Citrus Sinensis ID: 044490

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYLGSARPDHQPPLLLTFNGEMVDAEEHETISSNVGDLKSSATLENEGFSEADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLSLDGKVGEHTAFTRKLHVVVNTRTKLTPAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNELPDDITYAHIKACLVMENCGISPEVIPPSQKKGNTDELPSKASETWHAEEPHEVEECGKSMVTFGCAYNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCPDGGFTVLEATASSVLNLLQKHDEG
ccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccEEEEccccHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEccccccccccHHHHHHHHHHccccHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHcHHHHHHHHHHcccc
ccHHHHcccccccEEcccccccHHHHHHHHHHHHHcccEEEEccccccEEEEcHHHHHHHcccccccccccEEcccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHccccHccHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccHHHccccEEccccccccHHcccHHHHHHHHHccccc
SKKVVDAQFDKLLLhglgkdhssnWWKTLAYQLISYGYLTETIKDVYRTVSVSQQgkqylgsarpdhqppllltfngemvdaeehetissnvgdlkssatlenegfsEADMQLYHMLLEERKKLARvtgtapyalcgdqTIKKIAlarpstkarLANIDGVNQHLVITHGDHLLQTIRHLSQKLNlsldgkvgehtAFTRKLHVVVNtrtkltpaKYEAWKMWHEDGLSIQKianypgrsapikeQTVVDYLLEAVSEgfdinwtrlcdevglTDEIFSAIQEAISKvgckdklkpiknelpddityAHIKACLVMencgispevippsqkkgntdelpskasetwhaeepheveecGKSMVTFGcaynnkemtslpvtkAEVQELSvgcgddelcshkrqrvdcpdggfTVLEATASSVLNLLQKHDEG
SKKVVDAQFDKLLlhglgkdhssnwWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYlgsarpdhqpPLLLTFNGEMVDAEEHEtissnvgdlksSATLENEGFSEADMQLYHMLLEERKKLARVTGTapyalcgdqtiKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLSLDGKVGEHtaftrklhvvvntrtkltpAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAIskvgckdklkpIKNELPDDITYAHIKACLVMENCGISPevippsqkkgntDELPSKASETWHAEEPHEVEECGKSMVTFGCAYNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCPDGGFTVLEATASSVLNLLQKHDEG
SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYLGSARPDHQPPLLLTFNGEMVDAEEHETISSNVGDLKSSATLENEGFSEADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLSLDGKVGEHTAFTRKLHVVVNTRTKLTPAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNELPDDITYAHIKACLVMENCGISPEVIPPSQKKGNTDELPSKASETWHAEEPHEVEECGKSMVTFGCAYNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCPDGGFTVLEATASSVLNLLQKHDEG
******AQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVS******************LLTF***********************************MQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLSLDGKVGEHTAFTRKLHVVVNTRTKLTPAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNELPDDITYAHIKACLVMENCGIS**********************************CGKSMVTFGCAYNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCPDGGFTVLEATASSVLN********
SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYLGSARPDHQPPLLL*************************************MQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKL**********************************AWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNELPDDITYAHIKACLVMENCG***********************************************************************************************TASSVLNLLQK****
SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYLGSARPDHQPPLLLTFNGEMVDAEEHETISSNVGDLKSSATLENEGFSEADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLSLDGKVGEHTAFTRKLHVVVNTRTKLTPAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNELPDDITYAHIKACLVMENCGISPEVIPP***************************ECGKSMVTFGCAYNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCPDGGFTVLEATASSVLNLLQKHDEG
SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYLGSARPDHQPPLLLTFNGEMVDAEEH********************FSEADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLN***************************TPAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNELPDDITYAHIKACLVMENCGI**************************************SMVT**C*YNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCP*GGFTVLEATASSVLNLLQK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYLGSARPDHQPPLLLTFNGEMVDAEEHETISSNVGDLKSSATLENEGFSEADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLSLDGKVGEHTAFTRKLHVVVNTRTKLTPAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNELPDDITYAHIKACLVMENCGISPEVIPPSQKKGNTDELPSKASETWHAEEPHEVEECGKSMVTFGCAYNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCPDGGFTVLEATASSVLNLLQKHDEG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query430 2.2.26 [Sep-21-2011]
O090531401 Werner syndrome ATP-depen yes no 0.709 0.217 0.232 9e-14
O935301436 Werner syndrome ATP-depen N/A no 0.760 0.227 0.249 9e-10
Q141911432 Werner syndrome ATP-depen yes no 0.637 0.191 0.228 2e-08
Q9CL21632 ATP-dependent DNA helicas yes no 0.330 0.224 0.260 1e-07
P71359619 ATP-dependent DNA helicas yes no 0.332 0.231 0.248 1e-07
P15043609 ATP-dependent DNA helicas N/A no 0.365 0.257 0.241 1e-05
P40724609 ATP-dependent DNA helicas yes no 0.365 0.257 0.207 0.0007
>sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 Back     alignment and function desciption
 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 87/374 (23%), Positives = 149/374 (39%), Gaps = 69/374 (18%)

Query: 14   LHGLGKDHSSNWWKTLAYQLISYGYLTETIKD--VYRTVSVSQQGKQYLGSARPDHQPPL 71
            L G GK+ + +WWKTL++ LI+ G+L E  K+    +T S++++G+++LG A     P L
Sbjct: 968  LFGAGKEQAESWWKTLSHHLIAEGFLVEVPKENKYIKTCSLTKKGRKWLGEASSQSPPSL 1027

Query: 72   LLTFNGEMV--------------DAEEH-------------------------ETISSNV 92
            LL  N EM               +  +H                         E +SS  
Sbjct: 1028 LLQANEEMFPRKVLLPSSNPVSPETTQHSSNQNPAGLTTKQSNLERTHSYKVPEKVSSGT 1087

Query: 93   GDLKSSATLENEGFSEADMQ-------------LYHMLLEERKKLARVTGTAPYALCGDQ 139
               K SA + + G S + ++             LY  L+E R+K A      P  L  ++
Sbjct: 1088 NIPKKSAVMPSPGTSSSPLEPAISAQELDARTGLYARLVEARQKHANKMDVPPAILATNK 1147

Query: 140  TIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLSLD--GKVGEHTA 197
             +  +A  RP+T   +  IDGV++         LL+ I+H  Q  ++  D       H  
Sbjct: 1148 VLLDMAKMRPTTVENMKQIDGVSEGKAALLAP-LLEVIKHFCQVTSVQTDLLSSAKPHKE 1206

Query: 198  FTRKLHVVVNTRTKLTPAKYEAWKMWHEDGLSIQKIANYPGRSAPIKEQTVVDYLLEAVS 257
               K   +      L  +    + ++ E  + +  IA    R  P+    +  +L +AV 
Sbjct: 1207 -QEKSQEMEKKDCSLPQSVAVTYTLFQEKKMPLHSIAE--NRLLPLTAAGM--HLAQAVK 1261

Query: 258  EGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKD---KLKPIKNELPDDITYAHIKACL 314
             G+ ++  R     GLT E +  I + I          K+K I+  +P+++    I   +
Sbjct: 1262 AGYPLDMER----AGLTPETWKIIMDVIRNPPINSDMYKVKLIRMLVPENLDTYLIHMAI 1317

Query: 315  VMENCGISPEVIPP 328
             +   G      PP
Sbjct: 1318 EILQSGSDSRTQPP 1331
Multifunctional enzyme that has both magnesium and ATP-dependent DNA-helicase activity and 3'->5' exonuclease activity towards double-stranded DNA with a 5'-overhang. Has no nuclease activity towards single-stranded DNA or blunt-ended double-stranded DNA. Binds preferentially to DNA substrates containing alternate secondary structures, such as replication forks and Holliday junctions. May play an important role in the dissociation of joint DNA molecules that can arise as products of homologous recombination, at stalled replication forks or during DNA repair. Alleviates stalling of DNA polymerases at the site of DNA lesions. Important for genomic integrity. Plays a role in the formation of DNA replication focal centers; stably associates with foci elements generating binding sites for RP-A.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 Back     alignment and function description
>sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 Back     alignment and function description
>sp|Q9CL21|RECQ_PASMU ATP-dependent DNA helicase RecQ OS=Pasteurella multocida (strain Pm70) GN=recQ PE=3 SV=1 Back     alignment and function description
>sp|P71359|RECQ_HAEIN ATP-dependent DNA helicase RecQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=recQ PE=3 SV=1 Back     alignment and function description
>sp|P15043|RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) GN=recQ PE=1 SV=5 Back     alignment and function description
>sp|P40724|RECQ_SALTY ATP-dependent DNA helicase RecQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=recQ PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
359478480 913 PREDICTED: Werner syndrome ATP-dependent 0.995 0.468 0.599 1e-145
224124876 854 predicted protein [Populus trichocarpa] 0.941 0.474 0.582 1e-135
255570869 795 conserved hypothetical protein [Ricinus 0.946 0.511 0.548 1e-125
356537724 920 PREDICTED: LOW QUALITY PROTEIN: Werner s 0.986 0.460 0.551 1e-125
297745728 969 unnamed protein product [Vitis vinifera] 0.893 0.396 0.569 1e-122
356569961 920 PREDICTED: Werner syndrome ATP-dependent 0.986 0.460 0.549 1e-121
449462782 906 PREDICTED: ATP-dependent DNA helicase Re 0.751 0.356 0.571 1e-111
449517403 919 PREDICTED: Werner syndrome ATP-dependent 0.751 0.351 0.545 1e-107
449462784 822 PREDICTED: ATP-dependent DNA helicase Re 0.723 0.378 0.529 9e-98
414888136 898 TPA: hypothetical protein ZEAMMB73_01882 0.809 0.387 0.455 1e-80
>gi|359478480|ref|XP_002275696.2| PREDICTED: Werner syndrome ATP-dependent helicase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 263/439 (59%), Positives = 322/439 (73%), Gaps = 11/439 (2%)

Query: 1   SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYL 60
           SK+++DA+FDKL LHGLGKDHSSNWWK LAYQLISYGYL E++KDVY+TVSVSQ+G Q+L
Sbjct: 436 SKRILDAKFDKLPLHGLGKDHSSNWWKALAYQLISYGYLMESVKDVYKTVSVSQKGAQFL 495

Query: 61  GSARPDHQPPLLLTFNGEMVDAEEHETISSNVGDLKSSATLENEGFSEADMQLYHMLLEE 120
            S+ P HQP L+L    EMVD EEHE  S   G+LK  AT E EGFSE + QLYHMLL+E
Sbjct: 496 SSSTPAHQPKLVLQVTNEMVDDEEHEGTSGKFGELKGLATFEYEGFSETEGQLYHMLLDE 555

Query: 121 RKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHL 180
           R K AR  GTAPYA+CG++TIKKIAL RPSTKARLANIDGVNQH + T+GDH LQ+I+HL
Sbjct: 556 RMKFARGIGTAPYAICGNETIKKIALIRPSTKARLANIDGVNQHFLTTYGDHFLQSIQHL 615

Query: 181 SQKLNLSLDGKVGEHTAFTRKLHVVVNTRTKLTPAKYEAWKMWHEDGLSIQKIANYPGRS 240
           SQ LNL LDG      A  RK+  V N + KLTPAKYEAWKMW EDGLSI+K+AN+P RS
Sbjct: 616 SQALNLPLDGDASMQAAVVRKMQPVPNQQRKLTPAKYEAWKMWQEDGLSIEKVANFPSRS 675

Query: 241 APIKEQTVVDYLLEAVSEGFDINWTRLCDEVGLTDEIFSAIQEAISKVGCKDKLKPIKNE 300
           APIK+QTV++YLL A  EGF I+WTRLCDEVGLT E+FS I+ AI+KVG +DKLKP+K E
Sbjct: 676 APIKDQTVLEYLLGAAQEGFAIDWTRLCDEVGLTREMFSDIEAAITKVGSRDKLKPVKIE 735

Query: 301 LPDDITYAHIKACLVMENCGISPEVIPPSQKKGNT-DELPSKASE----TWH---AEEPH 352
            P+ I+YAHIK CL +++CG+S EVIPP      T DELPSKASE    T H      P 
Sbjct: 736 SPEYISYAHIKVCLTLQDCGMSKEVIPPGNHNTLTADELPSKASEASMDTMHKCLIRGPC 795

Query: 353 EVEECGKSMVTFGCAYNNKEMTSLPVTKAEVQELSVGCGDDELCSHKRQRVDCPDGGFTV 412
           EVE    +++   C   N+  TS+P T  ++     G  D+     KRQ++D P+    +
Sbjct: 796 EVETSVDNIIA-SCCLENEVTTSIPFT-VDLDMHPPGVHDEIFSLRKRQKIDEPEEESLI 853

Query: 413 L-EATASSVLNLLQKHDEG 430
           + EAT SS+L+LL+ +D+G
Sbjct: 854 MQEATESSILDLLRNYDDG 872

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224124876|ref|XP_002319444.1| predicted protein [Populus trichocarpa] gi|222857820|gb|EEE95367.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255570869|ref|XP_002526386.1| conserved hypothetical protein [Ricinus communis] gi|223534248|gb|EEF35962.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356537724|ref|XP_003537375.1| PREDICTED: LOW QUALITY PROTEIN: Werner syndrome ATP-dependent helicase homolog [Glycine max] Back     alignment and taxonomy information
>gi|297745728|emb|CBI15784.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356569961|ref|XP_003553162.1| PREDICTED: Werner syndrome ATP-dependent helicase homolog [Glycine max] Back     alignment and taxonomy information
>gi|449462782|ref|XP_004149119.1| PREDICTED: ATP-dependent DNA helicase RecQ-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449517403|ref|XP_004165735.1| PREDICTED: Werner syndrome ATP-dependent helicase homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449462784|ref|XP_004149120.1| PREDICTED: ATP-dependent DNA helicase RecQ-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|414888136|tpg|DAA64150.1| TPA: hypothetical protein ZEAMMB73_018829 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
MGI|MGI:1096351401 Wrn "Werner syndrome homolog ( 0.153 0.047 0.426 1.4e-13
UNIPROTKB|F1NAR01367 F1NAR0 "Uncharacterized protei 0.465 0.146 0.260 2.6e-12
UNIPROTKB|F1RX701409 WRN "Uncharacterized protein" 0.525 0.160 0.246 4.7e-11
UNIPROTKB|I3LC911507 WRN "Uncharacterized protein" 0.525 0.149 0.246 5.5e-11
TIGR_CMR|BA_2818705 BA_2818 "ATP-dependent DNA hel 0.413 0.252 0.244 9.5e-11
UNIPROTKB|O935301436 wrn "Werner syndrome ATP-depen 0.546 0.163 0.267 1.7e-10
ZFIN|ZDB-GENE-070702-21436 wrn "Werner syndrome" [Danio r 0.425 0.127 0.24 9.8e-10
RGD|15647881448 Wrn "Werner syndrome, RecQ hel 0.151 0.044 0.358 1.7e-09
UNIPROTKB|Q141911432 WRN "Werner syndrome ATP-depen 0.444 0.133 0.243 1.7e-09
UNIPROTKB|E1BEE61404 WRN "Uncharacterized protein" 0.502 0.153 0.243 1.9e-09
MGI|MGI:109635 Wrn "Werner syndrome homolog (human)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 1.4e-13, Sum P(2) = 1.4e-13
 Identities = 29/68 (42%), Positives = 45/68 (66%)

Query:    14 LHGLGKDHSSNWWKTLAYQLISYGYLTETIKD-VY-RTVSVSQQGKQYLGSARPDHQPPL 71
             L G GK+ + +WWKTL++ LI+ G+L E  K+  Y +T S++++G+++LG A     P L
Sbjct:   968 LFGAGKEQAESWWKTLSHHLIAEGFLVEVPKENKYIKTCSLTKKGRKWLGEASSQSPPSL 1027

Query:    72 LLTFNGEM 79
             LL  N EM
Sbjct:  1028 LLQANEEM 1035
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000287 "magnesium ion binding" evidence=ISO
GO:0000403 "Y-form DNA binding" evidence=ISO
GO:0000405 "bubble DNA binding" evidence=ISO
GO:0000723 "telomere maintenance" evidence=ISO;IGI;IMP
GO:0000731 "DNA synthesis involved in DNA repair" evidence=ISO
GO:0001302 "replicative cell aging" evidence=IMP
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=ISO
GO:0003678 "DNA helicase activity" evidence=ISO
GO:0003824 "catalytic activity" evidence=IEA
GO:0004003 "ATP-dependent DNA helicase activity" evidence=ISO
GO:0004386 "helicase activity" evidence=ISO
GO:0004518 "nuclease activity" evidence=IEA
GO:0004527 "exonuclease activity" evidence=ISO
GO:0005515 "protein binding" evidence=IPI
GO:0005524 "ATP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0005654 "nucleoplasm" evidence=ISO;IDA
GO:0005730 "nucleolus" evidence=ISO;IDA
GO:0005813 "centrosome" evidence=ISO
GO:0006139 "nucleobase-containing compound metabolic process" evidence=IEA
GO:0006200 "ATP catabolic process" evidence=ISO
GO:0006259 "DNA metabolic process" evidence=ISO;IMP
GO:0006260 "DNA replication" evidence=ISO;IMP
GO:0006281 "DNA repair" evidence=IEA
GO:0006284 "base-excision repair" evidence=ISO
GO:0006302 "double-strand break repair" evidence=ISO
GO:0006310 "DNA recombination" evidence=IEA
GO:0006974 "response to DNA damage stimulus" evidence=ISO
GO:0006979 "response to oxidative stress" evidence=ISO
GO:0007569 "cell aging" evidence=ISO
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0008408 "3'-5' exonuclease activity" evidence=ISO;IDA
GO:0009267 "cellular response to starvation" evidence=ISO
GO:0009378 "four-way junction helicase activity" evidence=ISO
GO:0010225 "response to UV-C" evidence=ISO
GO:0010259 "multicellular organismal aging" evidence=ISO;IGI
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016887 "ATPase activity" evidence=ISO
GO:0030145 "manganese ion binding" evidence=ISO
GO:0031297 "replication fork processing" evidence=ISO
GO:0032066 "nucleolus to nucleoplasm transport" evidence=ISO
GO:0032403 "protein complex binding" evidence=ISO
GO:0032508 "DNA duplex unwinding" evidence=ISO
GO:0040009 "regulation of growth rate" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=ISO
GO:0042981 "regulation of apoptotic process" evidence=ISO
GO:0043138 "3'-5' DNA helicase activity" evidence=ISO
GO:0043140 "ATP-dependent 3'-5' DNA helicase activity" evidence=IEA
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0051345 "positive regulation of hydrolase activity" evidence=ISO
GO:0051880 "G-quadruplex DNA binding" evidence=ISO
GO:0071480 "cellular response to gamma radiation" evidence=ISO
UNIPROTKB|F1NAR0 F1NAR0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RX70 WRN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LC91 WRN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2818 BA_2818 "ATP-dependent DNA helicase RecQ" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|O93530 wrn "Werner syndrome ATP-dependent helicase homolog" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070702-2 wrn "Werner syndrome" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1564788 Wrn "Werner syndrome, RecQ helicase-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q14191 WRN "Werner syndrome ATP-dependent helicase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEE6 WRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-14
pfam0057068 pfam00570, HRDC, HRDC domain 1e-13
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 6e-13
smart0095692 smart00956, RQC, This DNA-binding domain is found 3e-11
pfam0938292 pfam09382, RQC, RQC domain 2e-10
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 5e-07
smart0034181 smart00341, HRDC, Helicase and RNase D C-terminal 9e-05
PLN031371195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 8e-04
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information 
 Score = 75.1 bits (185), Expect = 2e-14
 Identities = 49/179 (27%), Positives = 78/179 (43%), Gaps = 23/179 (12%)

Query: 1   SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYL 60
           + K++    D+L  +G+GKD++   W++L  QLI+ G LTE  +           G Q  
Sbjct: 433 NDKILQKGHDQLSTYGIGKDYTQKEWRSLIDQLIAEGLLTENDEI--------YIGLQLT 484

Query: 61  GSARPDHQPPLLLTFNGEMVDAEEHETISSNVGDLKSSATLENEGFS-EADMQLYHMLLE 119
            +AR               V   E E +      +    T   +  S   D  L+  L E
Sbjct: 485 EAARK--------------VLKNEVEVLLRPFKVVAKEKTRVQKNLSVGVDNALFEALRE 530

Query: 120 ERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIR 178
            RK+ A      PY +  D T++++A  RP+T   L  I GV Q+ +  +G+  L+ IR
Sbjct: 531 LRKEQADEQNVPPYVIFSDSTLREMAEKRPATLNALLKIKGVGQNKLDRYGEAFLEVIR 589

The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ [DNA metabolism, DNA replication, recombination, and repair]. Length = 591
>gnl|CDD|201312 pfam00570, HRDC, HRDC domain Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214936 smart00956, RQC, This DNA-binding domain is found in the RecQ helicase among others and has a helix-turn-helix structure Back     alignment and domain information
>gnl|CDD|220217 pfam09382, RQC, RQC domain Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|128635 smart00341, HRDC, Helicase and RNase D C-terminal Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 430
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.93
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 99.91
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.86
COG4955343 Uncharacterized protein conserved in bacteria [Fun 99.86
PF1449391 HTH_40: Helix-turn-helix domain 99.82
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.81
PF0057068 HRDC: HRDC domain Bloom syndrome. Werner syndrome. 99.59
smart0034181 HRDC Helicase and RNase D C-terminal. Hypothetical 99.53
PF09382106 RQC: RQC domain; InterPro: IPR018982 This entry re 99.27
PRK10829373 ribonuclease D; Provisional 98.46
TIGR01388367 rnd ribonuclease D. This model describes ribonucle 98.44
PF1140880 Helicase_Sgs1: Sgs1 RecQ helicase; InterPro: IPR02 98.11
COG0349361 Rnd Ribonuclease D [Translation, ribosomal structu 97.58
KOG2206687 consensus Exosome 3'-5' exoribonuclease complex, s 95.4
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 94.13
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 93.97
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 92.61
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 92.36
PF13551112 HTH_29: Winged helix-turn helix 92.04
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 91.12
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 91.11
PRK15411207 rcsA colanic acid capsular biosynthesis activation 90.82
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 90.79
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 90.6
PRK00118104 putative DNA-binding protein; Validated 90.55
PF0605658 Terminase_5: Putative ATPase subunit of terminase 90.28
COG277165 CsgD DNA-binding HTH domain-containing proteins [T 90.14
PRK10840216 transcriptional regulator RcsB; Provisional 90.07
PRK15201198 fimbriae regulatory protein FimW; Provisional 89.92
COG2197211 CitB Response regulator containing a CheY-like rec 88.75
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 88.55
PF0063330 HHH: Helix-hairpin-helix motif; InterPro: IPR00044 88.5
PRK04217110 hypothetical protein; Provisional 88.45
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 88.42
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 88.06
PRK13719217 conjugal transfer transcriptional regulator TraJ; 88.02
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 87.5
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 86.98
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 86.82
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 86.34
PRK09483217 response regulator; Provisional 86.2
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 85.56
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 85.07
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 85.07
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 83.79
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 83.55
PRK10188240 DNA-binding transcriptional activator SdiA; Provis 83.51
PRK12547164 RNA polymerase sigma factor; Provisional 82.99
PRK09047161 RNA polymerase factor sigma-70; Validated 82.9
PRK12525168 RNA polymerase sigma factor; Provisional 82.22
PRK12529178 RNA polymerase sigma factor; Provisional 82.0
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 81.97
PF1351852 HTH_28: Helix-turn-helix domain 81.7
PRK15369211 two component system sensor kinase SsrB; Provision 81.54
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 81.54
PRK12528161 RNA polymerase sigma factor; Provisional 81.53
PRK12536181 RNA polymerase sigma factor; Provisional 80.7
TIGR03541232 reg_near_HchA LuxR family transcriptional regulato 80.67
PRK12542185 RNA polymerase sigma factor; Provisional 80.48
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 80.06
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information 
Probab=99.93  E-value=4.5e-25  Score=239.05  Aligned_cols=161  Identities=22%  Similarity=0.332  Sum_probs=136.4

Q ss_pred             ChhhhhhcccccCcccCCCCCCHHHHHHHHHHHHHcCCceeeecCccceEEeCcchHhhhcCCCCCCCCCeeeecccccc
Q 044490            1 SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIKDVYRTVSVSQQGKQYLGSARPDHQPPLLLTFNGEMV   80 (430)
Q Consensus         1 ~kkI~~~~~d~l~~fG~Gk~ls~~~wk~li~qLi~~GyL~e~~~~~y~~l~LT~kg~~~L~g~~kv~~~~l~l~~~~~~~   80 (430)
                      +++|.++||+++++||+|+++++.||++++++|+.+|||.+. .+.|++++||++|+.+|+|..++     .+....  .
T Consensus       444 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~l~~~~~~~~~l~~~~~~-----~~~~~~--~  515 (607)
T PRK11057        444 NQRIRDYGHDKLKVYGIGRDKSHEHWVSVIRQLIHLGLVTQN-IAQHSALQLTEAARPVLRGEVSL-----QLAVPR--I  515 (607)
T ss_pred             cchhhhcccccCCccCcCCcCCHHHHHHHHHHHHHcCCceec-cCccceEEECHHHHHHhcCCceE-----EEeccc--c
Confidence            589999999999999999999999999999999999999998 68899999999999999998653     222110  0


Q ss_pred             cchhhhhcccCcCCCCccccccccCCChHHHHHHHHHHHHHHHHHHHhCCCCeeecchHHHHHHHHhCCCCHHHHhccCC
Q 044490           81 DAEEHETISSNVGDLKSSATLENEGFSEADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDG  160 (430)
Q Consensus        81 ~~~~~~s~~~~~~~~~pk~~~~~~~~~e~~~~L~~~L~~~R~~lA~e~~vppy~Ifsd~tL~emA~~~P~T~~eL~~I~G  160 (430)
                      .+..   . .+     +.    .......+..||++|++||.++|.+.++|||+||+|.||.+||..+|.|.++|.+|+|
T Consensus       516 ~~~~---~-~~-----~~----~~~~~~~~~~l~~~Lr~~R~~~a~~~~~~~~~if~d~tL~~ia~~~P~t~~~l~~i~G  582 (607)
T PRK11057        516 VALK---P-RA-----MQ----KSFGGNYDRKLFAKLRKLRKSIADEENIPPYVVFNDATLIEMAEQMPITASEMLSVNG  582 (607)
T ss_pred             cccc---c-cc-----cc----ccccccchHHHHHHHHHHHHHHHHHcCCCCeEEECHHHHHHHHHHCCCCHHHHcCCCC
Confidence            0000   0 00     00    0111234689999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHH
Q 044490          161 VNQHLVITHGDHLLQTIRHLSQ  182 (430)
Q Consensus       161 vg~~k~~kyG~~fL~~I~~~~~  182 (430)
                      ||+.|+++||..|+++|+.++.
T Consensus       583 vg~~K~~~yg~~~l~~i~~~~~  604 (607)
T PRK11057        583 VGQRKLERFGKPFMALIRAHVD  604 (607)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999999875

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG4955 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14493 HTH_40: Helix-turn-helix domain Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00570 HRDC: HRDC domain Bloom syndrome Back     alignment and domain information
>smart00341 HRDC Helicase and RNase D C-terminal Back     alignment and domain information
>PF09382 RQC: RQC domain; InterPro: IPR018982 This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>TIGR01388 rnd ribonuclease D Back     alignment and domain information
>PF11408 Helicase_Sgs1: Sgs1 RecQ helicase; InterPro: IPR022758 RecQ helicases unwind DNA in an ATP-dependent manner Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2206 consensus Exosome 3'-5' exoribonuclease complex, subunit PM/SCL-100 (Rrp6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK15201 fimbriae regulatory protein FimW; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK10188 DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
3aaf_A134 Structure Of Wrn Rqc Domain Bound To Double-Strande 2e-05
2axl_A144 Solution Structure Of A Multifunctional Dna- And Pr 6e-05
>pdb|3AAF|A Chain A, Structure Of Wrn Rqc Domain Bound To Double-Stranded Dna Length = 134 Back     alignment and structure 
Iteration: 1

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 47/81 (58%), Gaps = 4/81 (4%)
Query: 1   SKKVVDAQFDKLLLHGLGKDHSSNWWKTLAYQLISYGYLTETIK--DVYRTVSVSQQGKQ 58
           S+++ D Q+ +  L G GKD + +WWK  + QLI+ G+L E  +     +  +++++G+ 
Sbjct: 46  SQRLAD-QYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRN 104
Query: 59  YLGSARPDHQPPLLLTFNGEM 79
           +L  A  + Q  L+L  N E+
Sbjct: 105 WLHKANTESQ-SLILQANEEL 124
>pdb|2AXL|A Chain A, Solution Structure Of A Multifunctional Dna- And Protein- Binding Domain Of Human Werner Syndrome Protein Length = 144 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
2rrd_A101 BLM HRDC domain, HRDC domain from bloom syndrome p 1e-11
2kv2_A85 Bloom syndrome protein; HRDC domain, disease mutat 1e-11
3aaf_A134 Werner syndrome ATP-dependent helicase; helix-turn 4e-11
2e1f_A103 Werner syndrome ATP-dependent helicase; HRDC domai 4e-11
2dgz_A113 Werner syndrome protein variant; HRDC domain, stru 7e-11
1wud_A89 ATP-dependent DNA helicase RECQ; DNA-binding domai 8e-11
2rhf_A77 DNA helicase RECQ; HRDC, D. radiodurans, ATP-bindi 1e-09
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
 Score = 60.1 bits (146), Expect = 1e-11
 Identities = 18/72 (25%), Positives = 32/72 (44%)

Query: 107 SEADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLV 166
            E   +    L E  K L +V G   + +    T+KK+A +  S    L  IDGV +  +
Sbjct: 18  EEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKL 77

Query: 167 ITHGDHLLQTIR 178
             +G  ++  ++
Sbjct: 78  EKYGAEVISVLQ 89
>2kv2_A Bloom syndrome protein; HRDC domain, disease mutation, DNA replicati binding, nucleotide-binding, nucleus, gene regulation; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3aaf_A Werner syndrome ATP-dependent helicase; helix-turn-helix, winged-helix, protein-DNA complex, DNA-BIN helicase; HET: DNA; 1.90A {Homo sapiens} PDB: 2axl_A Length = 134 Back     alignment and structure
>2e1f_A Werner syndrome ATP-dependent helicase; HRDC domain, hydrolase; 2.00A {Homo sapiens} SCOP: a.60.8.1 PDB: 2e1e_A Length = 103 Back     alignment and structure
>2dgz_A Werner syndrome protein variant; HRDC domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.60.8.1 Length = 113 Back     alignment and structure
>1wud_A ATP-dependent DNA helicase RECQ; DNA-binding domain, HRDC, hydrolase; 2.20A {Escherichia coli} SCOP: a.60.8.1 Length = 89 Back     alignment and structure
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans} Length = 77 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
2e1f_A103 Werner syndrome ATP-dependent helicase; HRDC domai 99.79
2kv2_A85 Bloom syndrome protein; HRDC domain, disease mutat 99.77
2rrd_A101 BLM HRDC domain, HRDC domain from bloom syndrome p 99.76
2rhf_A77 DNA helicase RECQ; HRDC, D. radiodurans, ATP-bindi 99.76
2dgz_A113 Werner syndrome protein variant; HRDC domain, stru 99.76
1wud_A89 ATP-dependent DNA helicase RECQ; DNA-binding domai 99.76
3iuo_A122 ATP-dependent DNA helicase RECQ; C-terminal, GI PS 99.75
3aaf_A134 Werner syndrome ATP-dependent helicase; helix-turn 99.41
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 99.22
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 99.17
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 99.14
3cym_A440 Uncharacterized protein BAD_0989; structural genom 98.84
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 98.45
1d8b_A81 SGS1 RECQ helicase; five helices, three-helical bu 98.36
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.56
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 93.92
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 93.45
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 93.31
3cym_A440 Uncharacterized protein BAD_0989; structural genom 93.09
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 93.04
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 92.92
3c57_A95 Two component transcriptional regulatory protein; 92.83
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 92.75
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 92.7
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 91.9
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 91.73
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 91.22
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 90.11
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 89.94
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 89.77
2k27_A159 Paired box protein PAX-8; paired domain, solution 88.99
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 88.9
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 88.88
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 88.42
1u78_A141 TC3 transposase, transposable element TC3 transpos 88.35
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 87.75
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 87.11
3szt_A237 QCSR, quorum-sensing control repressor; quorum sen 86.84
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 86.56
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 86.46
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 86.24
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 86.13
2q0o_A236 Probable transcriptional activator protein TRAR; h 85.61
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial 85.33
1l3l_A234 Transcriptional activator protein TRAR; helix-turn 84.02
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 83.76
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 83.69
3qp6_A265 CVIR transcriptional regulator; quorum sensing, ag 83.29
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 83.18
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 82.74
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 82.26
>2e1f_A Werner syndrome ATP-dependent helicase; HRDC domain, hydrolase; 2.00A {Homo sapiens} SCOP: a.60.8.1 PDB: 2e1e_A Back     alignment and structure
Probab=99.79  E-value=2.2e-19  Score=150.70  Aligned_cols=86  Identities=28%  Similarity=0.387  Sum_probs=81.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhCCCCeeecchHHHHHHHHhCCCCHHHHhccCCCCHHHHHHHHHHHHHHHHHHHHhhccC
Q 044490          108 EADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLS  187 (430)
Q Consensus       108 e~~~~L~~~L~~~R~~lA~e~~vppy~Ifsd~tL~emA~~~P~T~~eL~~I~Gvg~~k~~kyG~~fL~~I~~~~~e~~~~  187 (430)
                      +.+..||++|+.||.++|++.|+|||+||+|.||.+||..+|.|.++|.+|+|||+.|+++| ..||++|..+++++++.
T Consensus        12 ~~d~~l~~~L~~wR~~~A~~~~vP~y~If~D~tL~emA~~~P~t~~eL~~I~Gvg~~K~~~y-~~~L~~I~~~~~~~~i~   90 (103)
T 2e1f_A           12 ETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAML-APLLEVIKHFCQTNSVQ   90 (103)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTSCHHHHCCHHHHHHHHHHCCCSHHHHTTSTTCCHHHHHHT-HHHHHHHHHHHHHTTCC
T ss_pred             chHHHHHHHHHHHHHHHHHHcCCCCCeeECHHHHHHHHHhCCCCHHHHhcCCCCCHHHHHHH-HHHHHHHHHHHHhcCCC
Confidence            45789999999999999999999999999999999999999999999999999999999999 99999999999999988


Q ss_pred             CCCCcCc
Q 044490          188 LDGKVGE  194 (430)
Q Consensus       188 ~~~~~~~  194 (430)
                      .+.++..
T Consensus        91 ~~~~~~~   97 (103)
T 2e1f_A           91 TDLFSST   97 (103)
T ss_dssp             CCCCCC-
T ss_pred             cCCCCCC
Confidence            8777543
>2kv2_A Bloom syndrome protein; HRDC domain, disease mutation, DNA replicati binding, nucleotide-binding, nucleus, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans} Back     alignment and structure
>2dgz_A Werner syndrome protein variant; HRDC domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.60.8.1 Back     alignment and structure
>1wud_A ATP-dependent DNA helicase RECQ; DNA-binding domain, HRDC, hydrolase; 2.20A {Escherichia coli} SCOP: a.60.8.1 Back     alignment and structure
>3iuo_A ATP-dependent DNA helicase RECQ; C-terminal, GI PSI, MCSG, structural genomics, midwest center for structur genomics; 1.60A {Porphyromonas gingivalis} Back     alignment and structure
>3aaf_A Werner syndrome ATP-dependent helicase; helix-turn-helix, winged-helix, protein-DNA complex, DNA-BIN helicase; HET: DNA; 1.90A {Homo sapiens} PDB: 2axl_A Back     alignment and structure
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1d8b_A SGS1 RECQ helicase; five helices, three-helical bundle flanked by two helices, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.8.1 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3szt_A QCSR, quorum-sensing control repressor; quorum sensing acyl-homoserine lactone, helix-turn-helix, transcription factor, 3-OXO-C12 HSL; HET: OHN; 2.55A {Pseudomonas aeruginosa} Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3qp6_A CVIR transcriptional regulator; quorum sensing, agonist, antagonist, LUXR, acylated homoseri lactone, transcription factor; HET: HL6; 2.00A {Chromobacterium violaceum} PDB: 3qp5_A* Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 430
d1wuda177 a.60.8.1 (A:530-606) HRDC domain from RecQ helicas 4e-13
d2e1fa194 a.60.8.1 (A:1142-1235) Werner syndrome ATP-depende 1e-12
d2hbka196 a.60.8.4 (A:421-516) Exosome complex exonuclease R 1e-10
d2axla1144 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent h 6e-10
d1oywa1110 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding 4e-08
d1yt3a1101 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia c 4e-08
d2cpra1113 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 1e-07
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: SAM domain-like
superfamily: HRDC-like
family: HRDC domain from helicases
domain: HRDC domain from RecQ helicase
species: Escherichia coli [TaxId: 562]

 Score = 62.5 bits (152), Expect = 4e-13
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 110 DMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITH 169
           D +L+  L + RK +A  +   PY +  D T+ ++A   P T + + +++GV    +   
Sbjct: 3   DRKLFAKLRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERF 62

Query: 170 GDHLLQTIR 178
           G   +  IR
Sbjct: 63  GKPFMALIR 71
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 96 Back     information, alignment and structure
>d2axla1 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent helicase WRN {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1oywa1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure
>d1yt3a1 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia coli [TaxId: 562]} Length = 101 Back     information, alignment and structure
>d2cpra1 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
d2e1fa194 Werner syndrome ATP-dependent helicase, WRN {Human 99.82
d1wuda177 HRDC domain from RecQ helicase {Escherichia coli [ 99.77
d2hbka196 Exosome complex exonuclease RRP6 domain {Baker's y 99.49
d1oywa1110 DNA helicase RecQ DNA-binding domain {Escherichia 99.45
d1yt3a1101 Ribonuclease D {Escherichia coli [TaxId: 562]} 99.41
d2cpra1113 Exosome component 10, EXOSC10 {Human (Homo sapiens 99.27
d2axla1144 Werner syndrome ATP-dependent helicase WRN {Human 99.19
d1d8ba_81 HRDC domain from RecQ helicase {Baker's yeast (Sac 96.86
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 95.11
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 94.91
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 94.55
d1yioa170 Response regulatory protein StyR, C-terminal domai 94.26
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 93.41
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 92.5
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 92.18
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 91.9
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 91.8
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 90.67
d1yt3a281 Ribonuclease D {Escherichia coli [TaxId: 562]} 87.2
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 83.85
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 81.75
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 81.51
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 80.94
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: SAM domain-like
superfamily: HRDC-like
family: HRDC domain from helicases
domain: Werner syndrome ATP-dependent helicase, WRN
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.82  E-value=1.4e-20  Score=153.48  Aligned_cols=83  Identities=29%  Similarity=0.409  Sum_probs=79.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhCCCCeeecchHHHHHHHHhCCCCHHHHhccCCCCHHHHHHHHHHHHHHHHHHHHhhccC
Q 044490          108 EADMQLYHMLLEERKKLARVTGTAPYALCGDQTIKKIALARPSTKARLANIDGVNQHLVITHGDHLLQTIRHLSQKLNLS  187 (430)
Q Consensus       108 e~~~~L~~~L~~~R~~lA~e~~vppy~Ifsd~tL~emA~~~P~T~~eL~~I~Gvg~~k~~kyG~~fL~~I~~~~~e~~~~  187 (430)
                      +.+..||++|++||.++|++.++|||+||+|.+|.+||..+|.|.++|.+|+|||+.|+++||+ ||.+|.+||++++++
T Consensus        10 ~~~~~L~~~L~~~R~~~A~~~~ip~~~I~~d~~L~~ia~~~P~t~~eL~~I~G~g~~k~~kyG~-~l~~I~~~~~e~~~~   88 (94)
T d2e1fa1          10 ETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAP-LLEVIKHFCQTNSVQ   88 (94)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTSCHHHHCCHHHHHHHHHHCCCSHHHHTTSTTCCHHHHHHTHH-HHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCHheeeCHHHHHHHHHcCCCCHHHHcCCCCCCHHHHHHHHH-HHHHHHHHHHHcCCc
Confidence            4578999999999999999999999999999999999999999999999999999999999996 999999999999988


Q ss_pred             CCCC
Q 044490          188 LDGK  191 (430)
Q Consensus       188 ~~~~  191 (430)
                      .+.+
T Consensus        89 ~~~~   92 (94)
T d2e1fa1          89 TDLF   92 (94)
T ss_dssp             CCCC
T ss_pred             cccc
Confidence            7655
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt3a1 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cpra1 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axla1 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent helicase WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d8ba_ a.60.8.1 (A:) HRDC domain from RecQ helicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yt3a2 a.60.8.3 (A:295-375) Ribonuclease D {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure