Citrus Sinensis ID: 044862
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| 255552704 | 234 | extensin, proline-rich protein, putative | 0.838 | 0.619 | 0.562 | 6e-24 | |
| 388519821 | 248 | unknown [Medicago truncatula] | 0.826 | 0.576 | 0.505 | 4e-23 | |
| 388507786 | 249 | unknown [Lotus japonicus] | 0.369 | 0.257 | 0.735 | 7e-22 | |
| 388501570 | 231 | unknown [Lotus japonicus] | 0.369 | 0.277 | 0.735 | 8e-22 | |
| 296087713 | 298 | unnamed protein product [Vitis vinifera] | 0.352 | 0.204 | 0.769 | 3e-21 | |
| 225452551 | 231 | PREDICTED: uncharacterized protein LOC10 | 0.352 | 0.264 | 0.769 | 2e-20 | |
| 351726602 | 191 | uncharacterized protein LOC100527019 pre | 0.352 | 0.319 | 0.723 | 3e-19 | |
| 112350249 | 264 | GASA-like protein [Gossypium hirsutum] | 0.358 | 0.234 | 0.712 | 9e-19 | |
| 351725761 | 182 | uncharacterized protein LOC100527676 pre | 0.352 | 0.335 | 0.707 | 1e-18 | |
| 224060000 | 223 | predicted protein [Populus trichocarpa] | 0.358 | 0.278 | 0.696 | 6e-18 |
| >gi|255552704|ref|XP_002517395.1| extensin, proline-rich protein, putative [Ricinus communis] gi|223543406|gb|EEF44937.1| extensin, proline-rich protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 115 bits (288), Expect = 6e-24, Method: Compositional matrix adjust.
Identities = 95/169 (56%), Positives = 101/169 (59%), Gaps = 24/169 (14%)
Query: 26 PVVKPPTT-YPPPVKPPTTTPPVVKLPTVAPAPPVKPPTVMPTPPLKPPPT--------- 75
PVVKPPT+ PP VKPPT +PPV K PT P +KPP P
Sbjct: 69 PVVKPPTSPAPPVVKPPTPSPPVYKPPTT---PVIKPPNAPSPVVKPPTVPAPPVVKPPT 125
Query: 76 YPPPV-KPPTTTPPPVSPPKTAPAPQV------PSPASSPMPIVRSNKDCIPLCAARCKA 128
Y PPV KPPT PP V PP T P P P+ +P+P VRS DCIPLCA RCK
Sbjct: 126 YSPPVAKPPTPAPPVVKPPSTPAPPMFKPPTPLPPPSGTPLPPVRSRADCIPLCAERCKL 185
Query: 129 HSRPNIFGRACTTCCVRCKCVPPGTYGNREKCGKCYTG----GNKPKCP 173
HSR NI RAC TCC RCKCVPPGTYGNREKCGKCYT NKPKCP
Sbjct: 186 HSRKNICTRACITCCDRCKCVPPGTYGNREKCGKCYTDMTTRHNKPKCP 234
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|388519821|gb|AFK47972.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388507786|gb|AFK41959.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|388501570|gb|AFK38851.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|296087713|emb|CBI34969.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225452551|ref|XP_002280219.1| PREDICTED: uncharacterized protein LOC100259439 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351726602|ref|NP_001237388.1| uncharacterized protein LOC100527019 precursor [Glycine max] gi|255631378|gb|ACU16056.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|112350249|gb|ABI15167.1| GASA-like protein [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|351725761|ref|NP_001235824.1| uncharacterized protein LOC100527676 precursor [Glycine max] gi|255632928|gb|ACU16818.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224060000|ref|XP_002300026.1| predicted protein [Populus trichocarpa] gi|222847284|gb|EEE84831.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| TAIR|locus:2147810 | 275 | GASA14 "AT5G14920" [Arabidopsi | 0.358 | 0.225 | 0.651 | 9e-22 | |
| TAIR|locus:2005634 | 98 | GASA1 "AT1G75750" [Arabidopsis | 0.323 | 0.571 | 0.557 | 4.2e-15 | |
| TAIR|locus:2062175 | 94 | AT2G18420 "AT2G18420" [Arabido | 0.323 | 0.595 | 0.540 | 1.6e-13 | |
| TAIR|locus:2136892 | 99 | GASA3 "AT4G09600" [Arabidopsis | 0.323 | 0.565 | 0.524 | 7.1e-13 | |
| TAIR|locus:2199645 | 119 | AT1G22690 "AT1G22690" [Arabido | 0.346 | 0.504 | 0.492 | 2.4e-12 | |
| TAIR|locus:2136897 | 99 | GASA2 "AT4G09610" [Arabidopsis | 0.323 | 0.565 | 0.491 | 5.8e-11 | |
| TAIR|locus:505006327 | 97 | GASA5 "GAST1 protein homolog 5 | 0.317 | 0.567 | 0.437 | 2.5e-10 | |
| TAIR|locus:4010713737 | 103 | AT3G10185 [Arabidopsis thalian | 0.312 | 0.524 | 0.444 | 4.1e-10 | |
| TAIR|locus:2052876 | 106 | AT2G30810 [Arabidopsis thalian | 0.317 | 0.518 | 0.437 | 1.4e-09 | |
| TAIR|locus:2019195 | 101 | GASA6 "AT1G74670" [Arabidopsis | 0.306 | 0.524 | 0.435 | 7.6e-09 |
| TAIR|locus:2147810 GASA14 "AT5G14920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 254 (94.5 bits), Expect = 9.0e-22, P = 9.0e-22
Identities = 43/66 (65%), Positives = 47/66 (71%)
Query: 112 VRSNKDCIPLCAARCKAHSRPNIFGRACTTCCVRCKCVPPGTYGNREKCGKCY----TGG 167
VR+ DC+PLC RC HSR N+ RAC TCC RCKCVPPGTYGN+EKCG CY T G
Sbjct: 210 VRTRIDCVPLCGTRCGQHSRKNVCMRACVTCCYRCKCVPPGTYGNKEKCGSCYANMKTRG 269
Query: 168 NKPKCP 173
K KCP
Sbjct: 270 GKSKCP 275
|
|
| TAIR|locus:2005634 GASA1 "AT1G75750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062175 AT2G18420 "AT2G18420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136892 GASA3 "AT4G09600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199645 AT1G22690 "AT1G22690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136897 GASA2 "AT4G09610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006327 GASA5 "GAST1 protein homolog 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4010713737 AT3G10185 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2052876 AT2G30810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019195 GASA6 "AT1G74670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| pfam02704 | 60 | pfam02704, GASA, Gibberellin regulated protein | 2e-16 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-09 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-09 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-08 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-08 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 3e-08 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 6e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-08 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 1e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-07 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 3e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-07 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 6e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 8e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-06 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 2e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-06 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 5e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 6e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 8e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-05 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 1e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 2e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-05 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 5e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 6e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 8e-05 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 8e-05 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 9e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 2e-04 | |
| PRK10547 | 670 | PRK10547, PRK10547, chemotaxis protein CheA; Provi | 2e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 3e-04 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 3e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-04 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 4e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 5e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 5e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 6e-04 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 6e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 7e-04 | |
| pfam11725 | 1771 | pfam11725, AvrE, Pathogenicity factor | 7e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 8e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 9e-04 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 9e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 0.001 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 0.001 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.001 | |
| COG3898 | 531 | COG3898, COG3898, Uncharacterized membrane-bound p | 0.001 | |
| TIGR02813 | 2582 | TIGR02813, omega_3_PfaA, polyketide-type polyunsat | 0.001 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.002 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.002 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.002 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.002 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.003 | |
| PRK10547 | 670 | PRK10547, PRK10547, chemotaxis protein CheA; Provi | 0.003 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.003 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.004 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.004 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.004 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 0.004 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.004 | |
| TIGR02813 | 2582 | TIGR02813, omega_3_PfaA, polyketide-type polyunsat | 0.004 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.004 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 0.004 |
| >gnl|CDD|190394 pfam02704, GASA, Gibberellin regulated protein | Back alignment and domain information |
|---|
Score = 69.2 bits (170), Expect = 2e-16
Identities = 32/61 (52%), Positives = 37/61 (60%), Gaps = 5/61 (8%)
Query: 117 DCIPLCAARCKAHSRPNIFGRACTTCCVRCKCVPPGTYGNREKCGKCY----TGGNKPKC 172
DC CA RC SR RAC CC +C CVPPGTYGN+++C CY T G +PKC
Sbjct: 1 DCGGKCAVRCSKTSRKKPCLRACGKCCAKCLCVPPGTYGNKDEC-PCYNNWKTHGGRPKC 59
Query: 173 P 173
P
Sbjct: 60 P 60
|
This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds. Length = 60 |
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236712 PRK10547, PRK10547, chemotaxis protein CheA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|221188 pfam11725, AvrE, Pathogenicity factor | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226414 COG3898, COG3898, Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236712 PRK10547, PRK10547, chemotaxis protein CheA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| PF02704 | 60 | GASA: Gibberellin regulated protein; InterPro: IPR | 99.96 |
| >PF02704 GASA: Gibberellin regulated protein; InterPro: IPR003854 This is the GASA gibberellin regulated cysteine rich protein family | Back alignment and domain information |
|---|
Probab=99.96 E-value=1e-29 Score=178.69 Aligned_cols=56 Identities=61% Similarity=1.377 Sum_probs=54.9
Q ss_pred CChHHHHHHHhhcCCccHHHHHHHhhcCCccccCCCCCCCcCCCcccccC----CCCCCCC
Q 044862 117 DCIPLCAARCKAHSRPNIFGRACTTCCVRCKCVPPGTYGNREKCGKCYTG----GNKPKCP 173 (173)
Q Consensus 117 dC~~~C~~RCs~~sr~k~CmraC~~CC~kC~CVPpGTyGNkeeCPpCY~d----~G~pKCP 173 (173)
||+++|++||++++++++|||+||+||++|+|||+|||||+|+|+ ||+| +|++|||
T Consensus 1 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~gn~~~Cp-CY~~m~t~~g~pKCP 60 (60)
T PF02704_consen 1 DCGGACSVRCSKASRKKRCMRACGTCCAKCKCVPPGTYGNKEECP-CYRDMKTHGGKPKCP 60 (60)
T ss_pred CcchHHHHHHhccCCchHHHHHHHHHhccCcccCCCCCCCCccCC-ChhhhhccCCCCCCc
Confidence 799999999999999999999999999999999999999999997 9999 9999998
|
The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds. |
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 5e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 6e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 5e-09 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-08 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 3e-07 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 5e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 8e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 5e-07 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 6e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 9e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 5e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 1e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-04 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 6e-05 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 8e-05 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 1e-04 |
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
Score = 56.5 bits (135), Expect = 5e-10
Identities = 10/129 (7%), Positives = 21/129 (16%)
Query: 5 PKTPVPAPAPPKAPVKPITPPPVVKPPTTYPPPVKPPTTTPPVVKLPTVAPAPPVKPPTV 64
+ K +
Sbjct: 30 SGANTELVSGESEHSTNEADKQNEGEHARENKLEKAEGVATASETASPASNEAATTETAE 89
Query: 65 MPTPPLKPPPTYPPPVKPPTTTPPPVSPPKTAPAPQVPSPASSPMPIVRSNKDCIPLCAA 124
+ + P+ P S +T P+ + P +NK +
Sbjct: 90 AASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAAEANKTEKEVQPD 149
Query: 125 RCKAHSRPN 133
K +
Sbjct: 150 VPKNTEKTL 158
|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00