Citrus Sinensis ID: 044237

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MILQADFPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDSKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQDLW
ccccccccccccccccEEEEEccccccccccHHHcccccccEEEEEEcccccEEccccccccccccccccccEEEEcccccccEEcccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEccccccEEcccccccccccEEcccccEEEEccccccccccccccccccccccccc
ccccccccHHHHHccEEEEEcccccccccHHHHHHHcccccEEEEEEcccEEEEEccccccHHccccHHHHHEEEHccHHHHHHHHcccccccHHHHHHEEEEEcccHHHHHccccccEEccccEEEEEcccHHHHHHccHHHHHHHHHHHEEEEccHHcHHEEEEcccccccccEEEcccccEEEEcccccccHccccccEEEcccHHHHc
milqadfpqhlfgslkqlniggddsacfpiWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLckqdsklgpiFQYLEIlkvydcqsllillpsssvsfrNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVindkegveKEEIVFRKLKMLelrdldsltsfcsanytfkfpslqdlw
MILQADFPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDSKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHlvtsstakTLVQLVTVRMRECRAMtevvindkegvekeEIVFRKLKMLELRDLDSLtsfcsanytfkfpslqdlw
MILQADFPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKelqlhqhyhleqlCKQDSKLGPIFQYLEILKVYDCQsllillpsssvsFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQDLW
******FPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDSKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFP******
MILQADFPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDSKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVIN*KEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQDLW
MILQADFPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDSKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQDLW
*I*QADFPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDSKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQDLW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILQADFPQHLFGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDSKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQDLW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
302143659 922 unnamed protein product [Vitis vinifera] 0.834 0.191 0.416 4e-25
359488108 1436 PREDICTED: disease resistance protein At 0.834 0.123 0.416 4e-25
359488025 1781 PREDICTED: uncharacterized protein LOC10 0.976 0.116 0.394 2e-24
296087869 1711 unnamed protein product [Vitis vinifera] 0.976 0.120 0.394 2e-24
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.966 0.152 0.400 4e-24
359488101 1677 PREDICTED: disease resistance protein At 0.952 0.120 0.363 1e-23
358344275 571 Resistance protein RGC2 [Medicago trunca 0.952 0.353 0.342 2e-23
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.976 0.084 0.369 2e-23
358344919 1995 NBS/LRR resistance protein-like protein 0.641 0.068 0.496 8e-23
147772601 1392 hypothetical protein VITISV_013427 [Viti 0.976 0.148 0.384 1e-22
>gi|302143659|emb|CBI22412.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 113/180 (62%), Gaps = 3/180 (1%)

Query: 33  VLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGK-LAMIKELQLHQHYHLEQLCKQDSK 91
           +L+R H+LE+L +   S  +EVF +EG  E++  K L  ++E++LH    L +L K++S+
Sbjct: 693 MLQRLHNLEVLKVGSCSSVKEVFQLEGLDEENQAKRLGRLREIELHDLPGLTRLWKENSE 752

Query: 92  LGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLV 151
            G   Q LE L+V++C SL+ L+PSS VSF+NL  +    C  L  L++ S AK+LV+L 
Sbjct: 753 PGLDLQSLESLEVWNCGSLINLVPSS-VSFQNLATLDVQSCGSLRSLISPSVAKSLVKLK 811

Query: 152 TVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQDL 211
           T+++     M EVV N+  G   +EI F KL+ +EL  L +LTSF S  Y F FPSL+ +
Sbjct: 812 TLKIGRSDMMEEVVANEG-GEATDEITFYKLQHMELLYLPNLTSFSSGGYIFSFPSLEQM 870

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087869|emb|CBI35152.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|358344275|ref|XP_003636216.1| Resistance protein RGC2 [Medicago truncatula] gi|355502151|gb|AES83354.1| Resistance protein RGC2 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358344919|ref|XP_003636533.1| NBS/LRR resistance protein-like protein [Medicago truncatula] gi|355502468|gb|AES83671.1| NBS/LRR resistance protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|147772601|emb|CAN62857.1| hypothetical protein VITISV_013427 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 212
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.47
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.44
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.01
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.92
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.23
PRK15386 426 type III secretion protein GogB; Provisional 98.21
KOG0617264 consensus Ras suppressor protein (contains leucine 98.18
KOG4341 483 consensus F-box protein containing LRR [General fu 98.16
PRK15386 426 type III secretion protein GogB; Provisional 98.14
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.13
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.12
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.04
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.93
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.64
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.27
KOG1947 482 consensus Leucine rich repeat proteins, some prote 97.25
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.25
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.07
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.97
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 96.9
KOG0617264 consensus Ras suppressor protein (contains leucine 96.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.88
KOG4341483 consensus F-box protein containing LRR [General fu 96.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.33
KOG1947 482 consensus Leucine rich repeat proteins, some prote 96.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.65
PLN03150623 hypothetical protein; Provisional 95.24
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.14
PLN03150623 hypothetical protein; Provisional 95.01
KOG0472565 consensus Leucine-rich repeat protein [Function un 94.69
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 94.61
KOG0472565 consensus Leucine-rich repeat protein [Function un 94.51
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.38
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 94.29
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 92.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.74
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 90.7
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.53
KOG2982 418 consensus Uncharacterized conserved protein [Funct 90.52
KOG1259490 consensus Nischarin, modulator of integrin alpha5 90.38
KOG2123 388 consensus Uncharacterized conserved protein [Funct 89.66
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.96
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 83.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 82.34
KOG4237498 consensus Extracellular matrix protein slit, conta 82.09
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.47  E-value=4e-13  Score=127.57  Aligned_cols=99  Identities=23%  Similarity=0.274  Sum_probs=63.0

Q ss_pred             CcccEEEEecCccccccCCCCcccCCCCCeEEEcCCCCCceecchhhHhcCCCCcEEeeeccccccccccccc-------
Q 044237           97 QYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVRMRECRAMTEVVINDK-------  169 (212)
Q Consensus        97 ~~L~~L~i~~C~~L~~l~~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~~l~~L~~L~i~~c~~l~~i~~~~~-------  169 (212)
                      ++|+.|++++|+.+..+ |.....+++|+.|++++|.+++.++..   .++++|+.|++++|..+..++....       
T Consensus       778 ~sL~~L~Ls~n~~l~~l-P~si~~L~~L~~L~Ls~C~~L~~LP~~---~~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~L  853 (1153)
T PLN03210        778 PSLTRLFLSDIPSLVEL-PSSIQNLHKLEHLEIENCINLETLPTG---INLESLESLDLSGCSRLRTFPDISTNISDLNL  853 (1153)
T ss_pred             ccchheeCCCCCCcccc-ChhhhCCCCCCEEECCCCCCcCeeCCC---CCccccCEEECCCCCccccccccccccCEeEC
Confidence            35666666666665554 333667788888888888888776432   2677888888888877765432110       


Q ss_pred             --cccc---cccccCCccceeecCCCCCCceecCC
Q 044237          170 --EGVE---KEEIVFRKLKMLELRDLDSLTSFCSA  199 (212)
Q Consensus       170 --~~~~---~~~~~~p~L~~L~l~~cp~L~~~~~~  199 (212)
                        .+..   .....+++|+.|.+.+|++|++++..
T Consensus       854 s~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~  888 (1153)
T PLN03210        854 SRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLN  888 (1153)
T ss_pred             CCCCCccChHHHhcCCCCCEEECCCCCCcCccCcc
Confidence              0000   11235778888888888888877653

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.5 bits (104), Expect = 1e-05
 Identities = 26/158 (16%), Positives = 49/158 (31%), Gaps = 26/158 (16%)

Query: 44  ILCYFSFHEEVF--SMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQDS----KLGPIFQ 97
           + C   F  ++F  ++          L M+++L      +        S    ++  I  
Sbjct: 176 VQCKMDF--KIFWLNL-KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQA 232

Query: 98  YLEIL---KVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSSTAKTLVQLVTVR 154
            L  L   K Y    LL+L    +V            CK  I L+T+   +    L    
Sbjct: 233 ELRRLLKSKPY-ENCLLVL---LNVQNAKAWNAFNLSCK--I-LLTTRFKQVTDFLSAAT 285

Query: 155 MRECRAMTEVVINDKEGVEKEEI--VFRKLKMLELRDL 190
                     + +    +  +E+  +  K      +DL
Sbjct: 286 TTH-----ISLDHHSMTLTPDEVKSLLLKYLDCRPQDL 318

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.58
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.57
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.42
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.4
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.36
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.34
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.33
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.32
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.3
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.28
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.27
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.26
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.22
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.22
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.21
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.2
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.2
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.16
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.1
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.1
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.04
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.03
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.01
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.99
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.99
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.99
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.99
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.97
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.97
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.97
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.97
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.96
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.95
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.94
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.94
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.93
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.92
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.92
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.9
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.88
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.85
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.85
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.77
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.75
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.74
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.74
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.72
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.69
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.69
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.63
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.56
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.56
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.54
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.47
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.38
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.33
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.27
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.24
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.1
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.1
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.08
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.02
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.98
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.95
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.88
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.88
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.85
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.77
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.62
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.47
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.35
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.13
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.06
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.99
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 92.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 89.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 85.54
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 84.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 83.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 82.68
4gt6_A394 Cell surface protein; leucine rich repeats, putati 82.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 81.86
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.58  E-value=2.4e-14  Score=117.41  Aligned_cols=175  Identities=19%  Similarity=0.224  Sum_probs=91.6

Q ss_pred             cCCccEEEEcCCCCceechHHHHhhcCCCcEEEEeecCCcceeccccccccccccccccccEEecCcccccccccccC--
Q 044237           12 FGSLKQLNIGGDDSACFPIWNVLERFHSLEILILCYFSFHEEVFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQD--   89 (212)
Q Consensus        12 l~~Lk~L~l~~~~~~~~p~~~~~~~l~~L~~L~i~~C~~l~~i~~~~~~~~~~~~~l~~L~~L~l~~~~~L~~l~~~~--   89 (212)
                      +++|++|+++++.+..+|..  ++.+++|++|++++| .++.++...       ..+++|++|++++|..+..++...  
T Consensus       103 l~~L~~L~L~~n~l~~lp~~--~~~l~~L~~L~Ls~n-~l~~lp~~l-------~~l~~L~~L~L~~n~~~~~~p~~~~~  172 (328)
T 4fcg_A          103 LSHLQHMTIDAAGLMELPDT--MQQFAGLETLTLARN-PLRALPASI-------ASLNRLRELSIRACPELTELPEPLAS  172 (328)
T ss_dssp             GTTCSEEEEESSCCCCCCSC--GGGGTTCSEEEEESC-CCCCCCGGG-------GGCTTCCEEEEEEETTCCCCCSCSEE
T ss_pred             CCCCCEEECCCCCccchhHH--HhccCCCCEEECCCC-ccccCcHHH-------hcCcCCCEEECCCCCCccccChhHhh
Confidence            66677777764444455543  346666666666664 444333211       134455555555443333322110  


Q ss_pred             --------------------------CccCCCcCcccEEEEecCccccccCCCCcccCCCCCeEEEcCCCCCceecchhh
Q 044237           90 --------------------------SKLGPIFQYLEILKVYDCQSLLILLPSSSVSFRNLTEIVAFGCKELIHLVTSST  143 (212)
Q Consensus        90 --------------------------~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~l~~L~~L~i~~C~~L~~l~~~~~  143 (212)
                                                +.....+++|++|++++|. +..+++ ....+++|++|++++|.....++.  .
T Consensus       173 ~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~-l~~l~~-~l~~l~~L~~L~Ls~n~~~~~~p~--~  248 (328)
T 4fcg_A          173 TDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGP-AIHHLPKLEELDLRGCTALRNYPP--I  248 (328)
T ss_dssp             EC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSC-CCCCCG-GGGGCTTCCEEECTTCTTCCBCCC--C
T ss_pred             ccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCC-CCcCch-hhccCCCCCEEECcCCcchhhhHH--H
Confidence                                      1112345556666665543 223222 245566666666666655444321  3


Q ss_pred             HhcCCCCcEEeeeccccccccccccccccccccccCCccceeecCCCCCCceecCCCccccCCCCcc
Q 044237          144 AKTLVQLVTVRMRECRAMTEVVINDKEGVEKEEIVFRKLKMLELRDLDSLTSFCSANYTFKFPSLQD  210 (212)
Q Consensus       144 ~~~l~~L~~L~i~~c~~l~~i~~~~~~~~~~~~~~~p~L~~L~l~~cp~L~~~~~~~~~~~~p~L~~  210 (212)
                      ...+++|++|++.+|.....+...        ...+++|++|++.+|+.+..++.+-  ..+++|+.
T Consensus       249 ~~~l~~L~~L~L~~n~~~~~~p~~--------~~~l~~L~~L~L~~n~~~~~iP~~l--~~L~~L~~  305 (328)
T 4fcg_A          249 FGGRAPLKRLILKDCSNLLTLPLD--------IHRLTQLEKLDLRGCVNLSRLPSLI--AQLPANCI  305 (328)
T ss_dssp             TTCCCCCCEEECTTCTTCCBCCTT--------GGGCTTCCEEECTTCTTCCCCCGGG--GGSCTTCE
T ss_pred             hcCCCCCCEEECCCCCchhhcchh--------hhcCCCCCEEeCCCCCchhhccHHH--hhccCceE
Confidence            445666666666666655444321        2357888888888888888777642  23455443
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.34
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.2
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.17
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.11
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.05
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.02
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.02
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.01
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.99
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.93
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.74
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.62
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.38
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.29
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.11
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.1
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.58
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.45
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.42
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.81
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.59
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 93.94
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 92.35
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 87.66
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.38  E-value=5.1e-14  Score=111.37  Aligned_cols=140  Identities=13%  Similarity=0.096  Sum_probs=69.3

Q ss_pred             ccCCccEEEEcCCCCc-eechHHHHhhcCCCcEEEEeecCCcce-eccccccccccccccccccEEecCccccccccccc
Q 044237           11 LFGSLKQLNIGGDDSA-CFPIWNVLERFHSLEILILCYFSFHEE-VFSMEGCLEKHVGKLAMIKELQLHQHYHLEQLCKQ   88 (212)
Q Consensus        11 ~l~~Lk~L~l~~~~~~-~~p~~~~~~~l~~L~~L~i~~C~~l~~-i~~~~~~~~~~~~~l~~L~~L~l~~~~~L~~l~~~   88 (212)
                      ...+|++|++++..+. ..... +...+++|++|.+++|. +.. .+.       ....+++|++|++++|.+++.....
T Consensus        44 ~~~~L~~LdLs~~~i~~~~l~~-l~~~c~~L~~L~L~~~~-l~~~~~~-------~l~~~~~L~~L~Ls~c~~itd~~l~  114 (284)
T d2astb2          44 SPFRVQHMDLSNSVIEVSTLHG-ILSQCSKLQNLSLEGLR-LSDPIVN-------TLAKNSNLVRLNLSGCSGFSEFALQ  114 (284)
T ss_dssp             CCBCCCEEECTTCEECHHHHHH-HHTTBCCCSEEECTTCB-CCHHHHH-------HHTTCTTCSEEECTTCBSCCHHHHH
T ss_pred             cCCCCCEEECCCCccCHHHHHH-HHHhCCCcccccccccC-CCcHHHH-------HHhcCCCCcCccccccccccccccc
Confidence            3567888888732222 21122 45678888888888873 321 111       1124567777777777666532110


Q ss_pred             CCccCCCcCcccEEEEecCccccccC-CCCc-ccCCCCCeEEEcCCC-CCceecchhhHhcCCCCcEEeeeccccc
Q 044237           89 DSKLGPIFQYLEILKVYDCQSLLILL-PSSS-VSFRNLTEIVAFGCK-ELIHLVTSSTAKTLVQLVTVRMRECRAM  161 (212)
Q Consensus        89 ~~~~~~~l~~L~~L~i~~C~~L~~l~-~~~~-~~l~~L~~L~i~~C~-~L~~l~~~~~~~~l~~L~~L~i~~c~~l  161 (212)
                        .....+++|++|++++|.++.+-. .... ...++|+.|++++|. .+........+.++++|++|++.+|..+
T Consensus       115 --~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~i  188 (284)
T d2astb2         115 --TLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVML  188 (284)
T ss_dssp             --HHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTC
T ss_pred             --hhhHHHHhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCC
Confidence              011235667777777776554310 0001 112455555555553 2322111123344555555555555544
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure