Citrus Sinensis ID: 043903
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| 225431447 | 488 | PREDICTED: probable polygalacturonase [V | 0.931 | 0.278 | 0.542 | 1e-29 | |
| 147776708 | 479 | hypothetical protein VITISV_043959 [Viti | 0.931 | 0.283 | 0.542 | 2e-29 | |
| 296088539 | 528 | unnamed protein product [Vitis vinifera] | 0.931 | 0.257 | 0.542 | 2e-29 | |
| 357464681 | 775 | Germin-like protein [Medicago truncatula | 0.931 | 0.175 | 0.478 | 3e-28 | |
| 255571381 | 480 | polygalacturonase, putative [Ricinus com | 0.924 | 0.281 | 0.52 | 2e-27 | |
| 297802658 | 475 | glycoside hydrolase family 28 protein [A | 0.876 | 0.269 | 0.522 | 4e-27 | |
| 356516364 | 477 | PREDICTED: probable polygalacturonase-li | 0.904 | 0.276 | 0.517 | 6e-27 | |
| 22329119 | 475 | glycoside hydrolase family 28 protein / | 0.876 | 0.269 | 0.522 | 9e-27 | |
| 4490311 | 462 | putative protein [Arabidopsis thaliana] | 0.890 | 0.281 | 0.507 | 2e-26 | |
| 224096000 | 445 | predicted protein [Populus trichocarpa] | 0.705 | 0.231 | 0.592 | 2e-26 |
| >gi|225431447|ref|XP_002274138.1| PREDICTED: probable polygalacturonase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 134 bits (337), Expect = 1e-29, Method: Composition-based stats.
Identities = 76/140 (54%), Positives = 97/140 (69%), Gaps = 4/140 (2%)
Query: 8 GNFSRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQY 67
G F+RPS A L+ + ++ + QI K V R V G E + A GL +
Sbjct: 13 GGFTRPSWAFLLLVFIVLVVSCFQIGTKTVFP-RWVVLGGGETGISEEAPSCFGLFRE-- 69
Query: 68 LPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILT 126
+P RKVVMSI+DFG VGDG TS TE FR+A+RY+Q+FG+ GG+QLNVP G W+TGSF LT
Sbjct: 70 VPPRKVVMSIRDFGGVGDGVTSNTETFRRAIRYMQSFGNIGGSQLNVPRGRWVTGSFNLT 129
Query: 127 SNFTLFLQKGAVILGSQELK 146
SNFTLFL++GAVILGSQ+L+
Sbjct: 130 SNFTLFLEEGAVILGSQDLE 149
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147776708|emb|CAN76963.1| hypothetical protein VITISV_043959 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296088539|emb|CBI37530.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357464681|ref|XP_003602622.1| Germin-like protein [Medicago truncatula] gi|355491670|gb|AES72873.1| Germin-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255571381|ref|XP_002526639.1| polygalacturonase, putative [Ricinus communis] gi|223534031|gb|EEF35751.1| polygalacturonase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297802658|ref|XP_002869213.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. lyrata] gi|297315049|gb|EFH45472.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356516364|ref|XP_003526865.1| PREDICTED: probable polygalacturonase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|22329119|ref|NP_195070.2| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] gi|27754320|gb|AAO22613.1| putative polygalacturonase [Arabidopsis thaliana] gi|28393881|gb|AAO42348.1| putative polygalacturonase [Arabidopsis thaliana] gi|332660825|gb|AEE86225.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|4490311|emb|CAB38802.1| putative protein [Arabidopsis thaliana] gi|7270292|emb|CAB80061.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224096000|ref|XP_002310517.1| predicted protein [Populus trichocarpa] gi|222853420|gb|EEE90967.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| TAIR|locus:2119156 | 475 | AT4G33440 [Arabidopsis thalian | 0.876 | 0.269 | 0.522 | 5e-27 | |
| TAIR|locus:2083383 | 446 | AT3G06770 [Arabidopsis thalian | 0.554 | 0.181 | 0.573 | 4.4e-17 | |
| TAIR|locus:504954979 | 449 | AT5G49215 [Arabidopsis thalian | 0.479 | 0.155 | 0.619 | 2e-16 | |
| TAIR|locus:2086740 | 455 | AT3G16850 [Arabidopsis thalian | 0.527 | 0.169 | 0.576 | 4.5e-16 | |
| TAIR|locus:2101313 | 469 | AT3G48950 [Arabidopsis thalian | 0.506 | 0.157 | 0.56 | 3.6e-15 | |
| TAIR|locus:2117964 | 495 | AT4G23500 [Arabidopsis thalian | 0.472 | 0.139 | 0.6 | 6.7e-15 | |
| TAIR|locus:2098038 | 471 | AT3G62110 [Arabidopsis thalian | 0.465 | 0.144 | 0.579 | 9.9e-15 | |
| TAIR|locus:2061396 | 477 | AT2G23900 [Arabidopsis thalian | 0.506 | 0.155 | 0.546 | 1.7e-14 | |
| TAIR|locus:2082787 | 476 | AT3G61490 [Arabidopsis thalian | 0.479 | 0.147 | 0.535 | 2.8e-14 | |
| TAIR|locus:2078531 | 484 | AT3G42950 [Arabidopsis thalian | 0.534 | 0.161 | 0.537 | 3.7e-14 |
| TAIR|locus:2119156 AT4G33440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 306 (112.8 bits), Expect = 5.0e-27, P = 5.0e-27
Identities = 71/136 (52%), Positives = 93/136 (68%)
Query: 11 SRPSRATLVPIVTLIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPK 70
+RPS A L+ + T++ ILSLQI+ L L + S + +P TC D + P
Sbjct: 15 TRPSWAFLLLVFTVLAILSLQISSNSFLPLW-IPTSQYD----DPVTCSGFFNHDPF-PN 68
Query: 71 RKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWLTGSFILTSNF 129
R +VMSI DFG VGDG TS T FR+AVR+++ F +GG QLNVPEG WL+GSF LTSNF
Sbjct: 69 R-IVMSITDFGGVGDGKTSNTAAFRRAVRHLEGFAAEGGAQLNVPEGTWLSGSFNLTSNF 127
Query: 130 TLFLQKGAVILGSQEL 145
TLFL++GA+ILGS++L
Sbjct: 128 TLFLERGALILGSKDL 143
|
|
| TAIR|locus:2083383 AT3G06770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954979 AT5G49215 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086740 AT3G16850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101313 AT3G48950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117964 AT4G23500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098038 AT3G62110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061396 AT2G23900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082787 AT3G61490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078531 AT3G42950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034796001 | SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (488 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00008525001 | • | 0.418 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| COG5434 | 542 | COG5434, PGU1, Endopygalactorunase [Cell envelope | 6e-09 |
| >gnl|CDD|227721 COG5434, PGU1, Endopygalactorunase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Score = 52.9 bits (127), Expect = 6e-09
Identities = 33/98 (33%), Positives = 46/98 (46%), Gaps = 11/98 (11%)
Query: 46 SGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFG 104
G+E +PA + D S+ D G VGDG T T + A+ + G
Sbjct: 61 EGSESEDSSPAINIKTAATDT-------AFSVSDDGAVGDGATDNTAAIQAAIDACASAG 113
Query: 105 DKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGS 142
GGT + +P G +L+G L SN TL L +GA +L S
Sbjct: 114 --GGT-VLLPAGTYLSGPLFLKSNVTLHLAEGATLLAS 148
|
Length = 542 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| COG5434 | 542 | PGU1 Endopygalactorunase [Cell envelope biogenesis | 99.83 | |
| PLN02155 | 394 | polygalacturonase | 99.7 | |
| PLN02793 | 443 | Probable polygalacturonase | 99.69 | |
| PLN02218 | 431 | polygalacturonase ADPG | 99.64 | |
| PLN03010 | 409 | polygalacturonase | 99.62 | |
| PLN02188 | 404 | polygalacturonase/glycoside hydrolase family prote | 99.61 | |
| PF12708 | 225 | Pectate_lyase_3: Pectate lyase superfamily protein | 99.56 | |
| PLN03003 | 456 | Probable polygalacturonase At3g15720 | 99.47 | |
| TIGR03808 | 455 | RR_plus_rpt_1 twin-arg-translocated uncharacterize | 99.29 | |
| TIGR03805 | 314 | beta_helix_1 parallel beta-helix repeat-containing | 95.8 | |
| PF12218 | 67 | End_N_terminal: N terminal extension of bacterioph | 95.67 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 92.61 | |
| PLN02480 | 343 | Probable pectinesterase | 90.34 | |
| PF03718 | 582 | Glyco_hydro_49: Glycosyl hydrolase family 49; Inte | 88.4 | |
| PF07602 | 246 | DUF1565: Protein of unknown function (DUF1565); In | 87.93 |
| >COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Probab=99.83 E-value=1.3e-20 Score=169.63 Aligned_cols=110 Identities=30% Similarity=0.434 Sum_probs=100.1
Q ss_pred HhCCCCCCcceeEEEEeeccCCCCCcCCcceeeccCCCCCCCCCCCeeEeeeecc-CCCCcchhHHHHHHHHHHhhhcCC
Q 043903 27 ILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGD 105 (146)
Q Consensus 27 ~~~L~p~t~y~~~vr~v~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~nV~dfG-~gDG~tDdT~A~q~Ai~aa~~~~~ 105 (146)
.+++.|++.|.+++|.++.++.++.++.++.|. ++.+....++|.+|| ++||.+||++|||+||++|+ .
T Consensus 42 ~~~~~~~~~~p~~~~~~~~~~~e~~~~~~~~~~-------~~~~~~t~~sv~~~ga~gDG~t~~~~aiq~AI~~ca---~ 111 (542)
T COG5434 42 SSNLVPNTALPDTVRSFNAEGSESEDSSPAINI-------KTAATDTAFSVSDDGAVGDGATDNTAAIQAAIDACA---S 111 (542)
T ss_pred ccCccccccCCcceeeeccccccccccccceec-------ccccccceeeeccccccccCCccCHHHHHHHHHhhh---h
Confidence 367889999999999999999999998877663 245566789999999 99999999999999999998 5
Q ss_pred CCCcEEEecCCEEEEeeEEeCCCeEEEEccCcEEEeCCCCC
Q 043903 106 KGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK 146 (146)
Q Consensus 106 ~gg~~V~IP~G~Yltg~l~L~SnvtL~l~~gAtL~as~d~~ 146 (146)
.+|++|+||+|+|++|+|+|||+|+|++++||||+++.+|+
T Consensus 112 a~Gg~V~lPaGtylsg~l~LKS~~~L~l~egatl~~~~~p~ 152 (542)
T COG5434 112 AGGGTVLLPAGTYLSGPLFLKSNVTLHLAEGATLLASSNPK 152 (542)
T ss_pred hcCceEEECCceeEeeeEEEecccEEEecCCceeeCCCChh
Confidence 79999999999999999999999999999999999999874
|
|
| >PLN02155 polygalacturonase | Back alignment and domain information |
|---|
| >PLN02793 Probable polygalacturonase | Back alignment and domain information |
|---|
| >PLN02218 polygalacturonase ADPG | Back alignment and domain information |
|---|
| >PLN03010 polygalacturonase | Back alignment and domain information |
|---|
| >PLN02188 polygalacturonase/glycoside hydrolase family protein | Back alignment and domain information |
|---|
| >PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A | Back alignment and domain information |
|---|
| >PLN03003 Probable polygalacturonase At3g15720 | Back alignment and domain information |
|---|
| >TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein | Back alignment and domain information |
|---|
| >TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein | Back alignment and domain information |
|---|
| >PF12218 End_N_terminal: N terminal extension of bacteriophage endosialidase; InterPro: IPR024429 This entry represents the N-terminal extension domain of endosialidases which is approximately 70 amino acids in length | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >PLN02480 Probable pectinesterase | Back alignment and domain information |
|---|
| >PF03718 Glyco_hydro_49: Glycosyl hydrolase family 49; InterPro: IPR005192 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF07602 DUF1565: Protein of unknown function (DUF1565); InterPro: IPR011459 These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 146 | ||||
| 2uve_A | 608 | Structure Of Yersinia Enterocolitica Family 28 Exop | 2e-06 | ||
| 3jur_A | 448 | The Crystal Structure Of A Hyperthermoactive Exopol | 3e-06 |
| >pdb|2UVE|A Chain A, Structure Of Yersinia Enterocolitica Family 28 Exopolygalacturonase Length = 608 | Back alignment and structure |
|
| >pdb|3JUR|A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima Length = 448 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 3e-20 | |
| 1h80_A | 464 | IOTA-carrageenase; hydrolase, IOTA-carrageenan dou | 7e-18 | |
| 3jur_A | 448 | EXO-poly-alpha-D-galacturonosidase; beta-helix, ce | 1e-16 | |
| 2pyg_A | 377 | Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli | 2e-15 | |
| 1bhe_A | 376 | PEHA, polygalacturonase; family 28 glycosyl hydrol | 1e-11 | |
| 2x6w_A | 600 | Tail spike protein; viral protein, beta-helix, hyd | 2e-10 | |
| 3gqn_A | 772 | Preneck appendage protein; beta helix, beta barrel | 1e-06 | |
| 3gq8_A | 609 | Preneck appendage protein; beta helix, viral prote | 5e-06 | |
| 2vbk_A | 514 | Tailspike-protein; viral adhesion protein, viral p | 2e-05 | |
| 1czf_A | 362 | Polygalacturonase II; beta helix, hydrolase; HET: | 2e-04 |
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Length = 608 | Back alignment and structure |
|---|
Score = 85.1 bits (210), Expect = 3e-20
Identities = 27/94 (28%), Positives = 50/94 (53%), Gaps = 6/94 (6%)
Query: 54 NPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLN 112
+ + VA P + +++++DFG + DG T T+ ++A+ K G ++
Sbjct: 136 DGSLSVASKPITAKTSAKPQIVNVRDFGAIDDGKTLNTKAIQQAIDSC-----KPGCRVE 190
Query: 113 VPEGLWLTGSFILTSNFTLFLQKGAVILGSQELK 146
+P G + +G+ L S+ TL LQ GA++LGS+
Sbjct: 191 IPAGTYKSGALWLKSDMTLNLQAGAILLGSENPD 224
|
| >1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A Length = 464 | Back alignment and structure |
|---|
| >3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Length = 448 | Back alignment and structure |
|---|
| >2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* Length = 377 | Back alignment and structure |
|---|
| >1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Length = 376 | Back alignment and structure |
|---|
| >2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A* Length = 600 | Back alignment and structure |
