Citrus Sinensis ID: 044945
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| 449433569 | 705 | PREDICTED: putative pentatricopeptide re | 0.611 | 0.256 | 0.377 | 7e-35 | |
| 449508565 | 712 | PREDICTED: LOW QUALITY PROTEIN: putative | 0.611 | 0.254 | 0.377 | 2e-34 | |
| 307136183 | 773 | hypothetical protein [Cucumis melo subsp | 0.611 | 0.234 | 0.381 | 4e-34 | |
| 356511287 | 674 | PREDICTED: putative pentatricopeptide re | 0.672 | 0.295 | 0.348 | 7e-27 | |
| 297743485 | 605 | unnamed protein product [Vitis vinifera] | 0.787 | 0.385 | 0.312 | 5e-26 | |
| 296082479 | 590 | unnamed protein product [Vitis vinifera] | 0.672 | 0.337 | 0.323 | 2e-25 | |
| 449496903 | 583 | PREDICTED: pentatricopeptide repeat-cont | 0.618 | 0.313 | 0.352 | 7e-25 | |
| 296085848 | 644 | unnamed protein product [Vitis vinifera] | 0.358 | 0.164 | 0.607 | 1e-24 | |
| 359481040 | 709 | PREDICTED: putative pentatricopeptide re | 0.358 | 0.149 | 0.607 | 1e-24 | |
| 357521373 | 701 | Pentatricopeptide repeat-containing prot | 0.611 | 0.258 | 0.337 | 3e-24 |
| >gi|449433569|ref|XP_004134570.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 7e-35, Method: Compositional matrix adjust.
Identities = 97/257 (37%), Positives = 126/257 (49%), Gaps = 76/257 (29%)
Query: 109 SITAGCGQNGPFDEGLKFFGQML----MAKIKARHAPFSRI----------------MHA 148
++ C G DE K+F M +A +A S + MH
Sbjct: 439 AVLTACSHGGLVDEAWKYFNSMTRDFGIAPGVEHYAAVSDLLGRAGRLEEAYDFICGMHI 498
Query: 149 GSTENVWLTLLSACRVHRNVELAEKVADMILMIEPNNTGAYVILIN-------------- 194
G T ++W TLLSACRVH+N+++AEKVA+ IL ++PNNTGAY++L N
Sbjct: 499 GPTGSIWATLLSACRVHKNIDMAEKVANRILEVDPNNTGAYILLANIYSAARRWKEAAKW 558
Query: 195 -------------------------------------EALKDLLE----RMEQEGYVPDT 213
E +++ +E ME+EGYVPDT
Sbjct: 559 RASMRRIGIRKTPACSWIEVKNKVYAFMAGDESHPCYEKIREAMEVLVELMEKEGYVPDT 618
Query: 214 KEVLLDVEEEQKKNILYYHGERLALVFGIISTPDGTTIRVIKNLPSLRGLRHGNKVVSKI 273
EV DVEEEQKK ++ H ERLA+VFGII+TP G TIRV KNL K +SKI
Sbjct: 619 SEVHHDVEEEQKKYLVCSHSERLAIVFGIINTPAGMTIRVTKNLRVCTDCHTATKFISKI 678
Query: 274 VHREMIVRDNRRFCRHF 290
V RE++VRDN RF HF
Sbjct: 679 VGREIVVRDNSRF-HHF 694
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449508565|ref|XP_004163348.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g23330-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|307136183|gb|ADN34022.1| hypothetical protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|356511287|ref|XP_003524358.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297743485|emb|CBI36352.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296082479|emb|CBI21484.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449496903|ref|XP_004160258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296085848|emb|CBI31172.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359481040|ref|XP_002266469.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357521373|ref|XP_003630975.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524997|gb|AET05451.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| TAIR|locus:2154389 | 646 | LPA66 "LOW PSII ACCUMULATION 6 | 0.327 | 0.150 | 0.428 | 8.1e-29 | |
| TAIR|locus:2103483 | 890 | OTP84 "ORGANELLE TRANSCRIPT PR | 0.310 | 0.103 | 0.532 | 5.9e-28 | |
| TAIR|locus:2078653 | 825 | AT3G02010 [Arabidopsis thalian | 0.314 | 0.112 | 0.489 | 2.3e-27 | |
| TAIR|locus:2151501 | 697 | AT5G46460 [Arabidopsis thalian | 0.327 | 0.139 | 0.438 | 2.8e-26 | |
| TAIR|locus:2077878 | 685 | AT3G08820 "AT3G08820" [Arabido | 0.304 | 0.131 | 0.488 | 1.2e-25 | |
| TAIR|locus:2125899 | 990 | AT4G33170 [Arabidopsis thalian | 0.398 | 0.119 | 0.413 | 1.5e-25 | |
| TAIR|locus:2038603 | 868 | AT2G27610 "AT2G27610" [Arabido | 0.314 | 0.107 | 0.446 | 5e-25 | |
| TAIR|locus:2118964 | 823 | EMB2758 "embryo defective 2758 | 0.314 | 0.113 | 0.478 | 6.6e-25 | |
| TAIR|locus:2140235 | 781 | AT4G02750 [Arabidopsis thalian | 0.314 | 0.119 | 0.457 | 8.8e-25 | |
| TAIR|locus:2115130 | 691 | AT4G37170 "AT4G37170" [Arabido | 0.317 | 0.136 | 0.489 | 6.6e-24 |
| TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 219 (82.2 bits), Expect = 8.1e-29, Sum P(3) = 8.1e-29
Identities = 42/98 (42%), Positives = 64/98 (65%)
Query: 193 INEALKDLLERMEQEGYVPDTKEVLLDVEEEQKKNILYYHGERLALVFGIISTPDGTTIR 252
IN L ++ +++ GY P T +VLL++EEE K+N+L+YH E++A FG+IST G IR
Sbjct: 539 INSMLVEISDKLRLAGYRPITTQVLLNLEEEDKENVLHYHSEKIATAFGLISTSPGKPIR 598
Query: 253 VIKNLPSLRGLRHGNKVVSKIVHREMIVRDNRRFCRHF 290
++KNL K++SK+ R++ VRD +RF HF
Sbjct: 599 IVKNLRICEDCHSSIKLISKVYKRKITVRDRKRF-HHF 635
|
|
| TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151501 AT5G46460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077878 AT3G08820 "AT3G08820" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118964 EMB2758 "embryo defective 2758" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115130 AT4G37170 "AT4G37170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00023962001 | SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (628 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| PLN03081 | 697 | PLN03081, PLN03081, pentatricopeptide (PPR) repeat | 2e-26 | |
| PLN03077 | 857 | PLN03077, PLN03077, Protein ECB2; Provisional | 7e-18 | |
| pfam14432 | 116 | pfam14432, DYW_deaminase, DYW family of nucleic ac | 1e-08 |
| >gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
Score = 108 bits (271), Expect = 2e-26
Identities = 59/231 (25%), Positives = 97/231 (41%), Gaps = 72/231 (31%)
Query: 115 GQNGPFDEGLKFFGQMLMAKIKARHAPFSRIMHAGSTENVWLTLLSACRVHRNVELAEKV 174
G+ G DE R APF T N+W LL+ACR+H+N+EL
Sbjct: 473 GREGLLDEAYAMI----------RRAPFK------PTVNMWAALLTACRIHKNLELGRLA 516
Query: 175 ADMILMIEPNNTGAYVILIN---------------EALK--------------------- 198
A+ + + P YV+L+N E LK
Sbjct: 517 AEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHS 576
Query: 199 -------------------DLLERMEQEGYVPDTKEVLLDVEEEQKKNILYYHGERLALV 239
+L++ + + GYV + E+L DV+E+++K YH E+LA+
Sbjct: 577 FFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIA 636
Query: 240 FGIISTPDGTTIRVIKNLPSLRGLRHGNKVVSKIVHREMIVRDNRRFCRHF 290
FG+I+T + T +++ ++ + K ++ + RE++VRD RF HF
Sbjct: 637 FGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDASRF-HHF 686
|
Length = 697 |
| >gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 100.0 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 100.0 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 100.0 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 100.0 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 100.0 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 100.0 | |
| PF13041 | 50 | PPR_2: PPR repeat family | 99.6 | |
| PF14432 | 116 | DYW_deaminase: DYW family of nucleic acid deaminas | 99.17 | |
| PF12854 | 34 | PPR_1: PPR repeat | 99.16 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 99.12 | |
| PF13041 | 50 | PPR_2: PPR repeat family | 99.1 | |
| PF12854 | 34 | PPR_1: PPR repeat | 98.95 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 98.93 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.91 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.78 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 98.69 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 98.67 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.65 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.63 | |
| KOG4422 | 625 | consensus Uncharacterized conserved protein [Funct | 98.49 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 98.31 | |
| PF01535 | 31 | PPR: PPR repeat; InterPro: IPR002885 This entry re | 98.17 | |
| TIGR00756 | 35 | PPR pentatricopeptide repeat domain (PPR motif). T | 98.14 | |
| PF13812 | 34 | PPR_3: Pentatricopeptide repeat domain | 97.89 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.38 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.87 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.86 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.79 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 96.77 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.69 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.68 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.58 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.49 | |
| KOG4318 | 1088 | consensus Bicoid mRNA stability factor [RNA proces | 96.41 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 96.4 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 96.26 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 96.22 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.21 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.17 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 96.1 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.04 | |
| PF08579 | 120 | RPM2: Mitochondrial ribonuclease P subunit (RPM2); | 95.97 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 95.8 | |
| PF06239 | 228 | ECSIT: Evolutionarily conserved signalling interme | 95.52 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 95.42 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.4 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 95.37 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 95.33 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 95.29 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.22 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 95.11 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 95.02 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 94.83 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 94.63 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 94.39 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 94.29 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 94.26 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 94.18 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 94.0 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 93.91 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 93.79 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 93.67 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 93.49 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 93.37 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 93.2 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 93.18 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 93.11 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 93.01 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 92.89 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 92.72 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 92.5 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 92.42 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 92.31 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 92.3 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 92.24 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 92.15 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 92.09 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 91.92 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 91.83 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 91.33 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 91.11 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 90.87 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 90.86 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 90.51 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 90.32 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 90.28 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 89.48 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 89.06 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 88.76 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 88.57 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 88.47 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 88.04 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 87.98 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 87.82 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 87.73 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 87.63 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 87.41 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 87.36 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 87.2 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 87.13 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 86.59 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 86.11 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 86.09 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 86.07 | |
| KOG3941 | 406 | consensus Intermediate in Toll signal transduction | 85.86 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 85.54 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 85.42 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 84.97 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 84.73 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 84.37 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 84.34 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 84.28 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 84.0 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 83.93 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 83.66 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 83.28 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 82.45 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 82.32 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 82.11 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 82.1 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 81.98 | |
| PF12921 | 126 | ATP13: Mitochondrial ATPase expression; InterPro: | 81.47 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 81.12 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 80.87 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 80.4 |
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-45 Score=364.03 Aligned_cols=282 Identities=27% Similarity=0.443 Sum_probs=223.9
Q ss_pred ccCCCCeeehHHHHHhh---cccHHHHHHHHHHhHhcccCCCc--cccHHHHHhcCCCccCCceehhh----------hh
Q 044945 7 ILERNENVELSNGLAGC---NEFMDKANGITDRFEERAVSIGH--YADLDGISDQLPSSSGGRQVDIH----------FD 71 (296)
Q Consensus 7 ~~~~pd~vs~n~~~~~~---~~~~~~A~~~f~~M~~~~~~~g~--~~~~~~~~~~m~~~~~~~~~~~~----------~~ 71 (296)
.++.||++|||+++..+ |+ .++|.++|++|.+.|+.++. +......+...+.++.+.++|.. ..
T Consensus 284 ~m~~~~~vt~n~li~~y~~~g~-~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~ 362 (697)
T PLN03081 284 GMPEKTTVAWNSMLAGYALHGY-SEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVA 362 (697)
T ss_pred hCCCCChhHHHHHHHHHHhCCC-HHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCCCeee
Confidence 35678999999977766 65 99999999999988876443 23334445555555555555544 34
Q ss_pred cccccccccccCCH---HHHHhhcccCCcccCCCceeeHHHHHHHHhccCChhHHHHHHHHHHHcCCccChhhhhhhhcc
Q 044945 72 GGVDGLRPSRSGSV---RKVFEIMAVRDFLEYCDYAISRNSITAGCGQNGPFDEGLKFFGQMLMAKIKARHAPFSRIMHA 148 (296)
Q Consensus 72 ~~~~i~~y~k~g~~---~~~f~~M~~~~~~~~~p~~~t~n~li~~~~~~g~~~~A~~l~~~M~~~g~~pd~~ty~~li~~ 148 (296)
++.++++|+|+|++ .++|++|.++|+ +|||+||.||+++|+.++|+++|++|.+.|++||.+||+++|.+
T Consensus 363 ~~~Li~~y~k~G~~~~A~~vf~~m~~~d~-------~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a 435 (697)
T PLN03081 363 NTALVDLYSKWGRMEDARNVFDRMPRKNL-------ISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSA 435 (697)
T ss_pred hHHHHHHHHHCCCHHHHHHHHHhCCCCCe-------eeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHH
Confidence 57788999999999 999999988877 99999999999999999999999999999999999999999987
Q ss_pred -------------------------------------------------------CCCHHHHHHHHHHHHhcCCHHHHHH
Q 044945 149 -------------------------------------------------------GSTENVWLTLLSACRVHRNVELAEK 173 (296)
Q Consensus 149 -------------------------------------------------------~p~~~~~~~Li~~~~~~g~~~~A~~ 173 (296)
.||..+|++||++|+++|+++.|+.
T Consensus 436 ~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~ 515 (697)
T PLN03081 436 CRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRL 515 (697)
T ss_pred HhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHH
Confidence 4555555555555555555555555
Q ss_pred HHHHHHhcCCCCcchhHHh--------hHHHHHHHHHH------------------------------------------
Q 044945 174 VADMILMIEPNNTGAYVIL--------INEALKDLLER------------------------------------------ 203 (296)
Q Consensus 174 ~~~~m~~~~~~~~~~y~~l--------~~~~a~~l~~~------------------------------------------ 203 (296)
+++++.+.+|.+..+|+.| ++++|.+++++
T Consensus 516 ~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~~l~ 595 (697)
T PLN03081 516 AAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLD 595 (697)
T ss_pred HHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCCCccHHHHHHHHH
Confidence 5555555556666677776 34444444444
Q ss_pred -----HHhCCCcCCCccceeecchhhhhhhhhhhhHHHHHHHHhhcCCCCCeEEEEecccCccchhhHHHHHhhhhcceE
Q 044945 204 -----MEQEGYVPDTKEVLLDVEEEQKKNILYYHGERLALVFGIISTPDGTTIRVIKNLPSLRGLRHGNKVVSKIVHREM 278 (296)
Q Consensus 204 -----M~~~g~~p~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~~~k~g~~~~A~~~f~~m~~r~~ 278 (296)
|++.|+.||+...+++++..+++..+..|+++++++||++..+.+++++|++++..|||||.|.|+++.+..|.|
T Consensus 596 ~l~~~~~~~gy~~~~~~~~~~~~~~~~~~~~~~hsekla~a~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i 675 (697)
T PLN03081 596 ELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREI 675 (697)
T ss_pred HHHHHHHHcCCCCCcchhhccccHHHHHHHHHhccHHHHHHhhCccCCCCCeEEEecCCEECCCchhhHHHHhhhcceEE
Confidence 455555555555556666677778889999999999999999999999999999999999999999999999999
Q ss_pred EEecCCccchhccccccC
Q 044945 279 IVRDNRRFCRHFLLFRAC 296 (296)
Q Consensus 279 ~~~~~~~~~~~~~~~~~c 296 (296)
|+||.+|||||-++-++|
T Consensus 676 ~~rd~~rfh~f~~g~csc 693 (697)
T PLN03081 676 VVRDASRFHHFKLGKCSC 693 (697)
T ss_pred EEecCCccccCCCCcccc
Confidence 999999999999999999
|
|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
| >PF14432 DYW_deaminase: DYW family of nucleic acid deaminases | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13041 PPR_2: PPR repeat family | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG4422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat | Back alignment and domain information |
|---|
| >TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) | Back alignment and domain information |
|---|
| >PF13812 PPR_3: Pentatricopeptide repeat domain | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.93 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 99.93 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.81 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 99.76 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.57 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.53 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.77 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.64 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.5 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.25 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.25 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.08 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.06 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.06 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.04 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.99 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.95 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.91 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.89 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.86 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.84 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.84 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.82 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.82 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.81 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.74 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.72 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.65 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.65 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.64 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.62 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.59 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.57 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.54 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.52 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.51 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.49 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.42 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.39 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.34 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.28 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.24 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.23 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.19 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.18 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.14 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.06 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 96.97 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.93 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.88 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.87 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.81 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.8 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.79 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.78 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.72 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.72 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.69 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.69 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.66 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 96.64 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.62 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.6 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.57 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.54 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.51 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.48 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.47 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 96.43 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.43 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 96.35 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 96.34 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 96.34 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 96.34 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 96.28 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 96.21 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 96.18 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 96.17 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.11 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.1 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 96.05 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 95.89 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.88 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 95.81 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.78 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.77 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 95.72 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 95.68 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 95.63 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 95.58 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.53 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 95.52 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.48 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 95.43 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 95.38 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 95.36 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.28 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 95.27 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.27 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 95.21 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.15 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 95.15 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.14 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 95.03 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 95.02 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 95.02 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 95.01 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 95.0 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.98 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 94.42 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 94.41 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 94.33 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 94.17 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 94.16 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 94.14 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 94.13 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 94.11 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 93.93 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 93.92 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 93.81 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 93.8 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 93.7 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 93.69 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 93.48 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 93.43 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 93.35 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 93.01 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 92.96 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 92.94 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 92.86 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 92.86 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 92.84 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 92.6 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 92.38 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 92.34 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 92.29 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 92.01 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 91.88 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 91.27 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 90.8 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 90.75 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 90.59 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 90.38 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 90.31 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 90.29 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 89.48 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 89.33 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 89.32 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 89.13 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 88.89 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 88.87 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 88.79 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 88.33 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 88.27 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 88.11 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 88.0 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 87.99 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 87.87 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 87.79 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 87.62 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 86.68 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 86.59 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 86.41 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 85.66 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 85.08 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 85.08 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 84.67 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 84.1 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 83.64 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 83.45 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 83.16 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 82.84 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 82.84 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 82.32 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 81.68 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 81.45 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 81.32 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 81.08 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 80.86 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 80.82 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 80.54 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 80.18 |
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
Probab=99.93 E-value=1.7e-26 Score=218.88 Aligned_cols=168 Identities=13% Similarity=0.047 Sum_probs=144.5
Q ss_pred ehHHHHHhh---cccHHHHHHHHHHhHhcccCCCccccHHHHHhcCCCccCCceehhhhhcccccccccccCC-------
Q 044945 15 ELSNGLAGC---NEFMDKANGITDRFEERAVSIGHYADLDGISDQLPSSSGGRQVDIHFDGGVDGLRPSRSGS------- 84 (296)
Q Consensus 15 s~n~~~~~~---~~~~~~A~~~f~~M~~~~~~~g~~~~~~~~~~~m~~~~~~~~~~~~~~~~~~i~~y~k~g~------- 84 (296)
.++.+|..| |+ +++|.++|++|+++|+.+ + .++|+.+|++|++.+.
T Consensus 28 ~l~~~id~c~k~G~-~~~A~~lf~~M~~~Gv~p----d-------------------~~tyn~Li~~c~~~~~~~~~~~~ 83 (501)
T 4g26_A 28 LLKQKLDMCSKKGD-VLEALRLYDEARRNGVQL----S-------------------QYHYNVLLYVCSLAEAATESSPN 83 (501)
T ss_dssp HHHHHHHHTTTSCC-HHHHHHHHHHHHHHTCCC----C-------------------HHHHHHHHHHHTTCCCCSSSSCC
T ss_pred HHHHHHHHHHhCCC-HHHHHHHHHHHHHcCCCC----C-------------------HhHHHHHHHHHHhCCchhhhhhc
Confidence 456655544 76 999999999999987652 2 2345555666665544
Q ss_pred --H---HHHHhhcccCCcccCCCceeeHHHHHHHHhccCChhHHHHHHHHHHHcCCccChhhhhhhhccCCCHHHHHHHH
Q 044945 85 --V---RKVFEIMAVRDFLEYCDYAISRNSITAGCGQNGPFDEGLKFFGQMLMAKIKARHAPFSRIMHAGSTENVWLTLL 159 (296)
Q Consensus 85 --~---~~~f~~M~~~~~~~~~p~~~t~n~li~~~~~~g~~~~A~~l~~~M~~~g~~pd~~ty~~li~~~p~~~~~~~Li 159 (296)
+ .++|++|.+.|+ .||.+|||+||++|++.|++++|+++|++|.+.|+. ||..|||+||
T Consensus 84 ~~l~~A~~lf~~M~~~G~---~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~-------------Pd~~tyn~lI 147 (501)
T 4g26_A 84 PGLSRGFDIFKQMIVDKV---VPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQ-------------PRLRSYGPAL 147 (501)
T ss_dssp HHHHHHHHHHHHHHHTTC---CCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCC-------------CCHHHHHHHH
T ss_pred chHHHHHHHHHHHHHhCC---CCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCC-------------CccceehHHH
Confidence 4 789999999999 999999999999999999999999999999999994 7888899999
Q ss_pred HHHHhcCCHHHHHHHHHHHHhcC-CCCcchhHHh--------hHHHHHHHHHHHHhCCCcCCCccceeecch
Q 044945 160 SACRVHRNVELAEKVADMILMIE-PNNTGAYVIL--------INEALKDLLERMEQEGYVPDTKEVLLDVEE 222 (296)
Q Consensus 160 ~~~~~~g~~~~A~~~~~~m~~~~-~~~~~~y~~l--------~~~~a~~l~~~M~~~g~~p~~~t~~~~~~~ 222 (296)
.+|++.|++++|.++|++|.+.+ .||..+|++| ..++|.++|++|++.|..|+..|+......
T Consensus 148 ~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~ 219 (501)
T 4g26_A 148 FGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEW 219 (501)
T ss_dssp HHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHH
T ss_pred HHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHH
Confidence 99999999999999999999987 4799999999 789999999999999999999998665443
|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.51 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.24 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.19 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.56 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.54 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.52 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.43 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 96.23 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.19 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.06 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.75 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.71 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 95.43 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 95.27 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 95.19 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.07 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 95.04 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 94.5 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 94.41 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 94.05 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 93.98 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 93.71 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 93.65 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 93.53 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 93.48 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 93.47 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 93.39 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 92.46 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 91.7 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 91.56 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 91.51 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 91.46 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 91.41 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 91.01 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 90.41 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 90.0 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 86.26 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 84.9 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 82.53 |
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: O-GlcNAc transferase p110 subunit, OGT species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.51 E-value=0.00021 Score=60.46 Aligned_cols=83 Identities=7% Similarity=0.035 Sum_probs=56.0
Q ss_pred hhcccHHHHHHHHHHhHhcccCCCccccHHHHHhcCCCccCCceehhhhhcccccccccccCCH---HHHHhhcccCCcc
Q 044945 22 GCNEFMDKANGITDRFEERAVSIGHYADLDGISDQLPSSSGGRQVDIHFDGGVDGLRPSRSGSV---RKVFEIMAVRDFL 98 (296)
Q Consensus 22 ~~~~~~~~A~~~f~~M~~~~~~~g~~~~~~~~~~~m~~~~~~~~~~~~~~~~~~i~~y~k~g~~---~~~f~~M~~~~~~ 98 (296)
+.|+ +++|.+.|++..+... ... ++ +..+-..|.+.|++ ...|++..+.
T Consensus 11 ~~G~-~~~A~~~~~~~l~~~p--~~~-~~---------------------~~~la~~~~~~~~~~~A~~~~~~al~~--- 62 (388)
T d1w3ba_ 11 QAGD-FEAAERHCMQLWRQEP--DNT-GV---------------------LLLLSSIHFQCRRLDRSAHFSTLAIKQ--- 62 (388)
T ss_dssp HHTC-HHHHHHHHHHHHHHCT--TCH-HH---------------------HHHHHHHHHHTTCHHHHHHHHHHHHHH---
T ss_pred HcCC-HHHHHHHHHHHHHhCC--CCH-HH---------------------HHHHHHHHHHcCCHHHHHHHHHHHHHh---
Confidence 3466 9999999999877531 110 10 11123466777888 6677765543
Q ss_pred cCCC-ceeeHHHHHHHHhccCChhHHHHHHHHHHHcC
Q 044945 99 EYCD-YAISRNSITAGCGQNGPFDEGLKFFGQMLMAK 134 (296)
Q Consensus 99 ~~~p-~~~t~n~li~~~~~~g~~~~A~~l~~~M~~~g 134 (296)
.| +..+|..+...|.+.|+.++|.+.+....+..
T Consensus 63 --~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~ 97 (388)
T d1w3ba_ 63 --NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLK 97 (388)
T ss_dssp --CTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC
T ss_pred --CCCCHHHHHHHHHHhhhhccccccccccccccccc
Confidence 22 22678889999999999999999998887643
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|