Citrus Sinensis ID: 044925
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| 15238555 | 111 | large subunit ribosomal protein LP1 [Ara | 0.592 | 0.549 | 0.432 | 0.0007 |
| >gi|15238555|ref|NP_197839.1| large subunit ribosomal protein LP1 [Arabidopsis thaliana] gi|10177851|dbj|BAB11203.1| 60s acidic ribosomal protein P1 [Arabidopsis thaliana] gi|67633816|gb|AAY78832.1| putative 60S acidic ribosomal protein P1 [Arabidopsis thaliana] gi|332005935|gb|AED93318.1| large subunit ribosomal protein LP1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 48.1 bits (113), Expect = 7e-04, Method: Compositional matrix adjust.
Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 6/67 (8%)
Query: 40 KLFEKRSADELYLNVGSGGAHLAVAAPAVASSGLGGAALAAAVEEKKEE---TKEESDDD 96
KL EK++ D+L +NVG+GG VA P ++ +++ EEKK E KEES+DD
Sbjct: 48 KLCEKKNIDDLIMNVGAGGC--GVARPVTTAAPTASQSVSIP-EEKKNEMEVIKEESEDD 104
Query: 97 MGLSLFD 103
M + LFD
Sbjct: 105 MIIGLFD 111
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
No confident hit detected by STRING
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| cd05831 | 103 | cd05831, Ribosomal_P1, Ribosomal protein P1 | 3e-15 | |
| cd05833 | 109 | cd05833, Ribosomal_P2, Ribosomal protein P2 | 6e-12 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 9e-12 | |
| PLN00138 | 113 | PLN00138, PLN00138, large subunit ribosomal protei | 1e-08 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 7e-08 | |
| cd04411 | 105 | cd04411, Ribosomal_P1_P2_L12p, Ribosomal protein P | 1e-07 | |
| PTZ00135 | 310 | PTZ00135, PTZ00135, 60S acidic ribosomal protein P | 2e-05 | |
| PTZ00373 | 112 | PTZ00373, PTZ00373, 60S Acidic ribosomal protein P | 6e-05 |
| >gnl|CDD|100109 cd05831, Ribosomal_P1, Ribosomal protein P1 | Back alignment and domain information |
|---|
Score = 65.0 bits (159), Expect = 3e-15
Identities = 32/63 (50%), Positives = 37/63 (58%), Gaps = 3/63 (4%)
Query: 40 KLFEKRSADELYLNVGSGGAHLAVAAPAVASSGLGGAALAAAVEEKKEETKEESDDDMGL 99
K E + +L NVG GG AAPA A++ AA A EEKKEE +EESDDDMG
Sbjct: 44 KALEGKDIKDLLSNVGGGGG---GAAPAAAAAAAAAAAAEAKKEEKKEEEEEESDDDMGF 100
Query: 100 SLF 102
LF
Sbjct: 101 GLF 103
|
This subfamily represents the eukaryotic large ribosomal protein P1. Eukaryotic P1 and P2 are functionally equivalent to the bacterial protein L7/L12, but are not homologous to L7/L12. P1 is located in the L12 stalk, with proteins P2, P0, L11, and 28S rRNA. P1 and P2 are the only proteins in the ribosome to occur as multimers, always appearing as sets of heterodimers. Recent data indicate that eukaryotes have four copies (two heterodimers), while most archaeal species contain six copies of L12p (three homodimers) and bacteria may have four or six copies (two or three homodimers), depending on the species. Experiments using S. cerevisiae P1 and P2 indicate that P1 proteins are positioned more internally with limited reactivity in the C-terminal domains, while P2 proteins seem to be more externally located and are more likely to interact with other cellular components. In lower eukaryotes, P1 and P2 are further subdivided into P1A, P1B, P2A, and P2B, which form P1A/P2B and P1B/P2A heterodimers. Some plant species have a third P-protein, called P3, which is not homologous to P1 and P2. In humans, P1 and P2 are strongly autoimmunogenic. They play a significant role in the etiology and pathogenesis of systemic lupus erythema (SLE). In addition, the ribosome-inactivating protein trichosanthin (TCS) interacts with human P0, P1, and P2, with its primary binding site located in the C-terminal region of P2. TCS inactivates the ribosome by depurinating a specific adenine in the sarcin-ricin loop of 28S rRNA. Length = 103 |
| >gnl|CDD|100111 cd05833, Ribosomal_P2, Ribosomal protein P2 | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|165706 PLN00138, PLN00138, large subunit ribosomal protein LP2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|100108 cd04411, Ribosomal_P1_P2_L12p, Ribosomal protein P1, P2, and L12p | Back alignment and domain information |
|---|
| >gnl|CDD|240285 PTZ00135, PTZ00135, 60S acidic ribosomal protein P0; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185582 PTZ00373, PTZ00373, 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| KOG3449 | 112 | consensus 60S acidic ribosomal protein P2 [Transla | 99.93 | |
| PTZ00373 | 112 | 60S Acidic ribosomal protein P2; Provisional | 99.92 | |
| PLN00138 | 113 | large subunit ribosomal protein LP2; Provisional | 99.91 | |
| cd05833 | 109 | Ribosomal_P2 Ribosomal protein P2. This subfamily | 99.91 | |
| cd04411 | 105 | Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and | 99.91 | |
| cd05831 | 103 | Ribosomal_P1 Ribosomal protein P1. This subfamily | 99.88 | |
| COG2058 | 109 | RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Tr | 99.84 | |
| PF00428 | 88 | Ribosomal_60s: 60s Acidic ribosomal protein; Inter | 99.8 | |
| KOG1762 | 114 | consensus 60s acidic ribosomal protein P1 [Transla | 99.8 | |
| PRK06402 | 106 | rpl12p 50S ribosomal protein L12P; Reviewed | 99.69 | |
| cd05832 | 106 | Ribosomal_L12p Ribosomal protein L12p. This subfam | 99.45 | |
| TIGR03685 | 105 | L21P_arch 50S ribosomal protein L12P. This model r | 99.44 | |
| PTZ00135 | 310 | 60S acidic ribosomal protein P0; Provisional | 98.56 | |
| PTZ00240 | 323 | 60S ribosomal protein P0; Provisional | 97.87 | |
| cd04411 | 105 | Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and | 97.19 | |
| COG2058 | 109 | RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Tr | 97.15 | |
| PRK06402 | 106 | rpl12p 50S ribosomal protein L12P; Reviewed | 97.11 | |
| KOG3449 | 112 | consensus 60S acidic ribosomal protein P2 [Transla | 96.89 | |
| cd05831 | 103 | Ribosomal_P1 Ribosomal protein P1. This subfamily | 96.65 | |
| PRK04019 | 330 | rplP0 acidic ribosomal protein P0; Validated | 96.55 | |
| TIGR03685 | 105 | L21P_arch 50S ribosomal protein L12P. This model r | 96.41 | |
| cd05832 | 106 | Ribosomal_L12p Ribosomal protein L12p. This subfam | 96.11 | |
| cd05833 | 109 | Ribosomal_P2 Ribosomal protein P2. This subfamily | 94.79 | |
| PLN00138 | 113 | large subunit ribosomal protein LP2; Provisional | 91.14 | |
| PTZ00373 | 112 | 60S Acidic ribosomal protein P2; Provisional | 89.86 | |
| PTZ00240 | 323 | 60S ribosomal protein P0; Provisional | 84.47 |
| >KOG3449 consensus 60S acidic ribosomal protein P2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.4e-26 Score=162.08 Aligned_cols=89 Identities=45% Similarity=0.545 Sum_probs=66.2
Q ss_pred cCCchhhHhhhhhcccccccHHHHHHHHHHhcCCChHHHhh-------hcCCCCcccccccccccccCCCCccchhhhhh
Q 044925 12 FWPHNTIDSGLVEFSFFTSQPEKIATLIKLFEKRSADELYL-------NVGSGGAHLAVAAPAVASSGLGGAALAAAVEE 84 (103)
Q Consensus 12 ~~~~~~i~~~l~~~g~vevdaekI~~li~aL~gk~I~eLIa-------~v~agg~a~~aaaa~aa~~~~~a~a~~~~~ee 84 (103)
.-+..||++||.+|| +++|.++|+.||+.|+||+|.|||+ ++++||+++++++++++ ++++++....+++
T Consensus 17 ~psa~DikkIl~sVG-~E~d~e~i~~visel~GK~i~ElIA~G~eklAsvpsGGa~~aaa~~aag--gaa~aa~~a~~~e 93 (112)
T KOG3449|consen 17 SPSASDIKKILESVG-AEIDDERINLVLSELKGKDIEELIAAGREKLASVPSGGAVAAAAAPAAG--GAAGAAPAAAKEE 93 (112)
T ss_pred CCCHHHHHHHHHHhC-cccCHHHHHHHHHHhcCCCHHHHHHHhHHHHhcCCCCCccccccCcCCC--CCccCCccchhhh
Confidence 567899999999999 9999999999999999999999995 68877764322221111 1111222223455
Q ss_pred hhcccccccccCCCCCCCC
Q 044925 85 KKEETKEESDDDMGLSLFD 103 (103)
Q Consensus 85 ~keeeeEE~ddDmGFgLFD 103 (103)
+|+||+|||||||||+|||
T Consensus 94 ~keEe~eesddDmgf~lFd 112 (112)
T KOG3449|consen 94 EKEEEKEESDDDMGFGLFD 112 (112)
T ss_pred hhhhhcccccccccccccC
Confidence 5666669999999999998
|
|
| >PTZ00373 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
| >PLN00138 large subunit ribosomal protein LP2; Provisional | Back alignment and domain information |
|---|
| >cd05833 Ribosomal_P2 Ribosomal protein P2 | Back alignment and domain information |
|---|
| >cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p | Back alignment and domain information |
|---|
| >cd05831 Ribosomal_P1 Ribosomal protein P1 | Back alignment and domain information |
|---|
| >COG2058 RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00428 Ribosomal_60s: 60s Acidic ribosomal protein; InterPro: IPR001813 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG1762 consensus 60s acidic ribosomal protein P1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06402 rpl12p 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >cd05832 Ribosomal_L12p Ribosomal protein L12p | Back alignment and domain information |
|---|
| >TIGR03685 L21P_arch 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >PTZ00135 60S acidic ribosomal protein P0; Provisional | Back alignment and domain information |
|---|
| >PTZ00240 60S ribosomal protein P0; Provisional | Back alignment and domain information |
|---|
| >cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p | Back alignment and domain information |
|---|
| >COG2058 RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06402 rpl12p 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >KOG3449 consensus 60S acidic ribosomal protein P2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05831 Ribosomal_P1 Ribosomal protein P1 | Back alignment and domain information |
|---|
| >PRK04019 rplP0 acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >TIGR03685 L21P_arch 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >cd05832 Ribosomal_L12p Ribosomal protein L12p | Back alignment and domain information |
|---|
| >cd05833 Ribosomal_P2 Ribosomal protein P2 | Back alignment and domain information |
|---|
| >PLN00138 large subunit ribosomal protein LP2; Provisional | Back alignment and domain information |
|---|
| >PTZ00373 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
| >PTZ00240 60S ribosomal protein P0; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| 3iz5_t | 110 | 60S acidic ribosomal protein P11 - P1 (L12P); euka | 99.95 | |
| 3izc_t | 106 | 60S acidic ribosomal protein RPP11 (P1); eukaryoti | 99.94 | |
| 3iz5_v | 113 | 60S acidic ribosomal protein P21 - P2 (L12P); euka | 99.94 | |
| 3izc_v | 106 | 60S acidic ribosomal protein (P2); eukaryotic ribo | 99.93 | |
| 2lbf_A | 69 | 60S acidic ribosomal protein P1; ribosome, stalk, | 99.22 | |
| 3iz5_s | 319 | 60S acidic ribosomal protein P0 (L10P); eukaryotic | 99.2 | |
| 2zkr_g | 317 | 60S acidic ribosomal protein P0; protein-RNA compl | 99.15 | |
| 3u5i_q | 312 | A0, L10E, 60S acidic ribosomal protein P0; transla | 99.12 | |
| 2lbf_B | 70 | 60S acidic ribosomal protein P2; ribosome, stalk, | 99.0 | |
| 3a1y_A | 58 | 50S ribosomal protein P1 (L12P); stalk, helix SPIN | 98.98 | |
| 3iz5_t | 110 | 60S acidic ribosomal protein P11 - P1 (L12P); euka | 96.97 | |
| 3izc_t | 106 | 60S acidic ribosomal protein RPP11 (P1); eukaryoti | 96.75 | |
| 3iz5_v | 113 | 60S acidic ribosomal protein P21 - P2 (L12P); euka | 95.4 | |
| 3izc_v | 106 | 60S acidic ribosomal protein (P2); eukaryotic ribo | 93.35 |
| >2lbf_A 60S acidic ribosomal protein P1; ribosome, stalk, P1/P2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2zkr_g 60S acidic ribosomal protein P0; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >3u5i_q A0, L10E, 60S acidic ribosomal protein P0; translation, ribosome, ribosomal R ribosomal protein, STM1; 3.00A {Saccharomyces cerevisiae} PDB: 4b6a_q 3izc_s 3izs_s 3j16_G* 3o5h_M 3jyw_8 | Back alignment and structure |
|---|
| >2lbf_B 60S acidic ribosomal protein P2; ribosome, stalk, P1/P2; NMR {Homo sapiens} PDB: 2w1o_A | Back alignment and structure |
|---|
| >3a1y_A 50S ribosomal protein P1 (L12P); stalk, helix SPIN, ribonucleoprotein; 2.13A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00