|---|
| >3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Length = 609 | Back alignment and structure |
|---|
| >2vbk_A Tailspike-protein; viral adhesion protein, viral protein, hydrolase, endorhamnosidase, right-handed parallel beta-helix; 1.25A {Enterobacteria phage SF6} PDB: 2vbe_A 2vbm_A* Length = 514 | Back alignment and structure |
|---|
| >1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Length = 362 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 99.89 | |
| 3jur_A | 448 | EXO-poly-alpha-D-galacturonosidase; beta-helix, ce | 99.74 | |
| 1h80_A | 464 | IOTA-carrageenase; hydrolase, IOTA-carrageenan dou | 99.68 | |
| 2pyg_A | 377 | Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli | 99.58 | |
| 2vbk_A | 514 | Tailspike-protein; viral adhesion protein, viral p | 99.54 | |
| 2x6w_A | 600 | Tail spike protein; viral protein, beta-helix, hyd | 99.47 | |
| 1rmg_A | 422 | Rgase A, rhamnogalacturonase A; hydrolase, inverti | 99.47 | |
| 1bhe_A | 376 | PEHA, polygalacturonase; family 28 glycosyl hydrol | 99.44 | |
| 3gq8_A | 609 | Preneck appendage protein; beta helix, viral prote | 99.36 | |
| 3eqn_A | 758 | Glucan 1,3-beta-glucosidase; tandem beta-helix dom | 99.36 | |
| 3gqn_A | 772 | Preneck appendage protein; beta helix, beta barrel | 99.32 | |
| 3eqn_A | 758 | Glucan 1,3-beta-glucosidase; tandem beta-helix dom | 99.23 | |
| 1x0c_A | 549 | Isopullulanase; glycoside hydrolase family 49, gly | 98.32 | |
| 2inu_A | 410 | Insulin fructotransferase; right-handed parallel b | 97.85 | |
| 1ogo_X | 574 | Dextranase; hydrolase, dextran degradation, glycos | 97.83 | |
| 2iq7_A | 339 | Endopolygalacturonase; parallel beta helix, hydrol | 97.72 | |
| 1hg8_A | 349 | Endopolygalacturonase; hydrolase, pectin degradati | 97.71 | |
| 1nhc_A | 336 | Polygalacturonase I; beta-helix, hydrolase; HET: M | 97.59 | |
| 1ia5_A | 339 | Polygalacturonase; glycosylhydrolase, hydrolase; H | 97.45 | |
| 1czf_A | 362 | Polygalacturonase II; beta helix, hydrolase; HET: | 97.21 | |
| 1k5c_A | 335 | Endopolygalacturonase; beta helical structure, gly | 96.85 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 96.02 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 95.87 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 95.5 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 94.73 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 94.2 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 94.14 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 93.97 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 93.73 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 93.6 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 93.49 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 93.46 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 93.44 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 93.34 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 93.34 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 93.21 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 93.11 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 93.11 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 93.03 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 92.95 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 92.88 | |
| 1xg2_A | 317 | Pectinesterase 1; protein-protein complex, beta he | 92.78 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 92.6 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 92.56 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 92.43 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 92.42 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 92.41 | |
| 1gq8_A | 319 | Pectinesterase; hydrolase, carboxylic ester hydrol | 92.4 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 92.32 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 92.27 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 92.18 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 92.16 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 92.16 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 92.08 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 91.96 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 91.93 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 91.82 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 91.64 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 91.6 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 91.6 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 91.59 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 91.5 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 91.45 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 91.25 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 91.22 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 91.21 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 91.17 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 91.16 | |
| 1ru4_A | 400 | Pectate lyase, PEL9A; parallel beta-helix; 1.60A { | 91.07 | |
| 1dbg_A | 506 | Chondroitinase B; beta helix, polysaccharide lyase | 91.03 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 90.99 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 90.94 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 90.83 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 90.81 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 90.72 | |
| 2x3h_A | 542 | K5 lyase, K5A lyase; bacteriophage, glycosaminogly | 90.64 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 90.57 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 90.49 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 90.41 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 90.31 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 90.16 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 90.05 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 89.98 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 89.85 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 89.81 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 89.54 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 89.53 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 89.46 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 89.39 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 89.17 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 89.09 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 88.86 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 88.82 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 88.43 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 88.36 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 88.34 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 87.97 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 87.81 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 87.22 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 87.19 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 87.16 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 86.5 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 86.5 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 86.19 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 85.92 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 85.91 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 85.39 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 85.37 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 85.37 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 85.25 | |
| 3uw0_A | 364 | Pectinesterase; right-handed beta-helix, carbohydr | 85.18 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 84.91 | |
| 2nsp_A | 342 | Pectinesterase A; michaelis complex, hydrolase; HE | 84.67 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 84.6 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 83.94 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 83.78 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 82.76 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 81.23 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 81.03 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 80.52 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 80.46 |
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
Probab=99.89 E-value=1.9e-23 Score=187.77 Aligned_cols=109 Identities=25% Similarity=0.473 Sum_probs=98.3
Q ss_pred HHHHhCCCCCCcceeEEEEeeccCCCCCcCCcceeeccCCCCCCCCCCCeeEeeeecc-CCCCcchhHHHHHHHHHHhhh
Q 043903 24 LIKILSLQITKKPVLSLRRVGFSGAEGALFNPATCVAGLPGDQYLPKRKVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQA 102 (146)
Q Consensus 24 ~~~~~~L~p~t~y~~~vr~v~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~nV~dfG-~gDG~tDdT~A~q~Ai~aa~~ 102 (146)
.+++.+|+|+|+|.|+|++++.+|..+.++..+... +.+++..+||++|| ++||.+|||+|||+||++|.
T Consensus 114 ~~~v~~L~p~T~Y~~~v~a~d~~G~~s~ds~~V~~~--------T~~~~~~~~v~~~Ga~~dg~~ddt~aiq~Ai~~c~- 184 (608)
T 2uvf_A 114 NFTVIGLKPETSYQFTVKAQYADGSLSVASKPITAK--------TSAKPQIVNVRDFGAIDDGKTLNTKAIQQAIDSCK- 184 (608)
T ss_dssp EEEECSCCTTCEEEEEEEEEETTSCBCCCCCCEEEE--------CCCCCCEEEGGGGTCCSSSSCCCHHHHHHHHHTCC-
T ss_pred eEEecCCCCCCEEEEEEEEecCCCcccccchhcccc--------cccCCCEEecccccccCCCCccCHHHHHHHHHhcC-
Confidence 356789999999999999999999988887776653 45667899999999 99999999999999999775
Q ss_pred cCCCCCcEEEecCCEEEEeeEEeCCCeEEEEccCcEEEeCCCC
Q 043903 103 FGDKGGTQLNVPEGLWLTGSFILTSNFTLFLQKGAVILGSQEL 145 (146)
Q Consensus 103 ~~~~gg~~V~IP~G~Yltg~l~L~SnvtL~l~~gAtL~as~d~ 145 (146)
.|++|+||+|+|++|+|.|+|+++|+|++||+|+++.|+
T Consensus 185 ----~g~~v~vP~G~y~~g~i~lks~v~L~l~~gatL~~s~d~ 223 (608)
T 2uvf_A 185 ----PGCRVEIPAGTYKSGALWLKSDMTLNLQAGAILLGSENP 223 (608)
T ss_dssp ----TTEEEEECSEEEEECCEECCSSEEEEECTTEEEEECSCG
T ss_pred ----CCCEEEECCCceEecceeccCceEEEecCCcEEEecCCH
Confidence 389999999999999999999999999999999999875
|
| >3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A | Back alignment and structure |
|---|
| >2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A* | Back alignment and structure |
|---|
| >2vbk_A Tailspike-protein; viral adhesion protein, viral protein, hydrolase, endorhamnosidase, right-handed parallel beta-helix; 1.25A {Enterobacteria phage SF6} PDB: 2vbe_A 2vbm_A* | Back alignment and structure |
|---|
| >2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A* | Back alignment and structure |
|---|
| >1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 | Back alignment and structure |
|---|
| >1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 | Back alignment and structure |
|---|
| >3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A | Back alignment and structure |
|---|
| >3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* | Back alignment and structure |
|---|
| >3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A* | Back alignment and structure |
|---|
| >1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A* | Back alignment and structure |
|---|
| >2inu_A Insulin fructotransferase; right-handed parallel beta-helix, lyase; 1.80A {Bacillus SP} PDB: 2inv_A* | Back alignment and structure |
|---|
| >1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X* | Back alignment and structure |
|---|
| >2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} | Back alignment and structure |
|---|
| >1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 | Back alignment and structure |
|---|
| >1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 | Back alignment and structure |
|---|
| >1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* | Back alignment and structure |
|---|
| >1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 | Back alignment and structure |
|---|
| >1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xg2_A Pectinesterase 1; protein-protein complex, beta helix,four helix bundle, hydrolase/hydrolase inhibitor complex; 1.90A {Solanum lycopersicum} | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1gq8_A Pectinesterase; hydrolase, carboxylic ester hydrolase; 1.75A {Daucus carota} SCOP: b.80.1.5 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 | Back alignment and structure |
|---|
| >1dbg_A Chondroitinase B; beta helix, polysaccharide lyase, dematan sulfate; HET: MAN RAM GCU MXY G4D BGC; 1.70A {Pedobacter heparinus} SCOP: b.80.1.4 PDB: 1dbo_A* 1ofl_A* 1ofm_A* | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2x3h_A K5 lyase, K5A lyase; bacteriophage, glycosaminoglycan; 1.60A {Enterobacteria phage k1-5} | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >3uw0_A Pectinesterase; right-handed beta-helix, carbohydrate esterase, hydrolase; 3.50A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2nsp_A Pectinesterase A; michaelis complex, hydrolase; HET: M8C ADA; 1.70A {Erwinia chrysanthemi} PDB: 2nst_A* 2nt6_A* 2nt9_A* 2ntp_A* 2ntb_A* 2ntq_A* 1qjv_A | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 146 | ||||
| d1bhea_ | 376 | b.80.1.3 (A:) Polygalacturonase {Erwinia carotovor | 2e-11 | |
| d1rmga_ | 422 | b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus a | 1e-05 |
| >d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Length = 376 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded right-handed beta-helix superfamily: Pectin lyase-like family: Galacturonase domain: Polygalacturonase species: Erwinia carotovora, subsp. carotovora [TaxId: 554]
Score = 58.3 bits (140), Expect = 2e-11
Identities = 13/68 (19%), Positives = 28/68 (41%), Gaps = 8/68 (11%)
Query: 82 VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEG---LWLTGSFILTSNFTLFLQKGAV 138
+ +++ T +KA+ +G + + G ++L+G L S +L + KG
Sbjct: 18 LKADSSTATSTIQKALNNCD----QGKA-VRLSAGSTSVFLSGPLSLPSGVSLLIDKGVT 72
Query: 139 ILGSQELK 146
+ K
Sbjct: 73 LRAVNNAK 80
|
| >d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Length = 422 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| d1rmga_ | 422 | Rhamnogalacturonase A {Aspergillus aculeatus [TaxI | 99.54 | |
| d1bhea_ | 376 | Polygalacturonase {Erwinia carotovora, subsp. caro | 99.51 | |
| d1h80a_ | 464 | iota-carrageenase {Alteromonas sp., atcc 43554 [Ta | 98.7 | |
| d1ogmx2 | 373 | Dextranase, catalytic domain {Penicillium miniolut | 98.48 | |
| d1czfa_ | 335 | Polygalacturonase {Fungus (Aspergillus niger), end | 98.11 | |
| d1hg8a_ | 349 | Polygalacturonase {Fusarium moniliforme [TaxId: 11 | 97.87 | |
| d1nhca_ | 336 | Polygalacturonase {Fungus (Aspergillus niger), end | 96.97 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 96.6 | |
| d1ia5a_ | 339 | Polygalacturonase {Fungus (Aspergillus aculeatus) | 96.25 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 95.23 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 94.67 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 94.48 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 94.26 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 94.22 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 94.18 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 94.15 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 94.12 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 93.96 | |
| d1k5ca_ | 333 | Polygalacturonase {Fungus (Stereum purpureum), end | 93.84 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 93.67 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 93.57 | |
| d1ofla_ | 481 | Chondroitinase B {Pedobacter heparinus [TaxId: 984 | 93.4 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 93.32 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 93.27 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 93.19 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 93.1 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 92.84 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 92.84 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 92.71 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 92.71 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 92.57 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 92.48 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 92.47 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.42 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 92.4 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 92.34 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 92.32 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 92.14 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 92.03 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 92.0 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 91.95 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 91.89 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 91.87 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 91.83 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 91.76 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 91.66 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 91.65 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 91.56 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 91.47 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 91.46 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 91.45 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 91.34 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 91.34 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 91.3 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 91.0 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 90.96 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 90.89 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 90.88 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 90.7 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 90.68 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 90.67 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 90.59 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 90.36 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 90.05 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 89.95 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 89.76 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 89.65 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 89.52 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.49 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 89.47 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 89.44 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 89.29 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 89.23 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 88.71 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 88.65 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.61 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 88.6 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 88.17 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 87.67 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 87.0 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 87.0 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 86.86 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 86.83 | |
| d1ru4a_ | 400 | Pectate transeliminase {Erwinia chrysanthemi [TaxI | 85.78 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 85.73 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 85.57 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 85.29 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 84.15 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 82.47 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 82.26 |
| >d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded right-handed beta-helix superfamily: Pectin lyase-like family: Galacturonase domain: Rhamnogalacturonase A species: Aspergillus aculeatus [TaxId: 5053]
Probab=99.54 E-value=3.8e-15 Score=126.73 Aligned_cols=69 Identities=19% Similarity=0.255 Sum_probs=57.9
Q ss_pred CeeEeeeecc-CCCCcchhHHHHHHHHHHhhhcCCCCCcEEEecCCEEE-EeeEEeCCCeEEEEccCcEEEeCCCC
Q 043903 72 KVVMSIKDFG-VGDGTTSTTEVFRKAVRYVQAFGDKGGTQLNVPEGLWL-TGSFILTSNFTLFLQKGAVILGSQEL 145 (146)
Q Consensus 72 ~~~~nV~dfG-~gDG~tDdT~A~q~Ai~aa~~~~~~gg~~V~IP~G~Yl-tg~l~L~SnvtL~l~~gAtL~as~d~ 145 (146)
.+++||+||| +|||++|||+|||+||++|. +|++|+||+|+|+ .++|.|+.+..+.++.+++|+++.+.
T Consensus 18 ~k~~nV~dfGA~gDG~tDdT~Ai~~Ai~ac~-----~gg~V~iP~Gty~l~~~i~l~g~~~~~l~~~G~i~~~~~~ 88 (422)
T d1rmga_ 18 TKTCNILSYGAVADNSTDVGPAITSAWAACK-----SGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTA 88 (422)
T ss_dssp HCEEEGGGGTCCCSSSSBCHHHHHHHHHHHT-----BTCEEEECSSEEEECSCEEEESCEEEEEEECSEEEECCCC
T ss_pred CcEEEEecCCCCCCCCccCHHHHHHHHHhcC-----CCCEEEECCCcEEEeCcEEEcCCCceEEEEeEEEEeccCC
Confidence 4689999999 99999999999999998774 6789999999986 56799976655555666899887654
|
| >d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1h80a_ b.80.1.8 (A:) iota-carrageenase {Alteromonas sp., atcc 43554 [TaxId: 232]} | Back information, alignment and structure |
|---|
| >d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} | Back information, alignment and structure |
|---|
| >d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} | Back information, alignment and structure |
|---|
| >d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|