Citrus Sinensis ID: 044011

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
GALGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGGRLSLRSRGKDSS
cccccccccccHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccEEEEccccEEcc
cccccHHHccccHHHHcccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHcccEEEEcccEEEcc
galgatkllrpfsdiidslelkdpfVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEwykpgcsleyplrgsGALVNALVRGIEKFGgrlslrsrgkdss
galgatkllrpfsdIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEkfggrlslrsrgkdss
GALGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGGRLSLRSRGKDSS
******KLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGG************
****ATK*LRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGGRLSLRSRG****
GALGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGGRLS*********
**LGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGGRLSLRSRGK***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GALGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGGRLSLRSRGKDSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
224119928 579 predicted protein [Populus trichocarpa] 0.949 0.162 0.893 1e-43
255570972 585 All-trans-retinol 13,14-reductase precur 0.949 0.160 0.861 1e-42
297739513 570 unnamed protein product [Vitis vinifera] 0.949 0.164 0.851 5e-42
359486245 551 PREDICTED: prolycopene isomerase, chloro 0.949 0.170 0.851 6e-42
147777848 586 hypothetical protein VITISV_023401 [Viti 0.949 0.160 0.851 1e-41
297848272 578 hypothetical protein ARALYDRAFT_314966 [ 0.949 0.162 0.861 2e-41
12321347 578 hypothetical protein [Arabidopsis thalia 0.949 0.162 0.851 2e-41
22330293 574 FAD/NAD(P)-binding oxidoreductase domain 0.949 0.163 0.851 2e-41
47076392196 hypothetical protein [Ipomoea batatas] 0.949 0.479 0.840 2e-41
125546387 597 hypothetical protein OsI_14265 [Oryza sa 0.949 0.157 0.851 3e-40
>gi|224119928|ref|XP_002331097.1| predicted protein [Populus trichocarpa] gi|222872825|gb|EEF09956.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (97%)

Query: 1   GALGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKP 60
           GALGATKLLRPFS+IIDSLELKDPF+RNW+DLLAFLLAGVKSNGILSAEM+YMFAEWYKP
Sbjct: 230 GALGATKLLRPFSEIIDSLELKDPFIRNWVDLLAFLLAGVKSNGILSAEMIYMFAEWYKP 289

Query: 61  GCSLEYPLRGSGALVNALVRGIEKFGGRLSLRSR 94
           GCSLEYPL G+GALV+ALVRG++KFGGRLSLRS 
Sbjct: 290 GCSLEYPLHGTGALVDALVRGLQKFGGRLSLRSH 323

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255570972|ref|XP_002526437.1| All-trans-retinol 13,14-reductase precursor, putative [Ricinus communis] gi|223534217|gb|EEF35932.1| All-trans-retinol 13,14-reductase precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297739513|emb|CBI29695.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486245|ref|XP_002264237.2| PREDICTED: prolycopene isomerase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777848|emb|CAN60294.1| hypothetical protein VITISV_023401 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297848272|ref|XP_002892017.1| hypothetical protein ARALYDRAFT_314966 [Arabidopsis lyrata subsp. lyrata] gi|297337859|gb|EFH68276.1| hypothetical protein ARALYDRAFT_314966 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|12321347|gb|AAG50743.1|AC079733_11 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22330293|ref|NP_176088.2| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|11079523|gb|AAG29233.1|AC079732_4 hypothetical protein [Arabidopsis thaliana] gi|17529088|gb|AAL38754.1| unknown protein [Arabidopsis thaliana] gi|22136842|gb|AAM91765.1| unknown protein [Arabidopsis thaliana] gi|332195342|gb|AEE33463.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|47076392|dbj|BAD18100.1| hypothetical protein [Ipomoea batatas] Back     alignment and taxonomy information
>gi|125546387|gb|EAY92526.1| hypothetical protein OsI_14265 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
TAIR|locus:2009395 574 AT1G57770 [Arabidopsis thalian 0.939 0.162 0.860 7.5e-41
UNIPROTKB|Q10AT7 597 Os03g0841900 "Os03g0841900 pro 0.939 0.155 0.860 8.7e-40
UNIPROTKB|A8J3K3 558 CHLREDRAFT_130438 "Predicted p 0.898 0.159 0.539 6.5e-24
UNIPROTKB|A8J7T2 566 CHLREDRAFT_176572 "Predicted p 0.888 0.155 0.426 1.3e-12
TAIR|locus:2009395 AT1G57770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 434 (157.8 bits), Expect = 7.5e-41, P = 7.5e-41
 Identities = 80/93 (86%), Positives = 91/93 (97%)

Query:     1 GALGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKP 60
             GALGATKLLRPFS+I+DSLELKDPF+RNWIDLLAFLLAGVKS+GILSAEM+YMFAEWYKP
Sbjct:   225 GALGATKLLRPFSEIVDSLELKDPFIRNWIDLLAFLLAGVKSDGILSAEMIYMFAEWYKP 284

Query:    61 GCSLEYPLRGSGALVNALVRGIEKFGGRLSLRS 93
             GC+LEYP+ G+GA+V ALVRG+EKFGGRLSL+S
Sbjct:   285 GCTLEYPIDGTGAVVEALVRGLEKFGGRLSLKS 317
GO:0005739 "mitochondrion" evidence=ISM
GO:0016117 "carotenoid biosynthetic process" evidence=IBA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0046608 "carotenoid isomerase activity" evidence=IBA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
UNIPROTKB|Q10AT7 Os03g0841900 "Os03g0841900 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3K3 CHLREDRAFT_130438 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|A8J7T2 CHLREDRAFT_176572 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
COG1233 487 COG1233, COG1233, Phytoene dehydrogenase and relat 2e-04
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information 
 Score = 38.6 bits (90), Expect = 2e-04
 Identities = 16/93 (17%), Positives = 25/93 (26%), Gaps = 5/93 (5%)

Query: 2   ALGATKLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPG 61
                  L    D        +           +  A   +   L      +       G
Sbjct: 159 LRLLGFSLTSALDFFRGRFGSELLRALLAYSAVYGGAPPSTPPALYL---LLSHLGLSGG 215

Query: 62  CSLEYPLRGSGALVNALVRGIEKFGGRLSLRSR 94
             + YP  G GALV+AL     + GG +   + 
Sbjct: 216 --VFYPRGGMGALVDALAELAREHGGEIRTGAE 246

Length = 487

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.58
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 99.55
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 99.5
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 99.39
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 99.34
PLN02487 569 zeta-carotene desaturase 98.95
TIGR03467 419 HpnE squalene-associated FAD-dependent desaturase. 98.95
PRK07233 434 hypothetical protein; Provisional 98.94
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 98.8
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.68
PRK07208 479 hypothetical protein; Provisional 98.56
PLN02612 567 phytoene desaturase 98.51
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 98.42
PRK12416 463 protoporphyrinogen oxidase; Provisional 98.35
PRK11883 451 protoporphyrinogen oxidase; Reviewed 98.25
PLN02576 496 protoporphyrinogen oxidase 97.91
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.84
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.55
PLN02529 738 lysine-specific histone demethylase 1 96.46
PF00996 438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 96.26
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.08
PF07156 368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 95.77
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 95.4
PLN02676 487 polyamine oxidase 95.24
COG2081 408 Predicted flavoproteins [General function predicti 95.19
PLN02328 808 lysine-specific histone demethylase 1 homolog 94.8
PLN02268 435 probable polyamine oxidase 94.77
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 94.51
PRK13977 576 myosin-cross-reactive antigen; Provisional 94.49
COG0579 429 Predicted dehydrogenase [General function predicti 93.86
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 93.85
TIGR02352 337 thiamin_ThiO glycine oxidase ThiO. This family con 93.71
PLN02568 539 polyamine oxidase 93.41
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 93.32
PRK11728 393 hydroxyglutarate oxidase; Provisional 92.94
PLN03000 881 amine oxidase 92.9
KOG1439 440 consensus RAB proteins geranylgeranyltransferase c 92.66
COG2907 447 Predicted NAD/FAD-binding protein [General functio 92.36
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 92.05
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 91.74
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 91.67
PRK05257 494 malate:quinone oxidoreductase; Validated 91.56
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 91.31
TIGR03197 381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 91.25
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 91.15
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 91.12
PLN02976 1713 amine oxidase 90.71
PRK08274 466 tricarballylate dehydrogenase; Validated 90.63
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 90.48
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 89.21
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 88.68
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 87.1
PRK07121 492 hypothetical protein; Validated 86.69
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 86.49
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 85.77
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 85.56
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 84.82
PTZ00383 497 malate:quinone oxidoreductase; Provisional 84.1
PRK12842 574 putative succinate dehydrogenase; Reviewed 83.88
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 83.7
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 83.13
PRK13339 497 malate:quinone oxidoreductase; Reviewed 82.93
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 82.8
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 82.71
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 80.78
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 80.61
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information 
Probab=99.58  E-value=7.9e-15  Score=110.77  Aligned_cols=90  Identities=17%  Similarity=0.104  Sum_probs=74.5

Q ss_pred             cccCcHHHHHhcCC--CCCHHHHHHHHHHHHHhcCCCCCchhHHHHHHHHHHHhCCCCceeeeCCcHHHHHHHHHHHHHh
Q 044011            7 KLLRPFSDIIDSLE--LKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEK   84 (99)
Q Consensus         7 ~~~~s~~~~l~~~~--f~~~~l~~~l~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~p~GG~~~l~~aL~~~i~~   84 (99)
                      +...|+.|++++ +  |+|+.+|++++.++..+.+.||+++++.++.+++... ....|.++|+||+++|+++|++.+++
T Consensus       167 ~~~~s~~~~l~~-~~~~~~~~lr~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~G~~~~~GG~~~l~~aL~~~~~~  244 (492)
T TIGR02733       167 LSLLTVADLLRL-CGLGDDRRLRRFLDLQLKLYSQEDADETAALYGATVLQMA-QAPHGLWHLHGSMQTLSDRLVEALKR  244 (492)
T ss_pred             hhhhhHHHHHHH-hCCCccHHHHHHHHHHHhhhccCChhhhhHHHHHHHhhcc-ccCCCceeecCcHHHHHHHHHHHHHh
Confidence            345899999998 5  8999999999988755777888888877765444332 22246799999999999999999999


Q ss_pred             cCcEEEcCccceec
Q 044011           85 FGGRLSLRSRGKDS   98 (99)
Q Consensus        85 ~Gg~v~~~~~V~~I   98 (99)
                      +||+|++|++|++|
T Consensus       245 ~G~~i~~~~~V~~I  258 (492)
T TIGR02733       245 DGGNLLTGQRVTAI  258 (492)
T ss_pred             cCCEEeCCceEEEE
Confidence            99999999999998

Members of this family are slr1293, a carotenoid biosynthesis protein which was shown to be the C-3',4' desaturase (CrtD) of myxoxanthophyll biosynthesis in Synechocystis sp. strain PCC 6803, and close homologs (presumed to be functionally equivalent) from other cyanobacteria, where myxoxanthophyll biosynthesis is either known or expected. This enzyme can act on neurosporene and so presumably catalyzes the first step that is committed to myxoxanthophyll.
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 1e-14
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 2e-08
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
 Score = 66.6 bits (163), Expect = 1e-14
 Identities = 16/88 (18%), Positives = 32/88 (36%), Gaps = 2/88 (2%)

Query: 7   KLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEY 66
                    I S ++ D ++  + D        +KS+ +   E+  +    Y+ G     
Sbjct: 133 PSGSSLQAWIKS-QVSDEWLIKFADSFCGWALSLKSDEVPVEEVFEIIENMYRFGG-TGI 190

Query: 67  PLRGSGALVNALVRGIEKFGGRLSLRSR 94
           P  G   +++AL   I   GG++     
Sbjct: 191 PEGGCKGIIDALETVISANGGKIHTGQE 218
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.56
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 99.24
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 99.15
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 99.09
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 99.07
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 98.99
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 98.75
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.58
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.57
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 98.56
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 98.46
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.4
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.3
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.0
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.9
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.84
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 97.63
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.6
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.46
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 97.44
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 96.93
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 96.84
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.82
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.82
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 96.7
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.65
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 96.32
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 95.76
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 95.5
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 94.36
3dme_A 369 Conserved exported protein; structural genomics, P 94.29
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 94.2
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 93.33
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 93.11
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 92.98
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 92.96
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 92.86
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 92.64
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 91.83
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 91.54
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 91.09
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 90.93
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 90.86
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 90.43
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 87.83
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 87.55
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 87.33
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 87.19
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 86.89
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 86.18
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 84.92
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 84.61
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 82.85
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 82.28
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 81.04
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 80.85
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 80.8
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 80.49
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 80.45
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 80.08
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
Probab=99.56  E-value=9.7e-15  Score=108.01  Aligned_cols=84  Identities=21%  Similarity=0.326  Sum_probs=67.5

Q ss_pred             CcHHHHHhcCCCCCHHHHHHHHHHHHHhcCCCCCchhHHHHHHHHHHHhCCCCceeeeCCcHHHHHHHHHHHHHhcCcEE
Q 044011           10 RPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFAEWYKPGCSLEYPLRGSGALVNALVRGIEKFGGRL   89 (99)
Q Consensus        10 ~s~~~~l~~~~f~~~~l~~~l~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~p~GG~~~l~~aL~~~i~~~Gg~v   89 (99)
                      .|+.+.+++ +|+||.+|++++.++. +.+.+|.++++.+..+....   ...|++||+||+++|+++|++.++++||+|
T Consensus       164 ~~~~~~~~~-~~~~~~l~~~l~~~~~-~~g~~p~~~~~~~~~~~~~~---~~~G~~~p~GG~~~l~~aL~~~~~~~Gg~I  238 (501)
T 4dgk_A          164 RSVYSKVAS-YIEDEHLRQAFSFHSL-LVGGNPFATSSIYTLIHALE---REWGVWFPRGGTGALVQGMIKLFQDLGGEV  238 (501)
T ss_dssp             HHHHHHHHT-TCCCHHHHHHHHHHHH-HHHSCC--CCCTHHHHHHHH---SCCCEEEETTHHHHHHHHHHHHHHHTTCEE
T ss_pred             ccHHHHHHH-HhccHHHHhhhhhhhc-ccCCCcchhhhhhhhhhhhh---ccCCeEEeCCCCcchHHHHHHHHHHhCCce
Confidence            578899999 8999999999998874 45555566666554433333   345689999999999999999999999999


Q ss_pred             EcCccceec
Q 044011           90 SLRSRGKDS   98 (99)
Q Consensus        90 ~~~~~V~~I   98 (99)
                      ++|++|++|
T Consensus       239 ~~~~~V~~I  247 (501)
T 4dgk_A          239 VLNARVSHM  247 (501)
T ss_dssp             ECSCCEEEE
T ss_pred             eeecceeEE
Confidence            999999998
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.1
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.35
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 97.11
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 96.93
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.58
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.36
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.07
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 95.28
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.92
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 93.9
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.32
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.12
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.73
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.72
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 92.7
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 92.53
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 92.33
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.29
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.28
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.03
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.56
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 91.39
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 91.32
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 90.82
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.57
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.37
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.26
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.55
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.13
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 86.82
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 85.01
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 81.45
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 80.83
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Guanine nucleotide dissociation inhibitor, GDI
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.10  E-value=1.4e-10  Score=74.26  Aligned_cols=91  Identities=12%  Similarity=0.030  Sum_probs=60.4

Q ss_pred             cccCcHHHHHhcCCCCCHHHHHHHHHHHHHhcCCCCCchhHHHHHHHHH-----HHhCCCCceeeeCCcHHHHHHHHHHH
Q 044011            7 KLLRPFSDIIDSLELKDPFVRNWIDLLAFLLAGVKSNGILSAEMVYMFA-----EWYKPGCSLEYPLRGSGALVNALVRG   81 (99)
Q Consensus         7 ~~~~s~~~~l~~~~f~~~~l~~~l~~~~~~~~g~~~~~~~~~~~~~~~~-----~~~~~~~g~~~p~GG~~~l~~aL~~~   81 (99)
                      +...++.+++++ +..++.++.++..........+....++......+.     .......+.+||+||+++|+++|++.
T Consensus       167 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gG~~~l~~~l~~~  245 (297)
T d2bcgg1         167 LDKNTMDEVYYK-FGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLGELPQGFARL  245 (297)
T ss_dssp             TTTSBHHHHHHH-TTCCHHHHHHHHHHTSCCSSSGGGGSBHHHHHHHHHHHHHHHHHHSSCSEEEETTCTTHHHHHHHHH
T ss_pred             ccchhhhhhhhh-hccCHHHHHHHHHHHhhhccccccchhhhhhhhhhhhhhhcccccccCcceeccCcHHHHHHHHHHH
Confidence            344688999999 677888888776433111111111223322221111     11112246789999999999999999


Q ss_pred             HHhcCcEEEcCccceec
Q 044011           82 IEKFGGRLSLRSRGKDS   98 (99)
Q Consensus        82 i~~~Gg~v~~~~~V~~I   98 (99)
                      ++++||+|++|++|++|
T Consensus       246 ~~~~G~~i~~~~~V~~I  262 (297)
T d2bcgg1         246 SAIYGGTYMLDTPIDEV  262 (297)
T ss_dssp             HHHTTCEEECSCCCCEE
T ss_pred             HHhcCCEEEeCCEeeEE
Confidence            99999999999999998
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure