Citrus Sinensis ID: 044687

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
LILDFLDEVVRKPTVLIGIGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVKQREPANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGRYL
cccHHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHcccccccHHcccccccccEEEEEccccccccccccccccc
cHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHHHHHEcccccccHHHHcccccccEEEEEccccccccccccccccc
LILDFLDevvrkptvligigddwrIKLLFPLLWFIDFLLKQRPIADAIFedvkqrepandegalDAFVSivtgpsgpnpvqlmpsisipvlvlwgdedpftpldrpvgryl
lildfldevvrkptvligigddwrIKLLFPLLWFIDFLLKQRPIADAIFEDVKQREPANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGdedpftpldrpvgryl
LILDFLDEVVRKPTVLIGIGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVKQREPANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGRYL
*ILDFLDEVVRKPTVLIGIGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVK*********ALDAFVSIVTGP***NPVQLMPSISIPVLVLWGDED*************
LILDFLDEVVRKPTVLIGIGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVKQREPANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVG*Y*
LILDFLDEVVRKPTVLIGIGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVKQREPANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGRYL
LILDFLDEVVRKPTVLIGIGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVKQREPANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGR*L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LILDFLDEVVRKPTVLIGIGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVKQREPANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGRYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
357504133 390 Epoxide hydrolase [Medicago truncatula] 1.0 0.284 0.502 1e-31
118489064 384 unknown [Populus trichocarpa x Populus d 1.0 0.289 0.526 2e-31
224127826 323 predicted protein [Populus trichocarpa] 1.0 0.343 0.526 8e-31
116792791 398 unknown [Picea sitchensis] 1.0 0.278 0.456 4e-29
356576581 396 PREDICTED: uncharacterized protein Rv271 1.0 0.280 0.514 9e-29
225459882 377 PREDICTED: uncharacterized protein LOC10 1.0 0.294 0.520 1e-28
255555592 377 alpha/beta hydrolase, putative [Ricinus 1.0 0.294 0.520 2e-28
326505290 368 predicted protein [Hordeum vulgare subsp 1.0 0.301 0.479 2e-27
147791693 638 hypothetical protein VITISV_021892 [Viti 0.954 0.166 0.514 2e-27
449441232 429 PREDICTED: 2-hydroxymuconate semialdehyd 1.0 0.258 0.502 2e-27
>gi|357504133|ref|XP_003622355.1| Epoxide hydrolase [Medicago truncatula] gi|355497370|gb|AES78573.1| Epoxide hydrolase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 90/179 (50%), Positives = 99/179 (55%), Gaps = 68/179 (37%)

Query: 1   LILDFLDEVVRKPTVLIG------------------------------------------ 18
           LILDFLDEVV+KPTVLIG                                          
Sbjct: 171 LILDFLDEVVQKPTVLIGNSVGSLACVIAAASGIIRPDSSETLVRGIVLLNCSGGMNNKA 230

Query: 19  IGDDWRIKLLFPLLWFIDFLLKQRPIADAIFEDVKQRE---------------------- 56
           I DDWRIKLL PLLW IDFLL Q+ IA AIFE VKQRE                      
Sbjct: 231 IVDDWRIKLLLPLLWLIDFLLNQKGIASAIFERVKQRENLRNILSSVYGNKESVDDELVE 290

Query: 57  ----PANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGRYL 111
               PAN EGALDAFVSIVTGP GPNPVQL+P I++P+L+LWGDEDPFTP+D PVG+Y 
Sbjct: 291 IIREPANAEGALDAFVSIVTGPPGPNPVQLVPKITLPILLLWGDEDPFTPIDGPVGKYF 349

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118489064|gb|ABK96339.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224127826|ref|XP_002329187.1| predicted protein [Populus trichocarpa] gi|222870968|gb|EEF08099.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|116792791|gb|ABK26500.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|356576581|ref|XP_003556409.1| PREDICTED: uncharacterized protein Rv2715/MT2788-like [Glycine max] Back     alignment and taxonomy information
>gi|225459882|ref|XP_002262834.1| PREDICTED: uncharacterized protein LOC100244872 isoform 1 [Vitis vinifera] gi|297734717|emb|CBI16951.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255555592|ref|XP_002518832.1| alpha/beta hydrolase, putative [Ricinus communis] gi|223542005|gb|EEF43550.1| alpha/beta hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|326505290|dbj|BAK03032.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|147791693|emb|CAN70704.1| hypothetical protein VITISV_021892 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441232|ref|XP_004138386.1| PREDICTED: 2-hydroxymuconate semialdehyde hydrolase-like [Cucumis sativus] gi|449515530|ref|XP_004164802.1| PREDICTED: 2-hydroxymuconate semialdehyde hydrolase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
TAIR|locus:2159823374 AT5G38520 [Arabidopsis thalian 0.486 0.144 0.740 5.1e-24
TAIR|locus:2832896359 AT5G19850 [Arabidopsis thalian 0.558 0.172 0.333 8.3e-07
TAIR|locus:2159823 AT5G38520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 223 (83.6 bits), Expect = 5.1e-24, Sum P(2) = 5.1e-24
 Identities = 40/54 (74%), Positives = 47/54 (87%)

Query:    57 PANDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGRY 110
             PAN EGALDAFVSI+TGP GPNP++L+P I+ PVLVLWGD+D  TPLD PVG+Y
Sbjct:   276 PANTEGALDAFVSILTGPPGPNPIKLIPEITKPVLVLWGDQDGLTPLDGPVGKY 329
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TAIR|locus:2832896 AT5G19850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.125.164.1
hydrolase, alpha/beta fold family protein (323 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.I.9332.1
hypothetical protein (327 aa)
  •     0.426

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
PLN02679360 PLN02679, PLN02679, hydrolase, alpha/beta fold fam 4e-58
PLN02824294 PLN02824, PLN02824, hydrolase, alpha/beta fold fam 1e-07
>gnl|CDD|178283 PLN02679, PLN02679, hydrolase, alpha/beta fold family protein Back     alignment and domain information 
 Score =  182 bits (463), Expect = 4e-58
 Identities = 87/172 (50%), Positives = 100/172 (58%), Gaps = 62/172 (36%)

Query: 1   LILDFLDEVVRKPTVLIG------------------------------------IGDDWR 24
           LILDFL+EVV+KPTVLIG                                    + DDWR
Sbjct: 144 LILDFLEEVVQKPTVLIGNSVGSLACVIAASESTRDLVRGLVLLNCAGGMNNKAVVDDWR 203

Query: 25  IKLLFPLLWFIDFLLKQRPIADAIFEDVKQRE--------------------------PA 58
           IKLL PLLW IDFLLKQR IA A+F  VKQR+                          PA
Sbjct: 204 IKLLLPLLWLIDFLLKQRGIASALFNRVKQRDNLKNILLSVYGNKEAVDDELVEIIRGPA 263

Query: 59  NDEGALDAFVSIVTGPSGPNPVQLMPSISIPVLVLWGDEDPFTPLDRPVGRY 110
           +DEGALDAFVSIVTGP GPNP++L+P IS+P+LVLWGD+DPFTPLD PVG+Y
Sbjct: 264 DDEGALDAFVSIVTGPPGPNPIKLIPRISLPILVLWGDQDPFTPLDGPVGKY 315

Length = 360
>gnl|CDD|178419 PLN02824, PLN02824, hydrolase, alpha/beta fold family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
PLN02824294 hydrolase, alpha/beta fold family protein 98.89
PLN02679360 hydrolase, alpha/beta fold family protein 98.86
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 98.64
PLN02578354 hydrolase 98.58
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.29
PRK03592295 haloalkane dehalogenase; Provisional 98.22
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.02
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 97.94
PRK07581339 hypothetical protein; Validated 97.91
KOG2984277 consensus Predicted hydrolase [General function pr 97.86
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 97.79
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 97.69
PRK03204286 haloalkane dehalogenase; Provisional 97.52
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.46
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.45
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 97.38
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.37
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.28
PRK06489360 hypothetical protein; Provisional 97.15
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.13
PHA02857276 monoglyceride lipase; Provisional 97.04
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 96.94
PRK10349256 carboxylesterase BioH; Provisional 96.86
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 96.86
PRK11071190 esterase YqiA; Provisional 96.81
PLN02298330 hydrolase, alpha/beta fold family protein 96.79
PLN02511388 hydrolase 96.63
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 96.54
PLN02385349 hydrolase; alpha/beta fold family protein 96.51
PRK00175379 metX homoserine O-acetyltransferase; Provisional 96.49
PRK00870302 haloalkane dehalogenase; Provisional 96.45
KOG1552258 consensus Predicted alpha/beta hydrolase [General 96.41
PRK10749330 lysophospholipase L2; Provisional 96.11
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 96.06
PLN02965255 Probable pheophorbidase 95.95
PLN02652395 hydrolase; alpha/beta fold family protein 95.78
COG2267298 PldB Lysophospholipase [Lipid metabolism] 95.61
PRK06765389 homoserine O-acetyltransferase; Provisional 95.59
PRK10673255 acyl-CoA esterase; Provisional 95.55
PRK10985324 putative hydrolase; Provisional 95.54
PRK08775343 homoserine O-acetyltransferase; Provisional 95.3
PLN03084383 alpha/beta hydrolase fold protein; Provisional 95.05
PRK07868 994 acyl-CoA synthetase; Validated 94.63
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 94.54
PRK10566249 esterase; Provisional 94.49
COG1647243 Esterase/lipase [General function prediction only] 94.42
PRK05855 582 short chain dehydrogenase; Validated 94.15
PLN02894402 hydrolase, alpha/beta fold family protein 94.09
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 93.95
PRK13604307 luxD acyl transferase; Provisional 93.85
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 92.81
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 92.78
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 92.48
KOG1455313 consensus Lysophospholipase [Lipid transport and m 92.4
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 92.2
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 92.18
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 91.93
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 91.92
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 91.67
PLN02211273 methyl indole-3-acetate methyltransferase 91.47
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 90.84
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 89.64
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 88.88
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 88.87
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 88.71
KOG4667269 consensus Predicted esterase [Lipid transport and 85.94
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 85.71
PRK11460232 putative hydrolase; Provisional 85.52
COG0400207 Predicted esterase [General function prediction on 85.15
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 85.12
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 84.88
PLN02965255 Probable pheophorbidase 83.22
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 82.77
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 82.59
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 81.83
PRK00870302 haloalkane dehalogenase; Provisional 81.67
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 81.14
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information 
Probab=98.89  E-value=5.3e-09  Score=75.88  Aligned_cols=28  Identities=39%  Similarity=1.062  Sum_probs=23.9

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      ...+.+.++++|||+|||++|+++|.+.
T Consensus       225 ~~~~~l~~i~~P~lvi~G~~D~~~~~~~  252 (294)
T PLN02824        225 LPEELLPAVKCPVLIAWGEKDPWEPVEL  252 (294)
T ss_pred             chHHHHhhcCCCeEEEEecCCCCCChHH
Confidence            3456789999999999999999999854

>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 1e-09
1iup_A282 META-cleavage product hydrolase; aromatic compound 2e-07
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 1e-06
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 4e-06
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 5e-06
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 1e-05
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 2e-05
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 4e-05
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 1e-04
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 2e-04
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 2e-04
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 2e-04
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 3e-04
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 3e-04
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 3e-04
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 7e-04
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 7e-04
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 9e-04
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 Back     alignment and structure
 Score = 52.8 bits (127), Expect = 1e-09
 Identities = 22/112 (19%), Positives = 41/112 (36%), Gaps = 16/112 (14%)

Query: 8   EVVRKPTVLIGIG--DDWRIKLLFPLLWFIDFLLKQRPIADAIFED--------VKQR-E 56
           E+V    VL+G         + L P++ +         +  A+  D        +  R  
Sbjct: 129 ELVNA-LVLMGSAGLVVEIHEDLRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYT 187

Query: 57  PANDEGALDAFVSIVTGPSGPNPVQLMPS----ISIPVLVLWGDEDPFTPLD 104
            A DE    A+V+ +        +   P     + +P LV+ G +D   P++
Sbjct: 188 YATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVE 239
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 98.62
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.27
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.26
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.21
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.19
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.18
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.16
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.16
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.15
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.14
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.11
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.1
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.06
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.03
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.99
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 97.97
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 97.96
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 97.95
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 97.94
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.91
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.91
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 97.11
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 97.88
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.88
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 97.84
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.81
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 97.79
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.76
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.74
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 97.73
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.71
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.7
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.69
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.66
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.64
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.62
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.62
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.6
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 97.58
4fle_A202 Esterase; structural genomics, PSI-biology, northe 97.5
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.48
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.36
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 97.34
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 97.3
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.3
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 97.27
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 97.22
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.15
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 97.14
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 97.03
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 97.01
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 96.98
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.89
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.89
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 96.86
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 96.82
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 96.81
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.75
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.74
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.59
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 96.48
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.34
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 96.22
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 96.2
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 96.02
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 96.01
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 96.01
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 95.97
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 95.96
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 95.92
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 95.78
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 95.74
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 95.73
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 95.64
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 95.61
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 95.59
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 95.55
3llc_A270 Putative hydrolase; structural genomics, joint cen 95.53
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 95.51
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 95.5
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 95.37
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 95.33
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.33
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 95.25
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 95.18
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 95.13
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 95.13
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 95.12
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 95.1
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 95.08
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 95.04
3bjr_A283 Putative carboxylesterase; structural genomics, jo 95.02
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 94.79
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 94.77
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 94.65
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 94.62
3h04_A275 Uncharacterized protein; protein with unknown func 94.61
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 94.43
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 94.38
1r3d_A264 Conserved hypothetical protein VC1974; structural 94.3
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 94.13
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.11
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 94.11
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 94.1
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 94.05
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 94.0
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 93.91
1vkh_A273 Putative serine hydrolase; structural genomics, jo 93.89
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 93.84
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 93.78
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 93.54
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 93.36
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 93.32
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 93.31
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 93.3
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 93.29
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 93.27
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 93.12
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 93.06
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 93.02
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 93.01
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 92.93
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 92.72
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 92.71
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 92.67
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 92.53
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 92.38
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 92.23
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 92.17
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 91.89
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 91.63
1kez_A300 Erythronolide synthase; polyketide synthase, modul 91.3
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 91.02
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 91.02
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 90.94
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 90.92
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.61
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 90.5
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 90.47
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 90.28
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 90.13
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 89.85
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 89.83
4f21_A246 Carboxylesterase/phospholipase family protein; str 89.62
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 89.56
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 89.54
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 89.51
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 89.43
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 89.38
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 89.19
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 88.94
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 88.8
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 88.42
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 88.3
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 87.85
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 87.71
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 87.67
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 87.51
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 87.24
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 86.45
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 86.32
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 86.15
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 86.06
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 85.73
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 85.68
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 85.07
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 84.87
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 84.78
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 84.7
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 84.67
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 84.46
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 84.36
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 83.97
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 83.86
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 83.55
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 82.87
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 82.7
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 82.7
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 82.68
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 81.93
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 81.88
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 81.75
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 81.64
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 81.64
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 81.33
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 81.24
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 81.23
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 81.02
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 80.77
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 80.58
1r3d_A264 Conserved hypothetical protein VC1974; structural 80.33
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 80.23
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
Probab=98.62  E-value=4.4e-08  Score=68.53  Aligned_cols=28  Identities=25%  Similarity=0.313  Sum_probs=23.6

Q ss_pred             ChhhcCCCCCCCeEEEecCCCCCCCCCC
Q 044687           78 NPVQLMPSISIPVLVLWGDEDPFTPLDR  105 (111)
Q Consensus        78 ~~~~~l~~i~~PtLliWG~~D~~iP~~~  105 (111)
                      +..+.+.+|++|||+|||++|+++|++.
T Consensus       199 d~~~~l~~i~~P~Lvi~G~~D~~~~~~~  226 (266)
T 3om8_A          199 DLRAQLARIERPTLVIAGAYDTVTAASH  226 (266)
T ss_dssp             BCTTTGGGCCSCEEEEEETTCSSSCHHH
T ss_pred             chhhHhcCCCCCEEEEEeCCCCCCCHHH
Confidence            3446688999999999999999998743
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.04
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.98
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 97.95
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 97.93
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.76
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.75
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.73
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.7
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 97.69
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 97.58
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 97.57
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 97.52
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.43
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.4
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 97.14
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 96.95
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 96.62
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 96.58
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 96.37
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 96.37
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 96.32
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 96.18
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.02
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 95.94
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 95.84
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 95.68
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.32
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 95.26
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 95.12
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 95.08
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 94.54
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 94.48
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 94.13
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 93.8
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 93.13
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 91.94
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 91.75
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 91.04
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 90.66
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 90.64
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 90.62
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 90.02
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 89.83
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 84.57
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 84.39
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 84.29
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 83.76
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 82.77
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 80.4
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)
species: Rhodococcus sp., strain rha1 [TaxId: 1831]

Probab=98.04  E-value=2.2e-06  Score=57.46  Aligned_cols=26  Identities=35%  Similarity=0.599  Sum_probs=22.6

Q ss_pred             hhhcCCCCCCCeEEEecCCCCCCCCC
Q 044687           79 PVQLMPSISIPVLVLWGDEDPFTPLD  104 (111)
Q Consensus        79 ~~~~l~~i~~PtLliWG~~D~~iP~~  104 (111)
                      ..+.+.++++|||++||++|+++|++
T Consensus       214 ~~~~l~~i~~P~lii~G~~D~~~~~~  239 (281)
T d1c4xa_         214 PPATLGRLPHDVLVFHGRQDRIVPLD  239 (281)
T ss_dssp             CHHHHTTCCSCEEEEEETTCSSSCTH
T ss_pred             chhhhhhhccceEEEEeCCCCCcCHH
Confidence            34568899999999999999999975
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure