vitis vinifera (taxid: 29760)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 5
>sp|P15922|PEHX_ERWCH Exo-poly-alpha-D-galacturonosidase OS=Erwinia chrysanthemi GN=pehX PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
225431447 488 PREDICTED: probable polygalacturonase [V 0.931 0.278 0.542 1e-29
147776708 479 hypothetical protein VITISV_043959 [Viti 0.931 0.283 0.542 2e-29
296088539 528 unnamed protein product [Vitis vinifera] 0.931 0.257 0.542 2e-29
357464681 775 Germin-like protein [Medicago truncatula 0.931 0.175 0.478 3e-28
255571381 480 polygalacturonase, putative [Ricinus com 0.924 0.281 0.52 2e-27
297802658 475 glycoside hydrolase family 28 protein [A 0.876 0.269 0.522 4e-27
356516364 477 PREDICTED: probable polygalacturonase-li 0.904 0.276 0.517 6e-27
22329119 475 glycoside hydrolase family 28 protein / 0.876 0.269 0.522 9e-27
4490311 462 putative protein [Arabidopsis thaliana] 0.890 0.281 0.507 2e-26
224096000 445 predicted protein [Populus trichocarpa] 0.705 0.231 0.592 2e-26
>gi|225431447|ref|XP_002274138.1| PREDICTED: probable polygalacturonase [Vitis vinifera] Back     alignment and taxonomy information
 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 97/140 (69%), Gaps = 4/140 (2%)

Query: 8   GNFSRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQY 67
           G F+RPS A L+ +  ++ +   QI  K V   R V   G E  +   A    GL  +  
Sbjct: 13  GGFTRPSWAFLLLVFIVLVVSCFQIGTKTVFP-RWVVLGGGETGISEEAPSCFGLFRE-- 69

Query: 68  LPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILT 126
           +P RKVVMSI+DFG VGDG TS TE FR+A+RY+Q+FG+ GG+QLNVP G W+TGSF LT
Sbjct: 70  VPPRKVVMSIRDFGGVGDGVTSNTETFRRAIRYMQSFGNIGGSQLNVPRGRWVTGSFNLT 129

Query: 127 SNFTLFLQKGAVILGSQELK 146
           SNFTLFL++GAVILGSQ+L+
Sbjct: 130 SNFTLFLEEGAVILGSQDLE 149




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147776708|emb|CAN76963.1| hypothetical protein VITISV_043959 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088539|emb|CBI37530.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357464681|ref|XP_003602622.1| Germin-like protein [Medicago truncatula] gi|355491670|gb|AES72873.1| Germin-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255571381|ref|XP_002526639.1| polygalacturonase, putative [Ricinus communis] gi|223534031|gb|EEF35751.1| polygalacturonase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297802658|ref|XP_002869213.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. lyrata] gi|297315049|gb|EFH45472.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356516364|ref|XP_003526865.1| PREDICTED: probable polygalacturonase-like [Glycine max] Back     alignment and taxonomy information
>gi|22329119|ref|NP_195070.2| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] gi|27754320|gb|AAO22613.1| putative polygalacturonase [Arabidopsis thaliana] gi|28393881|gb|AAO42348.1| putative polygalacturonase [Arabidopsis thaliana] gi|332660825|gb|AEE86225.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4490311|emb|CAB38802.1| putative protein [Arabidopsis thaliana] gi|7270292|emb|CAB80061.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224096000|ref|XP_002310517.1| predicted protein [Populus trichocarpa] gi|222853420|gb|EEE90967.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:2119156 475 AT4G33440 [Arabidopsis thalian 0.876 0.269 0.522 5e-27
TAIR|locus:2083383 446 AT3G06770 [Arabidopsis thalian 0.554 0.181 0.573 4.4e-17
TAIR|locus:504954979 449 AT5G49215 [Arabidopsis thalian 0.479 0.155 0.619 2e-16
TAIR|locus:2086740 455 AT3G16850 [Arabidopsis thalian 0.527 0.169 0.576 4.5e-16
TAIR|locus:2101313 469 AT3G48950 [Arabidopsis thalian 0.506 0.157 0.56 3.6e-15
TAIR|locus:2117964 495 AT4G23500 [Arabidopsis thalian 0.472 0.139 0.6 6.7e-15
TAIR|locus:2098038 471 AT3G62110 [Arabidopsis thalian 0.465 0.144 0.579 9.9e-15
TAIR|locus:2061396 477 AT2G23900 [Arabidopsis thalian 0.506 0.155 0.546 1.7e-14
TAIR|locus:2082787 476 AT3G61490 [Arabidopsis thalian 0.479 0.147 0.535 2.8e-14
TAIR|locus:2078531 484 AT3G42950 [Arabidopsis thalian 0.534 0.161 0.537 3.7e-14
TAIR|locus:2119156 AT4G33440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 306 (112.8 bits), Expect = 5.0e-27, P = 5.0e-27
 Identities = 71/136 (52%), Positives = 93/136 (68%)

Query:    11 SRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPK 70
             +RPS A L+ + T++ ILSLQI+    L L  +  S  +    +P TC      D + P 
Sbjct:    15 TRPSWAFLLLVFTVLAILSLQISSNSFLPLW-IPTSQYD----DPVTCSGFFNHDPF-PN 68

Query:    71 RKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNF 129
             R +VMSI DFG VGDG TS T  FR+AVR+++ F  +GG QLNVPEG WL+GSF LTSNF
Sbjct:    69 R-IVMSITDFGGVGDGKTSNTAAFRRAVRHLEGFAAEGGAQLNVPEGTWLSGSFNLTSNF 127

Query:   130 TLFLQKGAVILGSQEL 145
             TLFL++GA+ILGS++L
Sbjct:   128 TLFLERGALILGSKDL 143




GO:0004650 "polygalacturonase activity" evidence=IEA;ISS
GO:0005975 "carbohydrate metabolic process" evidence=IEA;ISS
TAIR|locus:2083383 AT3G06770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954979 AT5G49215 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086740 AT3G16850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101313 AT3G48950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117964 AT4G23500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098038 AT3G62110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061396 AT2G23900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082787 AT3G61490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078531 AT3G42950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034796001
SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (488 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00008525001
SubName- Full=Chromosome undetermined scaffold_1529, whole genome shotgun sequence; (224 aa)
       0.418

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
COG5434 542 COG5434, PGU1, Endopygalactorunase [Cell envelope 6e-09
>gnl|CDD|227721 COG5434, PGU1, Endopygalactorunase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
 Score = 52.9 bits (127), Expect = 6e-09
 Identities = 33/98 (33%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 46  SGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFG 104
            G+E    +PA  +     D          S+ D G VGDG T  T   + A+    + G
Sbjct: 61  EGSESEDSSPAINIKTAATDT-------AFSVSDDGAVGDGATDNTAAIQAAIDACASAG 113

Query: 105 DKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGS 142
             GGT + +P G +L+G   L SN TL L +GA +L S
Sbjct: 114 --GGT-VLLPAGTYLSGPLFLKSNVTLHLAEGATLLAS 148


Length = 542

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
COG5434 542 PGU1 Endopygalactorunase [Cell envelope biogenesis 99.83
PLN02155 394 polygalacturonase 99.7
PLN02793 443 Probable polygalacturonase 99.69
PLN02218 431 polygalacturonase ADPG 99.64
PLN03010 409 polygalacturonase 99.62
PLN02188 404 polygalacturonase/glycoside hydrolase family prote 99.61
PF12708 225 Pectate_lyase_3: Pectate lyase superfamily protein 99.56
PLN03003 456 Probable polygalacturonase At3g15720 99.47
TIGR03808 455 RR_plus_rpt_1 twin-arg-translocated uncharacterize 99.29
TIGR03805 314 beta_helix_1 parallel beta-helix repeat-containing 95.8
PF1221867 End_N_terminal: N terminal extension of bacterioph 95.67
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 92.61
PLN02480 343 Probable pectinesterase 90.34
PF03718 582 Glyco_hydro_49: Glycosyl hydrolase family 49; Inte 88.4
PF07602 246 DUF1565: Protein of unknown function (DUF1565); In 87.93
>COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
Probab=99.83  E-value=1.3e-20  Score=169.63  Aligned_cols=110  Identities=30%  Similarity=0.434  Sum_probs=100.1

Q ss_pred             HhCCCCCCcceeEEEEeeccCCCCCcCCcceeeccCCCCCCCCCCCeeEeeeecc-CCCCcchhHHHHHHHHHHhhhcCC
Q 043903           27 ILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGD  105 (146)
Q Consensus        27 ~~~L~p~t~y~~~vr~v~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~nV~dfG-~gDG~tDdT~A~q~Ai~aa~~~~~  105 (146)
                      .+++.|++.|.+++|.++.++.++.++.++.|.       ++.+....++|.+|| ++||.+||++|||+||++|+   .
T Consensus        42 ~~~~~~~~~~p~~~~~~~~~~~e~~~~~~~~~~-------~~~~~~t~~sv~~~ga~gDG~t~~~~aiq~AI~~ca---~  111 (542)
T COG5434          42 SSNLVPNTALPDTVRSFNAEGSESEDSSPAINI-------KTAATDTAFSVSDDGAVGDGATDNTAAIQAAIDACA---S  111 (542)
T ss_pred             ccCccccccCCcceeeeccccccccccccceec-------ccccccceeeeccccccccCCccCHHHHHHHHHhhh---h
Confidence            367889999999999999999999998877663       245566789999999 99999999999999999998   5


Q ss_pred             CCCcEEEecCCEEEEeeEEeCCCeEEEEccCcEEEeCCCCC
Q 043903          106 KGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK  146 (146)
Q Consensus       106 ~gg~~V~IP~G~Yltg~l~L~SnvtL~l~~gAtL~as~d~~  146 (146)
                      .+|++|+||+|+|++|+|+|||+|+|++++||||+++.+|+
T Consensus       112 a~Gg~V~lPaGtylsg~l~LKS~~~L~l~egatl~~~~~p~  152 (542)
T COG5434         112 AGGGTVLLPAGTYLSGPLFLKSNVTLHLAEGATLLASSNPK  152 (542)
T ss_pred             hcCceEEECCceeEeeeEEEecccEEEecCCceeeCCCChh
Confidence            79999999999999999999999999999999999999874



>PLN02155 polygalacturonase Back     alignment and domain information
>PLN02793 Probable polygalacturonase Back     alignment and domain information
>PLN02218 polygalacturonase ADPG Back     alignment and domain information
>PLN03010 polygalacturonase Back     alignment and domain information
>PLN02188 polygalacturonase/glycoside hydrolase family protein Back     alignment and domain information
>PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A Back     alignment and domain information
>PLN03003 Probable polygalacturonase At3g15720 Back     alignment and domain information
>TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein Back     alignment and domain information
>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein Back     alignment and domain information
>PF12218 End_N_terminal: N terminal extension of bacteriophage endosialidase; InterPro: IPR024429 This entry represents the N-terminal extension domain of endosialidases which is approximately 70 amino acids in length Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PLN02480 Probable pectinesterase Back     alignment and domain information
>PF03718 Glyco_hydro_49: Glycosyl hydrolase family 49; InterPro: IPR005192 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07602 DUF1565: Protein of unknown function (DUF1565); InterPro: IPR011459 These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
2uve_A 608 Structure Of Yersinia Enterocolitica Family 28 Exop 2e-06
3jur_A 448 The Crystal Structure Of A Hyperthermoactive Exopol 3e-06
>pdb|2UVE|A Chain A, Structure Of Yersinia Enterocolitica Family 28 Exopolygalacturonase Length = 608 Back     alignment and structure

Iteration: 1

Score = 47.8 bits (112), Expect = 2e-06, Method: Composition-based stats. Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 11/97 (11%) Query: 48 AEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDK 106 A+G+L VA P + +++++DFG + DG T T+ ++A+ K Sbjct: 135 ADGSL-----SVASKPITAKTSAKPQIVNVRDFGAIDDGKTLNTKAIQQAIDSC-----K 184 Query: 107 GGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQ 143 G ++ +P G + +G+ L S+ TL LQ GA++LGS+ Sbjct: 185 PGCRVEIPAGTYKSGALWLKSDMTLNLQAGAILLGSE 221
>pdb|3JUR|A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima Length = 448 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 3e-20
1h80_A 464 IOTA-carrageenase; hydrolase, IOTA-carrageenan dou 7e-18
3jur_A 448 EXO-poly-alpha-D-galacturonosidase; beta-helix, ce 1e-16
2pyg_A 377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 2e-15
1bhe_A 376 PEHA, polygalacturonase; family 28 glycosyl hydrol 1e-11
2x6w_A 600 Tail spike protein; viral protein, beta-helix, hyd 2e-10
3gqn_A 772 Preneck appendage protein; beta helix, beta barrel 1e-06
3gq8_A 609 Preneck appendage protein; beta helix, viral prote 5e-06
2vbk_A 514 Tailspike-protein; viral adhesion protein, viral p 2e-05
1czf_A 362 Polygalacturonase II; beta helix, hydrolase; HET: 2e-04
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Length = 608 Back     alignment and structure
 Score = 85.1 bits (210), Expect = 3e-20
 Identities = 27/94 (28%), Positives = 50/94 (53%), Gaps = 6/94 (6%)

Query: 54  NPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLN 112
           + +  VA  P       +  +++++DFG + DG T  T+  ++A+        K G ++ 
Sbjct: 136 DGSLSVASKPITAKTSAKPQIVNVRDFGAIDDGKTLNTKAIQQAIDSC-----KPGCRVE 190

Query: 113 VPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK 146
           +P G + +G+  L S+ TL LQ GA++LGS+   
Sbjct: 191 IPAGTYKSGALWLKSDMTLNLQAGAILLGSENPD 224


>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A Length = 464 Back     alignment and structure
>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Length = 448 Back     alignment and structure
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Length = 377 Back     alignment and structure
>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Length = 376 Back     alignment and structure
>2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A* Length = 600 Back     alignment and structure
>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Length = 609 Back     alignment and structure
>2vbk_A Tailspike-protein; viral adhesion protein, viral protein, hydrolase, endorhamnosidase, right-handed parallel beta-helix; 1.25A {Enterobacteria phage SF6} PDB: 2vbe_A 2vbm_A* Length = 514 Back     alignment and structure
>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 99.89
3jur_A 448 EXO-poly-alpha-D-galacturonosidase; beta-helix, ce 99.74
1h80_A 464 IOTA-carrageenase; hydrolase, IOTA-carrageenan dou 99.68
2pyg_A 377 Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli 99.58
2vbk_A 514 Tailspike-protein; viral adhesion protein, viral p 99.54
2x6w_A 600 Tail spike protein; viral protein, beta-helix, hyd 99.47
1rmg_A 422 Rgase A, rhamnogalacturonase A; hydrolase, inverti 99.47
1bhe_A 376 PEHA, polygalacturonase; family 28 glycosyl hydrol 99.44
3gq8_A 609 Preneck appendage protein; beta helix, viral prote 99.36
3eqn_A 758 Glucan 1,3-beta-glucosidase; tandem beta-helix dom 99.36
3gqn_A 772 Preneck appendage protein; beta helix, beta barrel 99.32
3eqn_A 758 Glucan 1,3-beta-glucosidase; tandem beta-helix dom 99.23
1x0c_A 549 Isopullulanase; glycoside hydrolase family 49, gly 98.32
2inu_A 410 Insulin fructotransferase; right-handed parallel b 97.85
1ogo_X 574 Dextranase; hydrolase, dextran degradation, glycos 97.83
2iq7_A 339 Endopolygalacturonase; parallel beta helix, hydrol 97.72
1hg8_A 349 Endopolygalacturonase; hydrolase, pectin degradati 97.71
1nhc_A 336 Polygalacturonase I; beta-helix, hydrolase; HET: M 97.59
1ia5_A 339 Polygalacturonase; glycosylhydrolase, hydrolase; H 97.45
1czf_A 362 Polygalacturonase II; beta helix, hydrolase; HET: 97.21
1k5c_A 335 Endopolygalacturonase; beta helical structure, gly 96.85
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 96.02
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 95.87
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 95.5
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 94.73
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 94.2
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 94.14
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 93.97
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 93.73
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 93.6
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 93.49
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 93.46
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 93.44
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 93.34
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 93.34
3t04_D103 Monobody 7C12; engineered binding protein, antibod 93.21
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 93.11
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 93.11
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 93.03
1x5x_A109 Fibronectin type-III domain containing protein 3A; 92.95
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 92.88
1xg2_A 317 Pectinesterase 1; protein-protein complex, beta he 92.78
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 92.6
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 92.56
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 92.43
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 92.42
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 92.41
1gq8_A 319 Pectinesterase; hydrolase, carboxylic ester hydrol 92.4
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 92.32
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 92.27
2crm_A120 Fibronectin type-III domain containing protein 3A; 92.18
1x4x_A106 Fibronectin type-III domain containing protein 3A; 92.16
2crz_A110 Fibronectin type-III domain containing protein 3A; 92.16
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 92.08
1x3d_A118 Fibronectin type-III domain containing protein 3A; 91.96
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 91.93
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 91.82
3k2m_C101 Monobody HA4; engineered binding protein, antibody 91.64
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 91.6
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 91.6
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 91.59
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 91.5
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 91.45
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 91.25
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 91.22
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 91.21
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 91.17
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 91.16
1ru4_A 400 Pectate lyase, PEL9A; parallel beta-helix; 1.60A { 91.07
1dbg_A 506 Chondroitinase B; beta helix, polysaccharide lyase 91.03
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 90.99
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 90.94
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 90.83
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 90.81
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 90.72
2x3h_A 542 K5 lyase, K5A lyase; bacteriophage, glycosaminogly 90.64
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 90.57
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 90.49
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 90.41
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 90.31
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 90.16
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 90.05
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 89.98
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 89.85
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 89.81
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 89.54
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 89.53
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 89.46
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 89.39
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 89.17
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 89.09
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 88.86
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 88.82
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 88.43
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 88.36
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 88.34
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 87.97
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 87.81
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 87.22
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 87.19
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 87.16
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 86.5
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 86.5
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 86.19
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 85.92
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 85.91
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 85.39
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 85.37
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 85.37
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 85.25
3uw0_A 364 Pectinesterase; right-handed beta-helix, carbohydr 85.18
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 84.91
2nsp_A 342 Pectinesterase A; michaelis complex, hydrolase; HE 84.67
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 84.6
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 83.94
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 83.78
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 82.76
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 81.23
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 81.03
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 80.52
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 80.46
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
Probab=99.89  E-value=1.9e-23  Score=187.77  Aligned_cols=109  Identities=25%  Similarity=0.473  Sum_probs=98.3

Q ss_pred             HHHHhCCCCCCcceeEEEEeeccCCCCCcCCcceeeccCCCCCCCCCCCeeEeeeecc-CCCCcchhHHHHHHHHHHhhh
Q 043903           24 LIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQA  102 (146)
Q Consensus        24 ~~~~~~L~p~t~y~~~vr~v~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~nV~dfG-~gDG~tDdT~A~q~Ai~aa~~  102 (146)
                      .+++.+|+|+|+|.|+|++++.+|..+.++..+...        +.+++..+||++|| ++||.+|||+|||+||++|. 
T Consensus       114 ~~~v~~L~p~T~Y~~~v~a~d~~G~~s~ds~~V~~~--------T~~~~~~~~v~~~Ga~~dg~~ddt~aiq~Ai~~c~-  184 (608)
T 2uvf_A          114 NFTVIGLKPETSYQFTVKAQYADGSLSVASKPITAK--------TSAKPQIVNVRDFGAIDDGKTLNTKAIQQAIDSCK-  184 (608)
T ss_dssp             EEEECSCCTTCEEEEEEEEEETTSCBCCCCCCEEEE--------CCCCCCEEEGGGGTCCSSSSCCCHHHHHHHHHTCC-
T ss_pred             eEEecCCCCCCEEEEEEEEecCCCcccccchhcccc--------cccCCCEEecccccccCCCCccCHHHHHHHHHhcC-
Confidence            356789999999999999999999988887776653        45667899999999 99999999999999999775 


Q ss_pred             cCCCCCcEEEecCCEEEEeeEEeCCCeEEEEccCcEEEeCCCC
Q 043903          103 FGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQEL  145 (146)
Q Consensus       103 ~~~~gg~~V~IP~G~Yltg~l~L~SnvtL~l~~gAtL~as~d~  145 (146)
                          .|++|+||+|+|++|+|.|+|+++|+|++||+|+++.|+
T Consensus       185 ----~g~~v~vP~G~y~~g~i~lks~v~L~l~~gatL~~s~d~  223 (608)
T 2uvf_A          185 ----PGCRVEIPAGTYKSGALWLKSDMTLNLQAGAILLGSENP  223 (608)
T ss_dssp             ----TTEEEEECSEEEEECCEECCSSEEEEECTTEEEEECSCG
T ss_pred             ----CCCEEEECCCceEecceeccCceEEEecCCcEEEecCCH
Confidence                389999999999999999999999999999999999875



>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Back     alignment and structure
>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A Back     alignment and structure
>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Back     alignment and structure
>2vbk_A Tailspike-protein; viral adhesion protein, viral protein, hydrolase, endorhamnosidase, right-handed parallel beta-helix; 1.25A {Enterobacteria phage SF6} PDB: 2vbe_A 2vbm_A* Back     alignment and structure
>2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A* Back     alignment and structure
>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 Back     alignment and structure
>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Back     alignment and structure
>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Back     alignment and structure
>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* Back     alignment and structure
>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* Back     alignment and structure
>1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A* Back     alignment and structure
>2inu_A Insulin fructotransferase; right-handed parallel beta-helix, lyase; 1.80A {Bacillus SP} PDB: 2inv_A* Back     alignment and structure
>1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X* Back     alignment and structure
>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} Back     alignment and structure
>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 Back     alignment and structure
>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* Back     alignment and structure
>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Back     alignment and structure
>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xg2_A Pectinesterase 1; protein-protein complex, beta helix,four helix bundle, hydrolase/hydrolase inhibitor complex; 1.90A {Solanum lycopersicum} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1gq8_A Pectinesterase; hydrolase, carboxylic ester hydrolase; 1.75A {Daucus carota} SCOP: b.80.1.5 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Back     alignment and structure
>1dbg_A Chondroitinase B; beta helix, polysaccharide lyase, dematan sulfate; HET: MAN RAM GCU MXY G4D BGC; 1.70A {Pedobacter heparinus} SCOP: b.80.1.4 PDB: 1dbo_A* 1ofl_A* 1ofm_A* Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2x3h_A K5 lyase, K5A lyase; bacteriophage, glycosaminoglycan; 1.60A {Enterobacteria phage k1-5} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3uw0_A Pectinesterase; right-handed beta-helix, carbohydrate esterase, hydrolase; 3.50A {Yersinia enterocolitica subsp} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2nsp_A Pectinesterase A; michaelis complex, hydrolase; HET: M8C ADA; 1.70A {Erwinia chrysanthemi} PDB: 2nst_A* 2nt6_A* 2nt9_A* 2ntp_A* 2ntb_A* 2ntq_A* 1qjv_A Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1bhea_ 376 b.80.1.3 (A:) Polygalacturonase {Erwinia carotovor 2e-11
d1rmga_ 422 b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus a 1e-05
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Length = 376 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pectin lyase-like
family: Galacturonase
domain: Polygalacturonase
species: Erwinia carotovora, subsp. carotovora [TaxId: 554]
 Score = 58.3 bits (140), Expect = 2e-11
 Identities = 13/68 (19%), Positives = 28/68 (41%), Gaps = 8/68 (11%)

Query: 82  VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEG---LWLTGSFILTSNFTLFLQKGAV 138
           +   +++ T   +KA+        +G   + +  G   ++L+G   L S  +L + KG  
Sbjct: 18  LKADSSTATSTIQKALNNCD----QGKA-VRLSAGSTSVFLSGPLSLPSGVSLLIDKGVT 72

Query: 139 ILGSQELK 146
           +      K
Sbjct: 73  LRAVNNAK 80


>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Length = 422 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1rmga_ 422 Rhamnogalacturonase A {Aspergillus aculeatus [TaxI 99.54
d1bhea_ 376 Polygalacturonase {Erwinia carotovora, subsp. caro 99.51
d1h80a_ 464 iota-carrageenase {Alteromonas sp., atcc 43554 [Ta 98.7
d1ogmx2 373 Dextranase, catalytic domain {Penicillium miniolut 98.48
d1czfa_ 335 Polygalacturonase {Fungus (Aspergillus niger), end 98.11
d1hg8a_ 349 Polygalacturonase {Fusarium moniliforme [TaxId: 11 97.87
d1nhca_ 336 Polygalacturonase {Fungus (Aspergillus niger), end 96.97
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 96.6
d1ia5a_ 339 Polygalacturonase {Fungus (Aspergillus aculeatus) 96.25
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 95.23
d1x5xa196 Fibronectin type-III domain containing protein 3a, 94.67
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 94.48
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 94.26
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 94.22
d2crma1107 Fibronectin type-III domain containing protein 3a, 94.18
d1x4xa193 Fibronectin type-III domain containing protein 3a, 94.15
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 94.12
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 93.96
d1k5ca_ 333 Polygalacturonase {Fungus (Stereum purpureum), end 93.84
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 93.67
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 93.57
d1ofla_ 481 Chondroitinase B {Pedobacter heparinus [TaxId: 984 93.4
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 93.32
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 93.27
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 93.19
d1va9a1109 Down syndrome cell adhesion molecule-like protein 93.1
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 92.84
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 92.84
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 92.71
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 92.71
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 92.57
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 92.48
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 92.47
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 92.42
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 92.4
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 92.34
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 92.32
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 92.14
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 92.03
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 92.0
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 91.95
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 91.89
d2crza197 Fibronectin type-III domain containing protein 3a, 91.87
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 91.83
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 91.76
d1x3da1105 Fibronectin type-III domain containing protein 3a, 91.66
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 91.65
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 91.56
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 91.47
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 91.46
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 91.45
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 91.34
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 91.34
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 91.3
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 91.0
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 90.96
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 90.89
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 90.88
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 90.7
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 90.68
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 90.67
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 90.59
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 90.36
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 90.05
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 89.95
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 89.76
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 89.65
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 89.52
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 89.49
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 89.47
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 89.44
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 89.29
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 89.23
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 88.71
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 88.65
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 88.61
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 88.6
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 88.17
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 87.67
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 87.0
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 87.0
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 86.86
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 86.83
d1ru4a_ 400 Pectate transeliminase {Erwinia chrysanthemi [TaxI 85.78
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 85.73
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 85.57
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 85.29
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 84.15
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 82.47
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 82.26
>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pectin lyase-like
family: Galacturonase
domain: Rhamnogalacturonase A
species: Aspergillus aculeatus [TaxId: 5053]
Probab=99.54  E-value=3.8e-15  Score=126.73  Aligned_cols=69  Identities=19%  Similarity=0.255  Sum_probs=57.9

Q ss_pred             CeeEeeeecc-CCCCcchhHHHHHHHHHHhhhcCCCCCcEEEecCCEEE-EeeEEeCCCeEEEEccCcEEEeCCCC
Q 043903           72 KVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWL-TGSFILTSNFTLFLQKGAVILGSQEL  145 (146)
Q Consensus        72 ~~~~nV~dfG-~gDG~tDdT~A~q~Ai~aa~~~~~~gg~~V~IP~G~Yl-tg~l~L~SnvtL~l~~gAtL~as~d~  145 (146)
                      .+++||+||| +|||++|||+|||+||++|.     +|++|+||+|+|+ .++|.|+.+..+.++.+++|+++.+.
T Consensus        18 ~k~~nV~dfGA~gDG~tDdT~Ai~~Ai~ac~-----~gg~V~iP~Gty~l~~~i~l~g~~~~~l~~~G~i~~~~~~   88 (422)
T d1rmga_          18 TKTCNILSYGAVADNSTDVGPAITSAWAACK-----SGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTA   88 (422)
T ss_dssp             HCEEEGGGGTCCCSSSSBCHHHHHHHHHHHT-----BTCEEEECSSEEEECSCEEEESCEEEEEEECSEEEECCCC
T ss_pred             CcEEEEecCCCCCCCCccCHHHHHHHHHhcC-----CCCEEEECCCcEEEeCcEEEcCCCceEEEEeEEEEeccCC
Confidence            4689999999 99999999999999998774     6789999999986 56799976655555666899887654



>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d1h80a_ b.80.1.8 (A:) iota-carrageenase {Alteromonas sp., atcc 43554 [TaxId: 232]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} Back     information, alignment and structure
>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} Back     information, alignment and structure
>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure