Citrus Sinensis ID: 044071

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--

HRGLSFVPFDAKNSSSGSGEDDHRAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLLHIGPFRL

cccccEEEEccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccEEEEEEEEEEccccccccccEEEEEEEEEccEEEEEEEEEEEccccccccccc

ccccEEEEEccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEEEEcccEcccccccEEEEEEEcccEEEEEEEEEEEccccccccccc

hrglsfvpfdaknsssgsgeddHRAALETVLKLYSAIKSQSLRELSDIIGDECRCVcnffsflqplqgkKQVLDFFTYLIRSLgnniefvvkptlhdgmnvgVSWRLEwnkkhvplgkgfsFHICQVYQGKVFIKNVEMFMEpllhigpfrl

hrglsfvpfdaknsssgsgeddHRAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLlhigpfrl

HRGLSFVPFDAKNSSSGSGEDDHRAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLLHIGPFRL

**************************LETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLLHIG****

****SFV**********************VLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLLHIGPFRL

HRGLSFVPFD*************RAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLLHIGPFRL

***LSFV*FDA************RAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLLHIGPF*L

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

HRGLSFVPFDAKNSSSGSGEDDHRAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFIKNVEMFMEPLLHIGPFRL

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		152
255559074		254	conserved hypothetical protein [Ricinus	0.986	0.590	0.710	3e-59
87241143		267	hypothetical protein MtrDRAFT_AC150798g6	0.980	0.558	0.646	2e-54
357447893		251	hypothetical protein MTR_2g025760 [Medic	0.980	0.593	0.646	2e-54
147816094		267	hypothetical protein VITISV_022313 [Viti	0.914	0.520	0.564	2e-42
356557961		262	PREDICTED: uncharacterized protein LOC10	0.960	0.557	0.539	2e-40
356532339		399	PREDICTED: uncharacterized protein LOC10	0.967	0.368	0.532	7e-40
359495571		231	PREDICTED: uncharacterized protein LOC10	0.677	0.445	0.435	9e-26
224137316		212	predicted protein [Populus trichocarpa]	0.638	0.457	0.450	1e-23
297799778		130	hypothetical protein ARALYDRAFT_329383 [	0.526	0.615	0.625	3e-23
145341508		130	uncharacterized protein [Arabidopsis tha	0.526	0.615	0.625	4e-23

>gi\|255559074\|ref\|XP_002520559.1\| conserved hypothetical protein [Ricinus communis] gi\|223540219\|gb\|EEF41792.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 129/152 (84%), Gaps = 2/152 (1%)

Query: 1   HRGLSFVPFDAKNSSSGSGEDDHRAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFF 60
            RGLS VPF+   SS    ED    ALETVLKLY+AIK+Q++ E+S++IGDECRCVCNFF
Sbjct: 59  QRGLSLVPFNNDKSSEPREEDT--PALETVLKLYTAIKNQNIHEVSNMIGDECRCVCNFF 116

Query: 61  SFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGF 120
           S  +  QGK+QVLDFF Y++++LGNNIEFVV+PT +DGMNVGVSWRLEW+K H+PLGKGF
Sbjct: 117 SSFESFQGKQQVLDFFNYVMQTLGNNIEFVVQPTKYDGMNVGVSWRLEWSKTHMPLGKGF 176

Query: 121 SFHICQVYQGKVFIKNVEMFMEPLLHIGPFRL 152
           SF+ICQ+YQGKV I+NVEMFMEPLLHI PFRL
Sbjct: 177 SFYICQIYQGKVTIRNVEMFMEPLLHIEPFRL 208

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|87241143\|gb\|ABD33001.1\| hypothetical protein MtrDRAFT_AC150798g6v2 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357447893\|ref\|XP_003594222.1\| hypothetical protein MTR_2g025760 [Medicago truncatula] gi\|355483270\|gb\|AES64473.1\| hypothetical protein MTR_2g025760 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147816094\|emb\|CAN72893.1\| hypothetical protein VITISV_022313 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356557961\|ref\|XP_003547278.1\| PREDICTED: uncharacterized protein LOC100808156 [Glycine max]	Back alignment and taxonomy information

>gi\|356532339\|ref\|XP_003534731.1\| PREDICTED: uncharacterized protein LOC100812303 [Glycine max]	Back alignment and taxonomy information

>gi\|359495571\|ref\|XP_003635025.1\| PREDICTED: uncharacterized protein LOC100853932 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224137316\|ref\|XP_002322527.1\| predicted protein [Populus trichocarpa] gi\|222867157\|gb\|EEF04288.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297799778\|ref\|XP_002867773.1\| hypothetical protein ARALYDRAFT_329383 [Arabidopsis lyrata subsp. lyrata] gi\|297313609\|gb\|EFH44032.1\| hypothetical protein ARALYDRAFT_329383 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|145341508\|ref\|NP_193968.2\| uncharacterized protein [Arabidopsis thaliana] gi\|60547863\|gb\|AAX23895.1\| hypothetical protein At4g22370 [Arabidopsis thaliana] gi\|332659201\|gb\|AEE84601.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		152
TAIR\|locus:2132070		130	AT4G22370 "AT4G22370" [Arabido	0.513	0.6	0.641	2.6e-24
TAIR\|locus:2177906		277	AT5G41470 "AT5G41470" [Arabido	0.809	0.444	0.317	6e-16
TAIR\|locus:2825304		216	AT1G71480 [Arabidopsis thalian	0.802	0.564	0.352	5.4e-15
UNIPROTKB\|Q8EBW2		148	SO_3383 "Uncharacterized prote	0.598	0.614	0.234	0.00016
TIGR_CMR\|SO_3383		148	SO_3383 "transcriptional regul	0.598	0.614	0.234	0.00016

TAIR\|locus:2132070 AT4G22370 "AT4G22370" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 278 (102.9 bits), Expect = 2.6e-24, P = 2.6e-24
 Identities = 50/78 (64%), Positives = 60/78 (76%)

Query:    75 FFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEWNKKHVPLGKGFSFHICQVYQGKVFI 134
             FF +LI  LG +I+ +VKPT  DGM VGV W+LE +K H+ LGKGFSFHIC +YQGK+ I
Sbjct:     3 FFYWLIMKLGKDIKIIVKPTFKDGMTVGVQWQLECDKSHIQLGKGFSFHICHMYQGKLLI 62

Query:   135 KNVEMFMEPLLHIGPFRL 152
             KNVEMFMEP+ HI   RL
Sbjct:    63 KNVEMFMEPIFHIEHLRL 80

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:2177906 AT5G41470 "AT5G41470" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2825304 AT1G71480 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8EBW2 SO_3383 "Uncharacterized protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_3383 SO_3383 "transcriptional regulator-related protein" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_XVI000078	hypothetical protein (212 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		152
PF12680		102	SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8	99.61
TIGR02096		129	conserved hypothetical protein, steroid delta-isom	99.52
cd00781		122	ketosteroid_isomerase ketosteroid isomerase: Many	99.42
PF07366		126	SnoaL: SnoaL-like polyketide cyclase; InterPro: IP	99.37
PRK08241		339	RNA polymerase factor sigma-70; Validated	99.17
TIGR02960		324	SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa	98.98
PRK09636		293	RNA polymerase sigma factor SigJ; Provisional	98.61
TIGR02246		128	conserved hypothetical protein. This family consis	98.57
COG3631		133	Ketosteroid isomerase-related protein [General fun	98.56
PF13474		121	SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE	98.47
PF07858		125	LEH: Limonene-1,2-epoxide hydrolase catalytic doma	98.42
COG4319		137	Ketosteroid isomerase homolog [Function unknown]	98.26
cd00531		124	NTF2_like Nuclear transport factor 2 (NTF2-like) s	98.24
PF10184		113	DUF2358: Uncharacterized conserved protein (DUF235	98.12
PF14534		107	DUF4440: Domain of unknown function (DUF4440); PDB	98.02
TIGR02957		281	SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa	97.74
PF02136		118	NTF2: Nuclear transport factor 2 (NTF2) domain; In	97.65
PRK09635		290	sigI RNA polymerase sigma factor SigI; Provisional	97.63
PF13577		127	SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF	97.46
COG5485		131	Predicted ester cyclase [General function predicti	96.99
PF12893		116	Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL	96.78
PF08332		128	CaMKII_AD: Calcium/calmodulin dependent protein ki	96.68
COG4922		129	Uncharacterized protein conserved in bacteria [Fun	96.41
PF07080		143	DUF1348: Protein of unknown function (DUF1348); In	95.9
cd00780		119	NTF2 Nuclear transport factor 2 (NTF2) domain play	95.89
COG4538		112	Uncharacterized conserved protein [Function unknow	95.25
COG4308		130	LimA Limonene-1,2-epoxide hydrolase [Secondary met	94.86
PF12870		111	Lumazine_bd: Lumazine-binding domain; InterPro: IP	93.73
COG4875		156	Uncharacterized protein conserved in bacteria with	93.46
PF05223		118	MecA_N: NTF2-like N-terminal transpeptidase domain	93.41
cd00667		160	ring_hydroxylating_dioxygenases_beta Ring hydroxyl	85.97
PF11533		125	DUF3225: Protein of unknown function (DUF3225); In	82.17

>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A	Back alignment and domain information

Probab=99.61  E-value=3.8e-15  Score=101.31  Aligned_cols=96  Identities=20%  Similarity=0.396  Sum_probs=83.3

Q ss_pred             HHHHHHHhccCCHhHHHhhhccCcceecCceeccCCcccHHHHHHHHHHHHHHcCCceEEEEceeeecCcEEEEEEEEEe
Q 044071           30 VLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGVSWRLEW  109 (152)
Q Consensus        30 v~~fY~A~n~~dl~~L~el~a~Dc~~~~~d~~f~dPf~G~~av~~~F~~l~~~~~~~~rFvI~~~~~~g~~~~v~W~lew  109 (152)
                      |++||+|+|++|++.+.++|++||+++  + . ..++.|++++.++|+.++++. ...++.+.+...+|..+.+.|++..
T Consensus         1 V~~~~~a~~~~d~~~i~~~~~~d~~~~--~-~-~~~~~g~~~~~~~~~~~~~~~-~~~~~~~~~~~~~gd~v~~~~~~~~   75 (102)
T PF12680_consen    1 VRRFFEAWNAGDLDAIAALFAPDAVFH--D-P-GGTLRGREAIREFFEEFFESF-PDIRFEIHDIFADGDRVVVEWTVTG   75 (102)
T ss_dssp             HHHHHHHHHTTHHHHHHHTEEEEEEEE--E-T-TSEEESHHHHHHHHHHHHHHE-EEEEEEEEEEEEETTEEEEEEEEEE
T ss_pred             CHHHHHHHHcCCHHHHHHHcCCCEEEE--e-C-CCcccCHHHHHHHHHHHHhcC-CceEEEEEEEEEcCCEEEEEEEEEE
Confidence            689999999999999999999997633  2 2 445799999999999999988 7999999999999999999999986


Q ss_pred             ----cccccCCCCceEEEEEeeeCCeEE
Q 044071          110 ----NKKHVPLGKGFSFHICQVYQGKVF  133 (152)
Q Consensus       110 ----~~~~lp~~rGcSf~~~~~~~gki~  133 (152)
                          .++++.. +||+++++  .+|||+
T Consensus        76 ~~~~~g~~~~~-~~~~~~~~--~dgkI~  100 (102)
T PF12680_consen   76 TTPPTGQPISF-RGCSVFRF--EDGKIV  100 (102)
T ss_dssp             EETTTSCEEEE-EEEEEEEE--ETTEEE
T ss_pred             EEcCCCCEEEE-EEEEEEEE--ECCEEE
Confidence                5666666 99999999  559975

...

>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related	Back alignment and domain information

>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon	Back alignment and domain information

>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis	Back alignment and domain information

>PRK08241 RNA polymerase factor sigma-70; Validated	Back alignment and domain information

>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family	Back alignment and domain information

>PRK09636 RNA polymerase sigma factor SigJ; Provisional	Back alignment and domain information

>TIGR02246 conserved hypothetical protein	Back alignment and domain information

>COG3631 Ketosteroid isomerase-related protein [General function prediction only]	Back alignment and domain information

>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B	Back alignment and domain information

>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism	Back alignment and domain information

>COG4319 Ketosteroid isomerase homolog [Function unknown]	Back alignment and domain information

>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily	Back alignment and domain information

>PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins	Back alignment and domain information

>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A	Back alignment and domain information

>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family	Back alignment and domain information

>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein	Back alignment and domain information

>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional	Back alignment and domain information

>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B	Back alignment and domain information

>COG5485 Predicted ester cyclase [General function prediction only]	Back alignment and domain information

>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C	Back alignment and domain information

>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>COG4922 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF07080 DUF1348: Protein of unknown function (DUF1348); InterPro: IPR009783 This family consists of several highly conserved hypothetical proteins of around 150 residues in length	Back alignment and domain information

>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus	Back alignment and domain information

>COG4538 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF12870 Lumazine_bd: Lumazine-binding domain; InterPro: IPR024267 This entry represents a lumazine-binding domain found in a family of putative lipoproteins from bacteria	Back alignment and domain information

>COG4875 Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown]	Back alignment and domain information

>PF05223 MecA_N: NTF2-like N-terminal transpeptidase domain; InterPro: IPR007887 The multiple antibiotic resistance of methicillin-resistant strains of Staphylococcus aureus (MRSA) has become a major clinical problem worldwide	Back alignment and domain information

>cd00667 ring_hydroxylating_dioxygenases_beta Ring hydroxylating dioxygenase beta subunit	Back alignment and domain information

>PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		152
4h3u_A		158	Hypothetical protein; structural genomics, PSI-bio	99.71
3fh1_A		129	Uncharacterized NTF2-like protein; structural geno	99.7
3fgy_A		135	Uncharacterized NTF2-like protein; structural geno	99.64
3g8z_A		148	Protein of unknown function with cystatin-like FO;	99.64
3dm8_A		143	Uncharacterized protein RPA4348; siras, putative i	99.64
3ec9_A		140	Uncharacterized NTF2-like protein; structural geno	99.64
3g16_A		156	Uncharacterized protein with cystatin-like fold; Y	99.62
3ehc_A		128	Snoal-like polyketide cyclase; structural genomics	99.6
3ebt_A		132	Uncharacterized NTF2-like protein; structural geno	99.59
3k0z_A		159	Putative polyketide cyclase; structural genomics,	99.58
3f14_A		112	Uncharacterized NTF2-like protein; YP_680363.1, NT	99.57
3grd_A		134	Uncharacterized NTF2-superfamily protein; NP_97724	99.57
3hk4_A		136	MLR7391 protein; NTF2-like protein, structural gen	99.57
3mso_A		143	Steroid delta-isomerase; structural genomics, join	99.56
3f9s_A		146	Putative polyketide cyclase; structural genomics,	99.56
2f99_A		153	Aklanonic acid methyl ester cyclase, AKNH; anthrac	99.56
2a15_A		139	Hypothetical protein RV0760C; beta-alpha-barrel, s	99.56
1sjw_A		144	Nogalonic acid methyl ester cyclase; anthracycline	99.56
2gey_A		158	ACLR protein; alpha+beta barrel, oxidoreductase; H	99.54
2gex_A		152	SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St	99.54
1tuh_A		156	BAL32A, hypothetical protein EGC068; unknown funct	99.54
3kkg_A		146	Putative snoal-like polyketide cyclase; structural	99.54
3ff2_A		117	Uncharacterized cystatin fold protein (YP_497570.	99.54
1oh0_A		131	Steroid delta-isomerase; ketosteroid isomerase, KS	99.53
3dxo_A		121	Uncharacterized snoal-like protein; putative isome	99.53
1ohp_A		125	Steroid delta-isomerase; inhibitor; HET: ESR; 1.53	99.52
1nww_A		149	Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R	99.51
3i0y_A		140	Putative polyketide cyclase; cystatin-like fold, s	99.5
3f8x_A		148	Putative delta-5-3-ketosteroid isomerase; structur	99.47
2k54_A		123	Protein ATU0742; protein of unknown function, stru	99.47
3f7x_A		151	Putative polyketide cyclase; structural genomics,	99.46
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	99.45
3h3h_A		122	Uncharacterized snoal-like protein; structural gen	99.44
1s5a_A		150	Hypothetical protein YESE; structural genomics, PS	99.43
3f8h_A		150	Putative polyketide cyclase; structural genomics,	99.43
2bng_A		149	MB2760; epoxide hydrolase, limonene, hydrolase, st	99.41
3g0k_A		148	Putative membrane protein; snoal-like polyketide c	99.4
3dmc_A		134	NTF2-like protein; structural genomics, joint cent	99.4
1z1s_A		163	Hypothetical protein PA3332; beta barrel, conserve	99.39
3rga_A		283	Epoxide hydrolase; NTF2-like, epoxide-opening cycl	99.36
3flj_A		155	Uncharacterized protein conserved in bacteria WIT	99.33
3en8_A		128	Uncharacterized NTF-2 like protein; YP_553245.1, N	99.32
3f40_A		114	Uncharacterized NTF2-like protein; YP_677363.1, NT	99.3
3hx8_A		129	MLR2180 protein, putative ketosteroid isomerase; s	99.3
3er7_A		131	Uncharacterized NTF2-like protein; YP_001812677.1,	99.27
3d9r_A		135	Ketosteroid isomerase-like protein; YP_049581.1, s	99.22
3jum_A		185	Phenazine biosynthesis protein A/B; chirality, dru	98.91
3gwr_A		144	Putative calcium/calmodulin-dependent protein KIN	98.8
3h51_A		156	Putative calcium/calmodulin dependent protein KIN	98.77
2gxf_A		142	Hypothetical protein YYBH; alpha-beta protein., st	98.76
3f7s_A		142	Uncharacterized NTF2-like protein; structural geno	98.73
3rob_A		139	Uncharacterized conserved protein; structural geno	98.73
3ff0_A		163	Phenazine biosynthesis protein PHZB 2; cystatin-li	98.73
3lyg_A		120	NTF2-like protein of unknown function; structural	98.71
3gzr_A		146	Uncharacterized protein with A NTF2-like fold; str	98.68
3bb9_A		148	Putative orphan protein; structural genomics, join	98.64
2ux0_A		143	Calcium-calmodulin dependent protein kinase (CAM I	98.47
3cu3_A		172	Domain of unknown function with A cystatin-like F;	98.43
3cnx_A		170	Uncharacterized protein; putative dehydratase, NTF	98.32
3b7c_A		122	Uncharacterized protein; NTF-2 like protein, struc	98.32
4i4k_A		143	Uncharacterized protein SGCJ; structural genomics,	98.18
3ke7_A		134	Putative ketosteroid isomerase; structural genomic	98.13
1tp6_A		128	Hypothetical protein PA1314; structural genomics,	98.12
3mg1_A		323	OCP, orange carotenoid protein; carotenoid binding	98.04
2chc_A		170	Protein RV3472; hypothetical protein; 1.69A {Mycob	98.02
3b8l_A		163	Uncharacterized protein; putative aromatic ring hy	97.85
3a76_A		176	Gamma-hexachlorocyclohexane dehydrochlorinase; bar	97.83
2rgq_A		144	Domain of unknown function with A cystatin-like F;	97.71
2rfr_A		155	Uncharacterized protein; structural genomics, join	97.65
2rcd_A		129	Uncharacterized protein; structural genomics, join	97.64
3ejv_A		179	Uncharacterized protein with cystatin-like fold; s	97.45
3gzb_A		154	Putative snoal-like polyketide cyclase; YP_0011826	97.35
3ef8_A		150	Putative scyalone dehydratase; YP_496742.1, struct	97.32
3soy_A		145	NTF2-like superfamily protein; structural genomics	97.23
2f86_B		143	Hypothetical protein K11E8.1D; UNC-43, oligomeriza	97.2
4gb5_A		159	Uncharacterized protein; structural genomics, PSI-	97.0
3blz_A		128	NTF2-like protein of unknown function; structural	96.89
2owp_A		129	Hypothetical protein BXE_B1374; cystatin-like fold	96.75
2imj_A		166	Hypothetical protein DUF1348; alpha beta protein,	96.5
3fsd_A		134	NTF2-like protein of unknown function in nutrient;	96.33
2r4i_A		123	Uncharacterized protein; NTF2-like protein, struct	96.02
3duk_A		125	NTF2-like protein of unknown function; structural	95.92
2qiy_A		154	UBP3-associated protein BRE5; deubiquitylation, ub	95.89
3nv0_B		154	NTF2-related export protein; NTF2-like domain, bet	95.69
3fka_A		120	Uncharacterized NTF-2 like protein; structural gen	95.33
3ujm_A		120	Rasputin; NTF2-like fold, RAS signaling, signaling	95.19
1zo2_A		129	NTF2, nuclear transport factor 2; structural genom	94.92
3q90_A		140	RAS GTPase-activating protein-binding protein 1; s	94.92
3ecf_A		130	NTF2-like protein; structural genomics, joint cent	94.44
1gy6_A		127	Nuclear transport factor 2; 1.6A {Rattus norvegicu	94.41
1gy7_A		125	Nuclear transport factor 2; protein transport; 1.6	93.15
1jkg_A		140	P15; NTF2-like domain, transport protein; 1.90A {H	91.52
1jkg_B		250	TAP; NTF2-like domain, transport protein; 1.90A {H	89.79
3ksp_A		129	Calcium/calmodulin-dependent kinase II associatio;	87.73
1idp_A		172	Scytalone dehydratase; lyase, melanine biosynthesi	86.92
1of5_A		221	MRNA export factor MEX67; nuclear protein, repeat,	81.76
1q40_B		219	MEX67, mRNA export factor MEX67; NTF2-fold, nuclea	80.49

>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila}	Back alignment and structure

Probab=99.71  E-value=2.8e-17  Score=122.45  Aligned_cols=112  Identities=8%  Similarity=0.055  Sum_probs=93.7

Q ss_pred             chHHHHHHHHHHHhccCCHhHHHhhhccCcceecCceeccCCcccHHHHHHHHHHHHHHcCCceEEEEceeeecCcEEEE
Q 044071           24 RAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFVVKPTLHDGMNVGV  103 (152)
Q Consensus        24 ~~a~~~v~~fY~A~n~~dl~~L~el~a~Dc~~~~~d~~f~dPf~G~~av~~~F~~l~~~~~~~~rFvI~~~~~~g~~~~v  103 (152)
                      ..+.++|.+||+|+|++|++++.+||++||+  +.|..+..|++|+++|.+||+.+.+.. ++++|++..+..+|..+.+
T Consensus        25 mt~~eiv~~y~~A~n~~D~d~~~~l~a~D~v--~~d~~~g~~~~Greai~~~~~~~~~~~-~d~~~~v~~~~~~gd~v~~  101 (158)
T 4h3u_A           25 MTTPEIVTAWAAAWTGTNPNALGTLFAADGT--YVDHAIGATMTGREQISGWKARTDAMI-ENVHVTITKAYRAGDHVTI  101 (158)
T ss_dssp             CCCCHHHHHHHHHHHSSCHHHHHTTEEEEEE--EEETTTTEEEESHHHHHHHHHHHHHHE-EEEEEEEEEEEEETTEEEE
T ss_pred             CCHHHHHHHHHHHHHcCCHHHHHHHhcccce--EeccCCCceEecchhhhhhhhhhhccC-CccceeEeEEeecCceEEE
Confidence            3456899999999999999999999999975  666667778999999999999999988 7999999998889999999


Q ss_pred             EEEEEecc----cccCCCCceEEEEEeeeCCeEEEEeeeeeeec
Q 044071          104 SWRLEWNK----KHVPLGKGFSFHICQVYQGKVFIKNVEMFMEP  143 (152)
Q Consensus       104 ~W~lew~~----~~lp~~rGcSf~~~~~~~gki~i~~~~~~~e~  143 (152)
                      .|+++..+    +++.. +||++++++  +|||+-.  ++....
T Consensus       102 ~~~~~gt~~~tG~~~~~-~~~~v~~~~--dGkI~~~--~~y~D~  140 (158)
T 4h3u_A          102 EAVYGGHIKGAPTPFAV-PMATLLRTR--GEEITSD--QDYYSL  140 (158)
T ss_dssp             EEEEEEEETTSSSCEEE-EEEEEEEEE--TTEEEEE--EEEECH
T ss_pred             EEEEEEEecCccCccee-eeEEEEEEE--CCEEEEE--EEEECH
Confidence            99998754    33433 899999994  5996544  666543

PyMOL of 4h3u

>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0	Back alignment and structure

>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV}	Back alignment and structure

>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20	Back alignment and structure

>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10	Back alignment and structure

>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1}	Back alignment and structure

>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str}	Back alignment and structure

>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9	Back alignment and structure

>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus}	Back alignment and structure

>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0	Back alignment and structure

>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti}	Back alignment and structure

>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa}	Back alignment and structure

>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23}	Back alignment and structure

>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A*	Back alignment and structure

>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A	Back alignment and structure

>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9	Back alignment and structure

>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9	Back alignment and structure

>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9	Back alignment and structure

>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11	Back alignment and structure

>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP}	Back alignment and structure

>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ...	Back alignment and structure

>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19	Back alignment and structure

>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A	Back alignment and structure

>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A*	Back alignment and structure

>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV}	Back alignment and structure

>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29	Back alignment and structure

>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440}	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis}	Back alignment and structure

>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264}	Back alignment and structure

>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10	Back alignment and structure

>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP}	Back alignment and structure

>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8	Back alignment and structure

>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans}	Back alignment and structure

>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10	Back alignment and structure

>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10	Back alignment and structure

>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis}	Back alignment and structure

>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20	Back alignment and structure

>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti}	Back alignment and structure

>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24	Back alignment and structure

>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27	Back alignment and structure

>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A*	Back alignment and structure

>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259}	Back alignment and structure

>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV}	Back alignment and structure

>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22	Back alignment and structure

>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440}	Back alignment and structure

>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus}	Back alignment and structure

>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea}	Back alignment and structure

>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides}	Back alignment and structure

>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16	Back alignment and structure

>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A*	Back alignment and structure

>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28	Back alignment and structure

>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17	Back alignment and structure

>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16	Back alignment and structure

>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus}	Back alignment and structure

>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503}	Back alignment and structure

>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12	Back alignment and structure

>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A*	Back alignment and structure

>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25	Back alignment and structure

>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis}	Back alignment and structure

>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25	Back alignment and structure

>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28	Back alignment and structure

>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18	Back alignment and structure

>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28	Back alignment and structure

>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A*	Back alignment and structure

>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28	Back alignment and structure

>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp}	Back alignment and structure

>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7	Back alignment and structure

>4gb5_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, snoal-like domain, unknown function; HET: PGE; 1.55A {Kribbella flavida}	Back alignment and structure

>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14	Back alignment and structure

>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18	Back alignment and structure

>2imj_A Hypothetical protein DUF1348; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} SCOP: d.17.4.23	Back alignment and structure

>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0	Back alignment and structure

>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15	Back alignment and structure

>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0	Back alignment and structure

>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A	Back alignment and structure

>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans}	Back alignment and structure

>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster}	Back alignment and structure

>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2	Back alignment and structure

>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0	Back alignment and structure

>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21	Back alignment and structure

>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A	Back alignment and structure

>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A	Back alignment and structure

>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A	Back alignment and structure

>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A	Back alignment and structure

>3ksp_A Calcium/calmodulin-dependent kinase II associatio; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>1idp_A Scytalone dehydratase; lyase, melanine biosynthesis; 1.45A {Magnaporthe grisea} SCOP: d.17.4.1 PDB: 2std_A* 1std_A* 3std_A* 6std_A* 4std_A* 5std_A* 7std_A*	Back alignment and structure

>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2	Back alignment and structure

>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		152
d1nwwa_		145	Limonene-1,2-epoxide hydrolase {Rhodococcus erythr	99.62
d3dm8a1		135	Uncharacterized protein Rpa4348 {Rhodopseudomonas	99.6
d3ebta1		131	Uncharacterized protein BPSS0132 {Burkholderia pse	99.58
d1tuha_		131	Hypothetical protein egc068 from a soil-derived mo	99.56
d2a15a1		132	Hypothetical protein Rv0760c {Mycobacterium tuberc	99.55
d3dxoa1		117	Uncharacterized protein Atu0744 {Agrobacterium tum	99.55
d1s5aa_		139	Hypothetical protein YesE {Bacillus subtilis [TaxI	99.55
d3ec9a1		130	Uncharacterized protein BTHI0051 {Burkholderia tha	99.51
d3dmca1		133	Uncharacterized protein Ava2261 {Anabaena variabil	99.5
d2f99a1		140	Aklanonic acid methyl ester cyclase, AknH {Strepto	99.49
d2bnga1		132	Uncharacterized protein Mb2760 {Mycobacterium tube	99.48
d2geya1		144	Putative hydroxylase AclR {Streptomyces galilaeus	99.48
d1z1sa1		129	Uncharacterized protein PA3332 {Pseudomonas aerugi	99.47
d1oh0a_		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	99.46
d2gexa1		138	Nogalamycin biosynthesis protein SnoL {Streptomyce	99.46
d3en8a1		127	Uncharacterized protein BxeB2092 {Burkholderia xen	99.45
d1ohpa1		125	Delta-5-3-ketosteroid isomerase, steroid delta-iso	99.45
d2k54a1		123	Uncharacterized protein Atu0742 {Agrobacterium tum	99.45
d1sjwa_		142	Nogalonic acid methyl ester cyclase SnoaL {Strepto	99.44
d1m98a2		142	Orange carotenoid protein, C-terminal domain {Cyan	99.3
d3d9ra1		132	Uncharacterized protein ECA1476 {Pectobacterium at	98.74
d2gxfa1		128	Hypothetical protein YybH {Bacillus subtilis [TaxI	98.66
d3cnxa1		153	Uncharacterized protein SAV4671 {Streptomyces aver	98.38
d3cu3a1		162	Uncharacterized protein NpunR1993 {Nostoc punctifo	98.31
d2rgqa1		133	Uncharacterized protein NpunR3134 {Nostoc punctifo	98.29
d3b7ca1		121	Uncharacterized protein SO0125 {Shewanella oneiden	98.14
d2ux0a1		135	Association domain of calcium/calmodulin-dependent	98.08
d2rcda1		127	Uncharacterized protein ECA3500 {Pectobacterium at	98.06
d3bb9a1		121	Uncharacterized protein Sfri1973 {Shewanella frigi	98.03
d2owpa1		128	Hypothetical protein BxeB1374 {Burkholderia xenovo	98.0
d3b8la1		144	Uncharacterized protein Saro3538 {Novosphingobium	97.73
d3ejva1		159	Uncharacterized protein Saro2766 {Novosphingobium	97.72
d3ef8a1		149	Uncharacterized protein Saro1465 {Novosphingobium	97.38
d2chca1		167	Uncharacterized protein Rv3472 {Mycobacterium tube	97.24
d2rfra1		153	Uncharacterized protein Saro3722 {Novosphingobium	96.94
d2r4ia1		122	Uncharacterized protein CHU142 {Cytophaga hutchins	96.91
d3blza1		124	Uncharacterized protein Sbal0622 {Shewanella balti	96.89
d2f86b1		129	Association domain of calcium/calmodulin-dependent	96.8
d2qiya1		139	UBP3-associated protein BRE5 {Baker's yeast (Sacch	96.65
d1gy6a_		125	Nuclear transport factor-2 (NTF2) {Rat (Rattus nor	96.28
d1zo2a1		117	Nuclear transport factor-2 (NTF2) {Cryptosporidium	96.11
d2imja1		155	Hypothetical protein PFL3262 {Pseudomonas fluoresc	95.72
d1gy7a_		121	Nuclear transport factor-2 (NTF2) {Baker's yeast (	95.45
d1idpa_		147	Scytalone dehydratase {Fungus (Magnaporthe grisea)	95.11
d3er7a1		118	Uncharacterized protein Exig0174 {Exiguobacterium	91.7
d1jkga_		139	NTF2-related export protein 1 (p15) {Human (Homo s	90.55
d1tp6a_		126	Hypothetical protein PA1314 {Pseudomonas aeruginos	89.9
d3ebya1		157	Putative hydroxylase subunit Saro3860 {Novosphingo	89.74
d1jkgb_		186	NTF2-like domain of Tip associating protein, TAP {	85.32

>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: Limonene-1,2-epoxide hydrolase-like
domain: Limonene-1,2-epoxide hydrolase
species: Rhodococcus erythropolis [TaxId: 1833]

Probab=99.62  E-value=4e-15  Score=107.88  Aligned_cols=119  Identities=15%  Similarity=0.101  Sum_probs=93.7

Q ss_pred             CCCCCCCCCCCCcchHHHHHHHHHHHhccCCHhHHHhhhccCcceecCceeccCCcccHHHHHHHHHHHHHHcCCceEEE
Q 044071           11 AKNSSSGSGEDDHRAALETVLKLYSAIKSQSLRELSDIIGDECRCVCNFFSFLQPLQGKKQVLDFFTYLIRSLGNNIEFV   90 (152)
Q Consensus        11 ~~~~~~~~~~~~~~~a~~~v~~fY~A~n~~dl~~L~el~a~Dc~~~~~d~~f~dPf~G~~av~~~F~~l~~~~~~~~rFv   90 (152)
                      ++.++.+...+   ++.++|++||+|++++|++++.+++++||+++  + .-..|+.|++++.++|+.++... ...+++
T Consensus         8 ~~~~~~~~~~~---~~~~lv~~~~~A~~~~D~~~~~~~~~~D~~~~--~-~~~~~~~G~e~~~~~~~~~~~~~-~~~~~~   80 (145)
T d1nwwa_           8 SKDSAAGAAST---PDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQ--N-MPLPPAYGRDAVEQTLAGLFTVM-SIDAVE   80 (145)
T ss_dssp             CCCTTTTCCCS---HHHHHHHHHHHHGGGCCHHHHHTTBCSSCEEE--E-TTSCCEESHHHHHHHHHHHHHHE-EEEEEE
T ss_pred             CCCCcccCCCC---cHHHHHHHHHHHHHcCCHHHHHHHHhccceEe--c-CCcccccCHHHHHHHHHhhhhhc-ccccce
Confidence            44445444444   77899999999999999999999999998743  3 33467899999999999999999 689999


Q ss_pred             EceeeecCcEEEEEEEEEec----ccccCCCCceEEEEEeeeCCeEEEEeeeeee
Q 044071           91 VKPTLHDGMNVGVSWRLEWN----KKHVPLGKGFSFHICQVYQGKVFIKNVEMFM  141 (152)
Q Consensus        91 I~~~~~~g~~~~v~W~lew~----~~~lp~~rGcSf~~~~~~~gki~i~~~~~~~  141 (152)
                      +.....+|..+.+.|+....    |+.+.. ++|++|++  .+|||+  ..++..
T Consensus        81 i~~~~~~~~~v~~~~~~~~~~~~~G~~~~~-~~~~~~~~--~DGKI~--~~~~Y~  130 (145)
T d1nwwa_          81 TFHIGSSNGLVYTERVDVLRALPTGKSYNL-SILGVFQL--TEGKIT--GWRDYF  130 (145)
T ss_dssp             EEEEEEETTEEEEEEEEEEEETTTCCEEEE-EEEEEEEE--ETTEEE--EEEEEC
T ss_pred             EEEEEecCceEEEEEeeecccccCCceeEE-EEEEEEEE--cCCEEE--EEEEEe
Confidence            99988888999998886653    333333 89999999  459965  346554

PyMOL of d1nwwa_

>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]}	Back information, alignment and structure

>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]}	Back information, alignment and structure

>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]}	Back information, alignment and structure

>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]}	Back information, alignment and structure

>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}	Back information, alignment and structure

>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]}	Back information, alignment and structure

>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]}	Back information, alignment and structure

>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]}	Back information, alignment and structure

>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]}	Back information, alignment and structure

>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]}	Back information, alignment and structure

>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]}	Back information, alignment and structure

>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]}	Back information, alignment and structure

>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]}	Back information, alignment and structure

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]}	Back information, alignment and structure

>d2imja1 d.17.4.23 (A:5-159) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1idpa_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]}	Back information, alignment and structure

>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]}	Back information, alignment and structure

>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure