Citrus Sinensis ID: 044025
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| 256016311 | 535 | importin alpha [Citrus sinensis] | 0.790 | 0.190 | 0.690 | 2e-35 | |
| 255542930 | 450 | importin alpha, putative [Ricinus commun | 0.775 | 0.222 | 0.675 | 1e-33 | |
| 224125002 | 537 | predicted protein [Populus trichocarpa] | 0.837 | 0.201 | 0.617 | 4e-32 | |
| 449453998 | 537 | PREDICTED: importin subunit alpha-1-like | 0.790 | 0.189 | 0.628 | 8e-32 | |
| 225450549 | 535 | PREDICTED: importin subunit alpha-1 [Vit | 0.775 | 0.186 | 0.630 | 2e-30 | |
| 147818271 | 523 | hypothetical protein VITISV_026717 [Viti | 0.775 | 0.191 | 0.630 | 2e-30 | |
| 13752560 | 535 | importin alpha 1 [Capsicum annuum] | 0.790 | 0.190 | 0.610 | 4e-30 | |
| 297843718 | 538 | hypothetical protein ARALYDRAFT_888168 [ | 0.806 | 0.193 | 0.591 | 5e-30 | |
| 15217478 | 538 | importin alpha isoform 4 [Arabidopsis th | 0.775 | 0.185 | 0.603 | 1e-29 | |
| 2959322 | 528 | Importin alpha-like protein [Arabidopsis | 0.775 | 0.189 | 0.603 | 2e-29 |
| >gi|256016311|gb|ACU56981.1| importin alpha [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 2e-35, Method: Compositional matrix adjust.
Identities = 78/113 (69%), Positives = 88/113 (77%), Gaps = 11/113 (9%)
Query: 28 MYTVIVANIILLLVHLLQHAELEIK-EATWAISSATYGGSHEHIQFLVSQGYIKPLCDLL 86
+ VI ANIIL LVHLLQHAE EIK EA WAIS+AT GGSH+ IQFLVSQG IKPLCDLL
Sbjct: 364 IQAVIEANIILPLVHLLQHAEFEIKKEAAWAISNATSGGSHQQIQFLVSQGCIKPLCDLL 423
Query: 87 VCSDQRIVTVCLNG----------NRKLGMDNRVNVYTQMINECDGLDKIENL 129
VC D RIVTVCL G ++++GM+N +NVY QMI+ECDGLDKIENL
Sbjct: 424 VCPDPRIVTVCLEGLENILKVGEADKEMGMNNGINVYAQMIDECDGLDKIENL 476
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255542930|ref|XP_002512528.1| importin alpha, putative [Ricinus communis] gi|223548489|gb|EEF49980.1| importin alpha, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224125002|ref|XP_002319478.1| predicted protein [Populus trichocarpa] gi|222857854|gb|EEE95401.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449453998|ref|XP_004144743.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus] gi|449490806|ref|XP_004158712.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225450549|ref|XP_002281670.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera] gi|296089795|emb|CBI39614.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147818271|emb|CAN64716.1| hypothetical protein VITISV_026717 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|13752560|gb|AAK38726.1|AF369706_1 importin alpha 1 [Capsicum annuum] | Back alignment and taxonomy information |
|---|
| >gi|297843718|ref|XP_002889740.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. lyrata] gi|297335582|gb|EFH65999.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15217478|ref|NP_172398.1| importin alpha isoform 4 [Arabidopsis thaliana] gi|30681049|ref|NP_849623.1| importin alpha isoform 4 [Arabidopsis thaliana] gi|3249096|gb|AAC24079.1| Match to mRNA for importin alpha-like protein 4 (impa4) gb|Y14616 from A. thaliana. ESTs gb|N96440, gb|N37503, gb|N37498 and gb|T42198 come from this gene [Arabidopsis thaliana] gi|20259334|gb|AAM13992.1| putative importin alpha protein [Arabidopsis thaliana] gi|21436201|gb|AAM51388.1| putative importin alpha protein [Arabidopsis thaliana] gi|222422859|dbj|BAH19416.1| AT1G09270 [Arabidopsis thaliana] gi|332190300|gb|AEE28421.1| importin alpha isoform 4 [Arabidopsis thaliana] gi|332190301|gb|AEE28422.1| importin alpha isoform 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|2959322|emb|CAA74966.1| Importin alpha-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| TAIR|locus:2195351 | 538 | IMPA-4 "AT1G09270" [Arabidopsi | 0.604 | 0.144 | 0.602 | 1.5e-22 | |
| TAIR|locus:2083313 | 532 | IMPA-1 "importin alpha isoform | 0.604 | 0.146 | 0.556 | 1.3e-19 | |
| TAIR|locus:2196140 | 539 | IMPA-6 "importin alpha isoform | 0.604 | 0.144 | 0.568 | 4.8e-19 | |
| TAIR|locus:2132238 | 531 | MOS6 "MODIFIER OF SNC1, 6" [Ar | 0.604 | 0.146 | 0.534 | 1.6e-18 | |
| TAIR|locus:505006475 | 535 | IMPA-2 "importin alpha isoform | 0.604 | 0.145 | 0.522 | 7.3e-18 | |
| TAIR|locus:2078122 | 528 | IMPA-7 "importin alpha isoform | 0.410 | 0.100 | 0.584 | 7.6e-15 | |
| TAIR|locus:2155929 | 519 | IMPA-5 "importin alpha isoform | 0.604 | 0.150 | 0.517 | 1.6e-14 | |
| UNIPROTKB|Q5ZJZ0 | 533 | KPNA6 "Importin subunit alpha" | 0.604 | 0.146 | 0.517 | 2.5e-13 | |
| MGI|MGI:1100836 | 536 | Kpna6 "karyopherin (importin) | 0.604 | 0.145 | 0.517 | 3.3e-13 | |
| DICTYBASE|DDB_G0272318 | 516 | DDB_G0272318 "putative importi | 0.604 | 0.151 | 0.494 | 3.9e-13 |
| TAIR|locus:2195351 IMPA-4 "AT1G09270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 268 (99.4 bits), Expect = 1.5e-22, P = 1.5e-22
Identities = 53/88 (60%), Positives = 67/88 (76%)
Query: 52 KEATWAISSATYGGSHEHIQFLVSQGYIKPLCDLLVCSDQRIVTVCLNG----------N 101
KEA WAIS+AT GGSHE IQ+LV+QG IKPLCDLL+C D RIVTVCL G +
Sbjct: 394 KEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAD 453
Query: 102 RKLGMDNRVNVYTQMINECDGLDKIENL 129
+++G+++ VN+Y Q+I E DGLDK+ENL
Sbjct: 454 KEMGLNSGVNLYAQIIEESDGLDKVENL 481
|
|
| TAIR|locus:2083313 IMPA-1 "importin alpha isoform 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196140 IMPA-6 "importin alpha isoform 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132238 MOS6 "MODIFIER OF SNC1, 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006475 IMPA-2 "importin alpha isoform 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078122 IMPA-7 "importin alpha isoform 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155929 IMPA-5 "importin alpha isoform 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJZ0 KPNA6 "Importin subunit alpha" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1100836 Kpna6 "karyopherin (importin) alpha 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272318 DDB_G0272318 "putative importin subunit alpha B" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| COG5064 | 526 | COG5064, SRP1, Karyopherin (importin) alpha [Intra | 1e-23 | |
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 3e-09 | |
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 7e-04 |
| >gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Score = 94.6 bits (235), Expect = 1e-23
Identities = 50/111 (45%), Positives = 69/111 (62%), Gaps = 12/111 (10%)
Query: 31 VIVANIILLLVHLLQHAELEI-KEATWAISSATYGGSH--EHIQFLVSQGYIKPLCDLLV 87
VI AN+I L+HLL AE +I KEA WAIS+AT GG + + I++LVSQG+IKPLCDLL
Sbjct: 365 VIDANLIPPLIHLLSSAEYKIKKEACWAISNATSGGLNRPDIIRYLVSQGFIKPLCDLLD 424
Query: 88 CSDQRIVTVCLNGNR---KLGMDNR------VNVYTQMINECDGLDKIENL 129
D +I+ V L+ K+G +R +N+Y + + G+D I L
Sbjct: 425 VVDNKIIEVALDAIENILKVGEQDRLRYGKNINIYAVYVEKAGGMDAIHGL 475
|
Length = 526 |
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 99.97 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 99.95 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 99.84 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 99.73 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.65 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.51 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 99.42 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 99.34 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 99.32 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 99.02 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 99.01 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 98.69 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 98.57 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 98.52 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 98.51 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 98.45 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 98.45 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 98.26 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 98.23 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 98.06 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 98.06 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 98.04 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 97.93 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 97.86 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 97.8 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 97.69 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 97.68 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 97.58 | |
| KOG0168 | 1051 | consensus Putative ubiquitin fusion degradation pr | 97.55 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 97.55 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 97.5 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 97.27 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 97.24 | |
| PRK09687 | 280 | putative lyase; Provisional | 97.0 | |
| PF14668 | 73 | RICTOR_V: Rapamycin-insensitive companion of mTOR, | 96.93 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 96.81 | |
| PRK09687 | 280 | putative lyase; Provisional | 96.64 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 96.61 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 96.51 | |
| PF14668 | 73 | RICTOR_V: Rapamycin-insensitive companion of mTOR, | 96.4 | |
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 96.18 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 96.16 | |
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 96.02 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 95.84 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 95.83 | |
| KOG2171 | 1075 | consensus Karyopherin (importin) beta 3 [Nuclear s | 95.65 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 95.62 | |
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 95.52 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 95.5 | |
| KOG0168 | 1051 | consensus Putative ubiquitin fusion degradation pr | 95.43 | |
| PF09759 | 102 | Atx10homo_assoc: Spinocerebellar ataxia type 10 pr | 95.2 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 95.18 | |
| KOG4646 | 173 | consensus Uncharacterized conserved protein, conta | 95.16 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 95.02 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 94.95 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 94.8 | |
| KOG2171 | 1075 | consensus Karyopherin (importin) beta 3 [Nuclear s | 94.77 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 94.53 | |
| PF05536 | 543 | Neurochondrin: Neurochondrin | 94.38 | |
| PF09759 | 102 | Atx10homo_assoc: Spinocerebellar ataxia type 10 pr | 94.09 | |
| KOG1222 | 791 | consensus Kinesin associated protein KAP [Intracel | 94.04 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 93.97 | |
| COG5369 | 743 | Uncharacterized conserved protein [Function unknow | 93.94 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 93.6 | |
| KOG4646 | 173 | consensus Uncharacterized conserved protein, conta | 93.5 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 92.89 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 91.74 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 91.61 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 91.54 | |
| KOG1222 | 791 | consensus Kinesin associated protein KAP [Intracel | 90.92 | |
| PF10363 | 92 | DUF2435: Protein of unknown function (DUF2435) | 89.69 | |
| KOG2023 | 885 | consensus Nuclear transport receptor Karyopherin-b | 89.51 | |
| PF07923 | 293 | N1221: N1221-like protein; InterPro: IPR012486 The | 88.54 | |
| KOG1061 | 734 | consensus Vesicle coat complex AP-1/AP-2/AP-4, bet | 88.51 | |
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 88.37 | |
| PF08045 | 257 | CDC14: Cell division control protein 14, SIN compo | 88.31 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 87.99 | |
| KOG4413 | 524 | consensus 26S proteasome regulatory complex, subun | 87.6 | |
| PF04063 | 192 | DUF383: Domain of unknown function (DUF383); Inter | 87.45 | |
| PF10165 | 446 | Ric8: Guanine nucleotide exchange factor synembryn | 87.35 | |
| cd00256 | 429 | VATPase_H VATPase_H, regulatory vacuolar ATP synth | 87.18 | |
| PF06371 | 187 | Drf_GBD: Diaphanous GTPase-binding Domain; InterPr | 87.15 | |
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 87.09 | |
| KOG1824 | 1233 | consensus TATA-binding protein-interacting protein | 87.06 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 86.7 | |
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 86.59 | |
| KOG2259 | 823 | consensus Uncharacterized conserved protein [Funct | 86.46 | |
| PF11701 | 157 | UNC45-central: Myosin-binding striated muscle asse | 86.45 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 86.32 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 86.32 | |
| PF12460 | 415 | MMS19_C: RNAPII transcription regulator C-terminal | 86.27 | |
| KOG4535 | 728 | consensus HEAT and armadillo repeat-containing pro | 86.2 | |
| KOG3036 | 293 | consensus Protein involved in cell differentiation | 85.6 | |
| KOG2759 | 442 | consensus Vacuolar H+-ATPase V1 sector, subunit H | 85.59 | |
| PF12830 | 187 | Nipped-B_C: Sister chromatid cohesion C-terminus | 85.56 | |
| PF12719 | 298 | Cnd3: Nuclear condensing complex subunits, C-term | 85.52 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 85.05 | |
| KOG1241 | 859 | consensus Karyopherin (importin) beta 1 [Nuclear s | 84.73 | |
| KOG2734 | 536 | consensus Uncharacterized conserved protein [Funct | 84.22 | |
| KOG2023 | 885 | consensus Nuclear transport receptor Karyopherin-b | 84.21 | |
| COG5231 | 432 | VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene | 84.17 | |
| KOG4535 | 728 | consensus HEAT and armadillo repeat-containing pro | 83.13 | |
| PF11701 | 157 | UNC45-central: Myosin-binding striated muscle asse | 82.34 | |
| PF06025 | 379 | DUF913: Domain of Unknown Function (DUF913); Inter | 82.17 | |
| KOG4413 | 524 | consensus 26S proteasome regulatory complex, subun | 81.64 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 81.4 | |
| KOG1241 | 859 | consensus Karyopherin (importin) beta 1 [Nuclear s | 80.93 | |
| COG5369 | 743 | Uncharacterized conserved protein [Function unknow | 80.76 | |
| KOG2759 | 442 | consensus Vacuolar H+-ATPase V1 sector, subunit H | 80.67 | |
| smart00567 | 30 | EZ_HEAT E-Z type HEAT repeats. Present in subunits | 80.46 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 80.33 | |
| PF08216 | 108 | CTNNBL: Catenin-beta-like, Arm-motif containing nu | 80.2 |
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=99.97 E-value=3e-31 Score=214.84 Aligned_cols=114 Identities=48% Similarity=0.720 Sum_probs=106.5
Q ss_pred HHHHHHHHhhH----hHHHHHhhccHHHHHHHhccCChHHH-HHHHHHHHhccCCCHHHHHHHHhcCChHHHHhhcCCCC
Q 044025 16 KENTLDSNIVV----CMYTVIVANIILLLVHLLQHAELEIK-EATWAISSATYGGSHEHIQFLVSQGYIKPLCDLLVCSD 90 (129)
Q Consensus 16 r~~w~lsNI~~----qiq~vi~~g~lp~L~~ll~~~~~~v~-eA~wal~Ni~~~~~~~~i~~lv~~g~i~~l~~lL~~~d 90 (129)
.++|++|||++ |+|+|+++|++|.|+.+|+++|+++| ||+|||+|++.+|+++|+.||+++|+|++||++|.+.|
T Consensus 341 EAcW~iSNItAG~~~qiqaVida~l~p~Li~~l~~~ef~~rKEAawaIsN~ts~g~~~qi~yLv~~giI~plcdlL~~~D 420 (514)
T KOG0166|consen 341 EACWTISNITAGNQEQIQAVIDANLIPVLINLLQTAEFDIRKEAAWAISNLTSSGTPEQIKYLVEQGIIKPLCDLLTCPD 420 (514)
T ss_pred HHHHHHHHhhcCCHHHHHHHHHcccHHHHHHHHhccchHHHHHHHHHHHhhcccCCHHHHHHHHHcCCchhhhhcccCCC
Confidence 35699999999 99999999999999999999999999 99999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhhcccCC---CC---hHHHHHHHhccchhhhcCC
Q 044025 91 QRIVTVCLNGNRKLGMDN---RV---NVYTQMINECDGLDKIENL 129 (129)
Q Consensus 91 ~~~~~~aL~al~ni~~~~---~~---~~~~~~i~e~ggl~~le~L 129 (129)
.+++.++|+|++||.+.+ .. ++++.+|+||||+++||.|
T Consensus 421 ~~ii~v~Ld~l~nil~~~e~~~~~~~n~~~~~IEe~ggldkiE~L 465 (514)
T KOG0166|consen 421 VKIILVALDGLENILKVGEAEKNRGTNPLAIMIEEAGGLDKIENL 465 (514)
T ss_pred hHHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHccChhHHHHh
Confidence 999999999999984411 11 8999999999999999976
|
|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 | Back alignment and domain information |
|---|
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05536 Neurochondrin: Neurochondrin | Back alignment and domain information |
|---|
| >PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 | Back alignment and domain information |
|---|
| >KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >COG5369 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10363 DUF2435: Protein of unknown function (DUF2435) | Back alignment and domain information |
|---|
| >KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07923 N1221: N1221-like protein; InterPro: IPR012486 The sequences featured in this family are similar to a hypothetical protein product of ORF N1221 in the CPT1-SPC98 intergenic region of the yeast genome (P53917 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function | Back alignment and domain information |
|---|
| >PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] | Back alignment and domain information |
|---|
| >cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments | Back alignment and domain information |
|---|
| >PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2259 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins | Back alignment and domain information |
|---|
| >KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus | Back alignment and domain information |
|---|
| >PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2734 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle | Back alignment and domain information |
|---|
| >PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing | Back alignment and domain information |
|---|
| >KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5369 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] | Back alignment and domain information |
|---|
| >smart00567 EZ_HEAT E-Z type HEAT repeats | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF08216 CTNNBL: Catenin-beta-like, Arm-motif containing nuclear; InterPro: IPR013180 This domain is found in eukaryotic proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 129 | ||||
| 4b8j_A | 528 | Rimp_alpha1a Length = 528 | 2e-23 | ||
| 2yns_A | 490 | Rimp_alpha_b54nls Length = 490 | 2e-23 | ||
| 3tj3_A | 447 | Structure Of Importin A5 Bound To The N-Terminus Of | 5e-15 | ||
| 2jdq_A | 450 | C-Terminal Domain Of Influenza A Virus Polymerase P | 5e-15 | ||
| 3rz9_A | 510 | Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt | 2e-11 | ||
| 4ba3_A | 496 | Mimp_alphadibb_a89nls Length = 496 | 2e-11 | ||
| 3ukw_B | 510 | Mouse Importin Alpha: Bimax1 Peptide Complex Length | 2e-11 | ||
| 4htv_A | 509 | Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex | 3e-11 | ||
| 2ynr_A | 461 | Mimp_alphadibb_b54nls Length = 461 | 3e-11 | ||
| 1q1s_C | 466 | Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid | 3e-11 | ||
| 1ejl_I | 460 | Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti | 3e-11 | ||
| 2c1m_A | 424 | Nup50:importin-Alpha Complex Length = 424 | 4e-11 | ||
| 3ve6_A | 426 | Crystal Structure Analysis Of Venezuelan Equine Enc | 4e-11 | ||
| 3tpm_A | 422 | Crystal Structure Of Mal Rpel Domain In Complex Wit | 4e-11 | ||
| 3l3q_A | 427 | Mouse Importin Alpha-Peptm Nls Peptide Complex Leng | 4e-11 | ||
| 1y2a_C | 428 | Structure Of Mammalian Importin Bound To The Non-Cl | 4e-11 | ||
| 3btr_C | 427 | Ar-Nls:importin-Alpha Complex Length = 427 | 4e-11 | ||
| 1ial_A | 453 | Importin Alpha, Mouse Length = 453 | 4e-11 | ||
| 3fex_C | 467 | Crystal Structure Of The Cbc-Importin Alpha Complex | 4e-11 | ||
| 3tpo_A | 529 | Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP | 2e-10 | ||
| 1ee5_A | 424 | Yeast Karyopherin (Importin) Alpha In A Complex Wit | 3e-10 | ||
| 1un0_A | 443 | Crystal Structure Of Yeast Karyopherin (Importin) A | 3e-10 | ||
| 1ee4_A | 423 | Crystal Structure Of Yeast Karyopherin (Importin) A | 3e-10 | ||
| 1bk6_A | 422 | Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng | 3e-10 | ||
| 1bk5_A | 422 | Karyopherin Alpha From Saccharomyces Cerevisiae Len | 3e-10 | ||
| 2c1t_A | 454 | Structure Of The Kap60p:nup2 Complex Length = 454 | 3e-10 | ||
| 1wa5_B | 530 | Crystal Structure Of The Exportin Cse1p Complexed W | 8e-10 |
| >pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 | Back alignment and structure |
|
| >pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 | Back alignment and structure |
| >pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 | Back alignment and structure |
| >pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 | Back alignment and structure |
| >pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 | Back alignment and structure |
| >pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 | Back alignment and structure |
| >pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 | Back alignment and structure |
| >pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 | Back alignment and structure |
| >pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 | Back alignment and structure |
| >pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 | Back alignment and structure |
| >pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 | Back alignment and structure |
| >pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 | Back alignment and structure |
| >pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 | Back alignment and structure |
| >pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 | Back alignment and structure |
| >pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 | Back alignment and structure |
| >pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 | Back alignment and structure |
| >pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 | Back alignment and structure |
| >pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 | Back alignment and structure |
| >pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 | Back alignment and structure |
| >pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 | Back alignment and structure |
| >pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 | Back alignment and structure |
| >pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 | Back alignment and structure |
| >pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 | Back alignment and structure |
| >pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 | Back alignment and structure |
| >pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 9e-21 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 1e-07 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 2e-18 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 4e-05 | |
| 3oqs_A | 510 | Importin subunit alpha-2; importin alpha, karyophe | 2e-18 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 3e-18 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 2e-04 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 3e-16 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 2e-11 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 3e-06 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 1e-08 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 1e-05 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 2e-04 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 5e-04 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 9e-04 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 3e-08 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 5e-07 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 1e-06 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 5e-06 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 9e-05 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 2e-04 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 7e-04 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 1e-07 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 4e-06 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 8e-06 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 6e-05 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 5e-04 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 4e-05 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 3e-04 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 3e-04 |
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
Score = 85.3 bits (211), Expect = 9e-21
Identities = 51/109 (46%), Positives = 61/109 (55%), Gaps = 10/109 (9%)
Query: 31 VIVANIILLLVHLLQHAELEIK-EATWAISSATYGGSHEHIQFLVSQGYIKPLCDLLVCS 89
VI ANI L+ +LQ AE + EA WAI++AT GGS E I++LV G IKPLCDLL
Sbjct: 314 VIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVM 373
Query: 90 DQRIVTVCLNG---------NRKLGMDNRVNVYTQMINECDGLDKIENL 129
D +IV V LNG +N Y +I E GLDKIE L
Sbjct: 374 DSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFL 422
|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.9 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.89 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.75 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 99.75 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.74 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.73 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.73 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.73 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.72 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 99.72 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 99.71 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.7 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 99.68 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.65 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 99.63 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.62 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.62 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.61 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 99.61 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.6 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 99.6 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 99.59 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 99.58 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 99.56 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 99.56 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 99.55 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 99.5 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 99.47 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.47 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 99.46 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 99.46 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 99.4 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 99.32 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 99.22 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 99.16 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 99.07 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 98.73 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 98.73 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 98.59 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 98.37 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 98.32 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 98.23 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.92 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.88 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 97.87 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 97.84 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.82 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.8 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 97.75 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 97.7 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 97.66 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 97.64 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 97.54 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 97.47 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 97.35 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 97.34 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 97.21 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 97.17 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 97.16 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 96.97 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 96.92 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 96.68 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 96.65 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 95.99 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 95.97 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 95.48 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 94.79 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 94.63 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 94.5 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 94.41 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 93.68 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 93.54 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 93.46 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 93.08 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 92.82 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 92.31 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 92.28 | |
| 3m1i_C | 1049 | Exportin-1; heat repeat, GTP-binding, nucleotide-b | 92.26 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 91.17 | |
| 4hat_C | 1023 | Exportin-1; heat repeat, nuclear export, RAN-ranbp | 90.96 | |
| 2x1g_F | 971 | Cadmus; transport protein, developmental protein, | 90.95 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 90.48 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 89.52 | |
| 4hat_C | 1023 | Exportin-1; heat repeat, nuclear export, RAN-ranbp | 89.02 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 87.56 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 86.38 | |
| 1ho8_A | 480 | Vacuolar ATP synthase subunit H; heat repeat, hydr | 86.08 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 85.19 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 84.54 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 80.5 |
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
Probab=99.90 E-value=1.6e-23 Score=169.75 Aligned_cols=119 Identities=34% Similarity=0.511 Sum_probs=108.3
Q ss_pred ChHHHHHHHHHHHhhH----hHHHHHhhccHHHHHHHhccCChHHH-HHHHHHHHhccCCCHHHHHHHHhcCChHHHHhh
Q 044025 11 PLSKLKENTLDSNIVV----CMYTVIVANIILLLVHLLQHAELEIK-EATWAISSATYGGSHEHIQFLVSQGYIKPLCDL 85 (129)
Q Consensus 11 ~~~~~r~~w~lsNI~~----qiq~vi~~g~lp~L~~ll~~~~~~v~-eA~wal~Ni~~~~~~~~i~~lv~~g~i~~l~~l 85 (129)
+.....++|+|+||++ +++.++++|++|.|+.++.++++++| +|+|||+|++.+++++++.++++.|++++|+++
T Consensus 349 ~~i~~~a~~aL~nl~~~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~A~~aL~nl~~~~~~~~~~~l~~~g~i~~L~~L 428 (529)
T 3tpo_A 349 TNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKAAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNL 428 (529)
T ss_dssp HHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCHHHHHHG
T ss_pred HHHHHHHHHHHHHHhcccHHHHHHHHhcCcHHHHHHHhcCCCHHHHHHHHHHHHHHHcCCCHHHHHHHHHCcCHHHHHHH
Confidence 3344446699999998 78889999999999999999999999 999999999999899999999999999999999
Q ss_pred cCCCCHHHHHHHHHHHhhccc----CCCChHHHHHHHhccchhhhcCC
Q 044025 86 LVCSDQRIVTVCLNGNRKLGM----DNRVNVYTQMINECDGLDKIENL 129 (129)
Q Consensus 86 L~~~d~~~~~~aL~al~ni~~----~~~~~~~~~~i~e~ggl~~le~L 129 (129)
|.++|++++..+|++|.|+.+ .+..+.++.+|+||||+++||.|
T Consensus 429 L~~~d~~i~~~~L~aL~nil~~~~~~~~~~~~~~~iee~ggl~~ie~L 476 (529)
T 3tpo_A 429 LSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL 476 (529)
T ss_dssp GGCSCHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHTTCHHHHTGG
T ss_pred hcCCCHHHHHHHHHHHHHHHHHhHhccChHHHHHHHHHCCcHHHHHHH
Confidence 999999999999999999842 44678999999999999999976
|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B | Back alignment and structure |
|---|
| >2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 129 | ||||
| d1wa5b_ | 503 | a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S | 7e-13 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 3e-12 |
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: Karyopherin alpha species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 61.7 bits (148), Expect = 7e-13
Identities = 46/115 (40%), Positives = 63/115 (54%), Gaps = 12/115 (10%)
Query: 27 CMYTVIVANIILLLVHLLQHAELEI-KEATWAISSATYGGSH--EHIQFLVSQGYIKPLC 83
+ VI AN+I LV LL+ AE + KEA WAIS+A+ GG + I++LVSQG IKPLC
Sbjct: 364 QIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLC 423
Query: 84 DLLVCSDQRIVTVCLNGNRKL---------GMDNRVNVYTQMINECDGLDKIENL 129
DLL +D RI+ V L+ + +N I + G++KI N
Sbjct: 424 DLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNC 478
|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.75 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.72 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.54 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.45 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.35 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.34 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 98.05 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.88 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 97.02 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.92 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 96.68 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 96.63 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 96.6 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 96.31 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 96.29 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 96.02 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 95.9 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 94.52 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 93.19 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 93.02 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 92.43 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 92.19 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 91.27 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 90.55 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 89.99 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 89.02 | |
| d1ho8a_ | 477 | Regulatory subunit H of the V-type ATPase {Baker's | 88.36 | |
| d1wa5c_ | 959 | Exportin Cse1p {Baker's yeast (Saccharomyces cerev | 85.56 | |
| d1ho8a_ | 477 | Regulatory subunit H of the V-type ATPase {Baker's | 83.98 |
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Armadillo repeat domain: Karyopherin alpha species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.75 E-value=3.2e-18 Score=133.92 Aligned_cols=118 Identities=42% Similarity=0.557 Sum_probs=102.9
Q ss_pred hHHHHHHHHHHHhhH----hHHHHHhhccHHHHHHHhccCChHHH-HHHHHHHHhccCCC--HHHHHHHHhcCChHHHHh
Q 044025 12 LSKLKENTLDSNIVV----CMYTVIVANIILLLVHLLQHAELEIK-EATWAISSATYGGS--HEHIQFLVSQGYIKPLCD 84 (129)
Q Consensus 12 ~~~~r~~w~lsNI~~----qiq~vi~~g~lp~L~~ll~~~~~~v~-eA~wal~Ni~~~~~--~~~i~~lv~~g~i~~l~~ 84 (129)
......+|+++|+++ +++.+++.|++|.+++++.++++++| +|+|+++|++.+++ ++++.++++.|++++|++
T Consensus 345 ~i~~~~~~~l~nl~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~~a~~~l~nl~~~~~~~~~~~~~l~~~~~l~~l~~ 424 (503)
T d1wa5b_ 345 NIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCD 424 (503)
T ss_dssp HHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHHHHHHHHHHHHHHTTTCTHHHHHHHHTTCHHHHHH
T ss_pred HHHHHHHHHHHHHhhccHHHHHHHHHccccchhHHhcccCChhHHHHHHHHHHHHHhcccccHHHHHHHHHCCcHHHHHH
Confidence 334455699999998 77888999999999999999999999 99999999997654 467899999999999999
Q ss_pred hcCCCCHHHHHHHHHHHhhccc---------CCCChHHHHHHHhccchhhhcCC
Q 044025 85 LLVCSDQRIVTVCLNGNRKLGM---------DNRVNVYTQMINECDGLDKIENL 129 (129)
Q Consensus 85 lL~~~d~~~~~~aL~al~ni~~---------~~~~~~~~~~i~e~ggl~~le~L 129 (129)
+|...|++++..+|++|.++.+ ....+++...++++||+++|+.|
T Consensus 425 ~L~~~d~~~~~~~L~~l~~ll~~~~~~~~~~~~~~~~~~~~iee~g~~~~i~~L 478 (503)
T d1wa5b_ 425 LLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNC 478 (503)
T ss_dssp HTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCHHHHHHHHTTHHHHHHGG
T ss_pred HhcCCCHHHHHHHHHHHHHHHHHHHHHhhhhcccchHHHHHHHHCCCHHHHHHH
Confidence 9999999999999999998732 22457889999999999999865
|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|