Citrus Sinensis ID: 044973

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MEAVEGAGLAMQRTKEEGEEMMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQHHTKQ
ccccccccccccccHHHccccccccccEEEEEEcccHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHccccEEEEcccccccccHHccccHHHHHHccccccEEEEccccccccccc
ccHHHHHHHHHccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccHHHHccccccEEEEEcccccccccc
meavegagLAMQRTKEEGEEMMGKNEMKVMVALDESGESFYALKWALDNLFgitgavtpgtsdrgagTVTLVHvqqpfqhfvfpagpggaafyaTSSVEQSIRKAQEENSAALLSRALQICKDknvkaetlvltgdpkDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSdycahhvqcpiiivkpppkqhhtkq
meavegaglamqrtkeegeemmgkNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPiiivkpppkqhhtkq
MEAVEGAGLAMQRTkeegeemmgknemkvmvALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVfpagpggaafYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQHHTKQ
*****************************MVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYAT****************ALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIV***********
****************************VMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPII*************
********LAMQRTKEEGEEMMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKP*********
************************NEMKVMVALDESGESFYALKWALDNLFGITGAVT*****RGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPP********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAVEGAGLAMQRTKEEGEEMMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQHHTKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.771 0.868 0.323 2e-17
P74148154 Universal stress protein N/A no 0.532 0.681 0.349 1e-09
O07552166 Stress response protein N yes no 0.761 0.903 0.245 3e-08
P42297148 Universal stress protein no no 0.436 0.581 0.348 9e-08
Q57951170 Universal stress protein yes no 0.436 0.505 0.344 2e-07
P72745108 Universal stress protein N/A no 0.482 0.879 0.315 2e-07
A0QZA1 294 Universal stress protein yes no 0.695 0.465 0.275 7e-07
Q2FXL6166 Putative universal stress yes no 0.690 0.819 0.246 1e-05
Q6GFZ7166 Putative universal stress yes no 0.690 0.819 0.246 1e-05
Q5HF64166 Putative universal stress yes no 0.690 0.819 0.246 1e-05
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 88/176 (50%), Gaps = 24/176 (13%)

Query: 22  MGKNEMKVMVALDESGESFY---------ALKWALDNLFGITGAVTPGTSDRGAGTVTLV 72
           MG    KVMVA++ S    Y         A +W L+ +      V   TSD     + L+
Sbjct: 1   MGSEPTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKI------VRSNTSD---FKILLL 51

Query: 73  HVQQPFQHFVFPAGPGGA-AFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETL 131
           HVQ      V   G     + YA+    + +R++ +     LL   +  C +  V  E  
Sbjct: 52  HVQ-----VVDEDGFDDVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAW 106

Query: 132 VLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVK 187
           + TGDPKD+ICQ  +++  D LVVGSRGLG+ ++  +G+VS +C  H +CP++ +K
Sbjct: 107 IKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIK 162

Arabidopsis thaliana (taxid: 3702)
>sp|P74148|Y1388_SYNY3 Universal stress protein Sll1388 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1388 PE=3 SV=1 Back     alignment and function description
>sp|O07552|NHAX_BACSU Stress response protein NhaX OS=Bacillus subtilis (strain 168) GN=nhaX PE=2 SV=2 Back     alignment and function description
>sp|P42297|YXIE_BACSU Universal stress protein YxiE OS=Bacillus subtilis (strain 168) GN=yxiE PE=3 SV=1 Back     alignment and function description
>sp|Q57951|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1 Back     alignment and function description
>sp|P72745|Y1101_SYNY3 Universal stress protein Slr1101 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1101 PE=3 SV=1 Back     alignment and function description
>sp|A0QZA1|Y3950_MYCS2 Universal stress protein MSMEG_3950/MSMEI_3859 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_3950 PE=1 SV=1 Back     alignment and function description
>sp|Q2FXL6|Y1819_STAA8 Putative universal stress protein SAOUHSC_01819 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01819 PE=3 SV=1 Back     alignment and function description
>sp|Q6GFZ7|Y1788_STAAR Putative universal stress protein SAR1788 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1788 PE=3 SV=1 Back     alignment and function description
>sp|Q5HF64|Y1759_STAAC Putative universal stress protein SACOL1759 OS=Staphylococcus aureus (strain COL) GN=SACOL1759 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
224139952180 predicted protein [Populus trichocarpa] 0.817 0.894 0.707 3e-63
359481111203 PREDICTED: universal stress protein A-li 0.934 0.906 0.601 1e-61
224088144172 predicted protein [Populus trichocarpa] 0.802 0.918 0.697 6e-59
18399413199 adenine nucleotide alpha hydrolases-like 0.812 0.804 0.613 4e-56
30681955200 adenine nucleotide alpha hydrolases-like 0.812 0.8 0.615 3e-55
79313191201 adenine nucleotide alpha hydrolases-like 0.812 0.796 0.612 3e-55
297829748200 universal stress protein family protein 0.939 0.925 0.566 5e-55
21594903199 ethylene-responsive protein, putative [A 0.812 0.804 0.607 9e-55
356500401191 PREDICTED: universal stress protein A-li 0.868 0.895 0.589 6e-54
30681959226 adenine nucleotide alpha hydrolases-like 0.812 0.707 0.531 1e-50
>gi|224139952|ref|XP_002323356.1| predicted protein [Populus trichocarpa] gi|222867986|gb|EEF05117.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 116/164 (70%), Positives = 137/164 (83%), Gaps = 3/164 (1%)

Query: 27  MKVMVALDESGESFYALKWALDNLF-GITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPA 85
           M++MVA+DES  SFYALKWALD+L  GIT    P  S   +  +TLVHVQQPFQH+V PA
Sbjct: 1   MRIMVAIDESDGSFYALKWALDHLVDGITPTNVP--SQEESSLITLVHVQQPFQHYVIPA 58

Query: 86  GPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAA 145
           GPGGAAFYAT S+ +S+R+AQ EN AALLSRALQ+CKDK +KAE+L+L G+PKD ICQA 
Sbjct: 59  GPGGAAFYATPSIVESVREAQAENDAALLSRALQMCKDKMIKAESLILEGEPKDKICQAT 118

Query: 146 EQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPP 189
           EQM +DLLV+GSRGLGKIKRA LGSVSDYCAHH +CP++IVKPP
Sbjct: 119 EQMQVDLLVLGSRGLGKIKRAFLGSVSDYCAHHAKCPVLIVKPP 162

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359481111|ref|XP_002266746.2| PREDICTED: universal stress protein A-like protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|224088144|ref|XP_002308342.1| predicted protein [Populus trichocarpa] gi|222854318|gb|EEE91865.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18399413|ref|NP_566406.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|332641598|gb|AEE75119.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30681955|ref|NP_850562.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|6671949|gb|AAF23209.1|AC016795_22 unknown protein [Arabidopsis thaliana] gi|13926250|gb|AAK49598.1|AF372882_1 MEC18.3/MEC18.3 [Arabidopsis thaliana] gi|16226626|gb|AAL16217.1|AF428448_1 At3g11930/MEC18.3 [Arabidopsis thaliana] gi|10998131|dbj|BAB03102.1| unnamed protein product [Arabidopsis thaliana] gi|15215662|gb|AAK91376.1| MEC18.3/MEC18.3 [Arabidopsis thaliana] gi|16323234|gb|AAL15351.1| AT3g11930/MEC18.3 [Arabidopsis thaliana] gi|332641600|gb|AEE75121.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79313191|ref|NP_001030675.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|332641601|gb|AEE75122.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297829748|ref|XP_002882756.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297328596|gb|EFH59015.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21594903|gb|AAM66054.1| ethylene-responsive protein, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356500401|ref|XP_003519020.1| PREDICTED: universal stress protein A-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|30681959|ref|NP_850563.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|222423541|dbj|BAH19740.1| AT3G11930 [Arabidopsis thaliana] gi|332641599|gb|AEE75120.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.670 0.584 0.522 1.1e-44
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.791 0.764 0.550 6.6e-42
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.751 0.865 0.395 5.3e-24
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.725 0.882 0.354 1.9e-19
TAIR|locus:2043273162 AT2G47710 "AT2G47710" [Arabido 0.730 0.888 0.329 1.7e-18
TAIR|locus:2084153175 AT3G01520 "AT3G01520" [Arabido 0.675 0.76 0.315 1.3e-15
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.710 0.875 0.333 1.6e-15
TAIR|locus:2086102163 AT3G17020 "AT3G17020" [Arabido 0.335 0.404 0.424 5.7e-15
TAIR|locus:2222687175 AT5G14680 "AT5G14680" [Arabido 0.482 0.542 0.347 4.9e-14
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.736 0.599 0.295 1.9e-12
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 365 (133.5 bits), Expect = 1.1e-44, Sum P(2) = 1.1e-44
 Identities = 71/136 (52%), Positives = 98/136 (72%)

Query:    32 ALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVXXXXX--XX 89
             A+DES  SFYAL+W +D+   +   +T   ++  +G +T++HVQ PF HF          
Sbjct:    38 AIDESDSSFYALQWVIDHFSNLL--LTTAAAEAESGMLTVIHVQSPFNHFAAFPAGPGGA 95

Query:    90 XXXYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMH 149
                YA+SS+ +S++KAQ+E SAALLSRALQ+C+ K ++ ETLVL G+ K+MIC+A E+MH
Sbjct:    96 TAVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGEAKEMICEAVEKMH 155

Query:   150 MDLLVVGSRGLGKIKR 165
             +DLLVVGSRGLGKIKR
Sbjct:   156 VDLLVVGSRGLGKIKR 171
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0002238 "response to molecule of fungal origin" evidence=RCA
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043273 AT2G47710 "AT2G47710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084153 AT3G01520 "AT3G01520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2222687 AT5G14680 "AT5G14680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XVI.2023.1
hypothetical protein (166 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 2e-32
pfam00582139 pfam00582, Usp, Universal stress protein family 2e-28
COG0589154 COG0589, UspA, Universal stress protein UspA and r 1e-19
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 3e-12
PRK15005144 PRK15005, PRK15005, universal stress protein F; Pr 7e-05
cd01988132 cd01988, Na_H_Antiporter_C, The C-terminal domain 7e-04
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score =  113 bits (284), Expect = 2e-32
 Identities = 50/159 (31%), Positives = 76/159 (47%), Gaps = 29/159 (18%)

Query: 28  KVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGP 87
           +++VA+D S ES  AL+WA                 R    + L+HV  P          
Sbjct: 1   RILVAVDGSEESERALRWAARLA------------RRLGAELVLLHVVDPPPSSAAE--- 45

Query: 88  GGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQ 147
                         + +  EE + ALL    +   +  VK ET+VL GDP + I +AAE+
Sbjct: 46  --------------LAELLEEEARALLEALREALAEAGVKVETVVLEGDPAEAILEAAEE 91

Query: 148 MHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIV 186
           +  DL+V+GSRG   ++R LLGSV++    H  CP+++V
Sbjct: 92  LGADLIVMGSRGRSGLRRLLLGSVAERVLRHAPCPVLVV 130

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>gnl|CDD|184967 PRK15005, PRK15005, universal stress protein F; Provisional Back     alignment and domain information
>gnl|CDD|238946 cd01988, Na_H_Antiporter_C, The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
PRK15456142 universal stress protein UspG; Provisional 99.93
PRK15005144 universal stress protein F; Provisional 99.93
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.93
PRK09982142 universal stress protein UspD; Provisional 99.92
PRK15118144 universal stress global response regulator UspA; P 99.91
PRK10116142 universal stress protein UspC; Provisional 99.89
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.89
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.89
PRK11175 305 universal stress protein UspE; Provisional 99.89
cd01987124 USP_OKCHK USP domain is located between the N-term 99.86
PRK11175305 universal stress protein UspE; Provisional 99.83
cd00293130 USP_Like Usp: Universal stress protein family. The 99.82
COG0589154 UspA Universal stress protein UspA and related nuc 99.8
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.58
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.35
PRK10490 895 sensor protein KdpD; Provisional 99.32
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.33
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.56
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.06
PLN03159832 cation/H(+) antiporter 15; Provisional 96.48
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 96.39
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 96.3
PRK12342 254 hypothetical protein; Provisional 95.26
PRK03359256 putative electron transfer flavoprotein FixA; Revi 94.68
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 94.23
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 94.23
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 93.85
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 93.37
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 93.07
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 93.01
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 92.79
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 91.64
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 91.63
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 89.12
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 89.06
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 88.4
PRK10867 433 signal recognition particle protein; Provisional 88.3
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 88.02
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 87.61
PRK13820 394 argininosuccinate synthase; Provisional 87.53
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 86.71
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 86.48
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 86.09
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 86.05
cd01713173 PAPS_reductase This domain is found in phosphoaden 84.75
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 84.12
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 83.95
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 82.28
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 82.11
TIGR00959 428 ffh signal recognition particle protein. This mode 81.9
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 81.35
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 80.91
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.93  E-value=6.6e-25  Score=163.15  Aligned_cols=139  Identities=19%  Similarity=0.235  Sum_probs=112.1

Q ss_pred             CCEEEEEeCCCh--hhHHHHHHHHHHhccccCCCCCCCCCCCCCEEEEEEeeCCCCCccccCCCCCCccccCchhHHHHH
Q 044973           26 EMKVMVALDESG--ESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIR  103 (197)
Q Consensus        26 ~~~ILv~~d~s~--~s~~al~~a~~la~~~~~~~~~~~~~~~~~~l~lv~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  103 (197)
                      |+|||||+|+|+  .+..|+++|..+|+.            . ++++++||+++........  .       ....+...
T Consensus         2 ~~~ILv~vD~S~~~~s~~al~~A~~la~~------------~-~~l~llhv~~~~~~~~~~~--~-------~~~~~~~~   59 (142)
T PRK15456          2 YKTIIMPVDVFEMELSDKAVRHAEFLAQD------------D-GVIHLLHVLPGSASLSLHR--F-------AADVRRFE   59 (142)
T ss_pred             CccEEEeccCCchhHHHHHHHHHHHHHhc------------C-CeEEEEEEecCcccccccc--c-------ccchhhHH
Confidence            489999999994  899999999999987            6 5899999998753211100  0       01112344


Q ss_pred             HHHHHHHHHHHHHHHHHHhhcCCceEEEEecCChHHHHHHHHHHcCCCEEEEecCCCCcccccccccHHHHHHhhCCCCE
Q 044973          104 KAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPI  183 (197)
Q Consensus       104 ~~~~~~~~~~l~~~~~~~~~~gi~~~~~v~~g~~~~~I~~~a~~~~~dliViG~~~~~~~~~~~~gs~~~~il~~~~~pV  183 (197)
                      +...+..++.++++.+.+...++++++++..|++.+.|++++++.++||||||+++++ +.++++||++++++++++|||
T Consensus        60 ~~~~~~~~~~l~~~~~~~~~~~~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~~~a~~pV  138 (142)
T PRK15456         60 EHLQHEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVIRHANLPV  138 (142)
T ss_pred             HHHHHHHHHHHHHHHHHhCCCCcceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHHHcCCCCE
Confidence            5556666777777777766667889999999999999999999999999999999976 777899999999999999999


Q ss_pred             EEEC
Q 044973          184 IIVK  187 (197)
Q Consensus       184 lvv~  187 (197)
                      |+||
T Consensus       139 LvV~  142 (142)
T PRK15456        139 LVVR  142 (142)
T ss_pred             EEeC
Confidence            9996

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 4e-16
1wjg_A137 Crystal Structure Of A Probable Atp Binding Protein 7e-07
3loq_A 294 The Crystal Structure Of A Universal Stress Protein 7e-05
1mjh_A162 Structure-Based Assignment Of The Biochemical Funct 1e-04
2pfs_A150 Crystal Structure Of Universal Stress Protein From 2e-04
3tnj_A150 Crystal Structure Of Universal Stress Protein From 3e-04
3hgm_A147 Universal Stress Protein Tead From The Trap Transpo 3e-04
2dum_A170 Crystal Structure Of Hypothetical Protein, Ph0823 L 4e-04
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 73/146 (50%), Gaps = 13/146 (8%)
Query: 42  ALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVXXXXXXXXXXYATSSVEQS 101
           A +W L+ +      V   TSD     + L+HVQ   +             YA+    + 
Sbjct: 30  AFEWTLEKI------VRSNTSD---FKILLLHVQVVDED----GFDDVDSIYASPEDFRD 76
Query: 102 IRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLG 161
            R++ +     LL   +  C +  V  E  + TGDPKD+ICQ  +++  D LVVGSRGLG
Sbjct: 77  XRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLG 136
Query: 162 KIKRALLGSVSDYCAHHVQCPIIIVK 187
           + ++  +G+VS +C  H +CP+  +K
Sbjct: 137 RFQKVFVGTVSAFCVKHAECPVXTIK 162
>pdb|1WJG|A Chain A, Crystal Structure Of A Probable Atp Binding Protein From Thermus Themophilus Hb8 Length = 137 Back     alignment and structure
>pdb|3LOQ|A Chain A, The Crystal Structure Of A Universal Stress Protein From Archaeoglobus Fulgidus Dsm 4304 Length = 294 Back     alignment and structure
>pdb|1MJH|A Chain A, Structure-Based Assignment Of The Biochemical Function Of Hypothetical Protein Mj0577: A Test Case Of Structural Genomics Length = 162 Back     alignment and structure
>pdb|2PFS|A Chain A, Crystal Structure Of Universal Stress Protein From Nitrosomonas Europaea Length = 150 Back     alignment and structure
>pdb|3TNJ|A Chain A, Crystal Structure Of Universal Stress Protein From Nitrosomonas Europaea With Amp Bound Length = 150 Back     alignment and structure
>pdb|3HGM|A Chain A, Universal Stress Protein Tead From The Trap Transporter Teaabc Of Halomonas Elongata Length = 147 Back     alignment and structure
>pdb|2DUM|A Chain A, Crystal Structure Of Hypothetical Protein, Ph0823 Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 1e-48
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 2e-40
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 3e-32
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 7e-32
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 4e-29
2z08_A137 Universal stress protein family; uncharacterized c 6e-29
3s3t_A146 Nucleotide-binding protein, universal stress PROT 2e-28
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 3e-27
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 3e-26
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 8e-14
3tnj_A150 Universal stress protein (USP); structural genomic 7e-26
3fdx_A143 Putative filament protein / universal stress PROT; 2e-25
3fg9_A156 Protein of universal stress protein USPA family; A 8e-25
3loq_A 294 Universal stress protein; structural genomics, PSI 7e-24
3loq_A294 Universal stress protein; structural genomics, PSI 2e-21
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 2e-23
3dlo_A155 Universal stress protein; unknown function, struct 1e-21
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 4e-21
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 1e-19
3olq_A 319 Universal stress protein E; structural genomics, P 2e-18
3olq_A319 Universal stress protein E; structural genomics, P 5e-18
3mt0_A290 Uncharacterized protein PA1789; structural genomic 6e-15
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 3e-12
1q77_A138 Hypothetical protein AQ_178; structural genomics, 4e-06
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  155 bits (393), Expect = 1e-48
 Identities = 53/174 (30%), Positives = 85/174 (48%), Gaps = 22/174 (12%)

Query: 28  KVMVALDESGESFY---------ALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPF 78
           KVMVA++ S    Y         A +W L+        V   TSD     + L+HVQ   
Sbjct: 7   KVMVAVNASTIKDYPNPSISCKRAFEWTLEK------IVRSNTSD---FKILLLHVQVVD 57

Query: 79  QHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPK 138
           +           + YA+    + +R++ +     LL   +  C +  V  E  + TGDPK
Sbjct: 58  E----DGFDDVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPK 113

Query: 139 DMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQ 192
           D+ICQ  +++  D LVVGSRGLG+ ++  +G+VS +C  H +CP++ +K    +
Sbjct: 114 DVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADE 167
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.95
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.95
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.94
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.94
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.94
3fg9_A156 Protein of universal stress protein USPA family; A 99.93
3tnj_A150 Universal stress protein (USP); structural genomic 99.93
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.92
3dlo_A155 Universal stress protein; unknown function, struct 99.92
2z08_A137 Universal stress protein family; uncharacterized c 99.92
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.92
3fdx_A143 Putative filament protein / universal stress PROT; 99.91
3olq_A 319 Universal stress protein E; structural genomics, P 99.9
3loq_A 294 Universal stress protein; structural genomics, PSI 99.89
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.88
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.88
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.88
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.86
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.86
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.86
3loq_A294 Universal stress protein; structural genomics, PSI 99.85
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.85
3olq_A319 Universal stress protein E; structural genomics, P 99.85
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.78
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 97.06
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 94.68
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 94.6
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 93.28
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 92.37
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 91.99
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 91.93
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 90.82
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 90.76
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 90.46
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 90.38
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 90.06
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 90.05
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 90.03
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 90.02
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 89.72
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 89.51
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 89.4
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 89.35
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 88.76
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 88.17
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 85.65
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 83.56
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 82.21
1efv_B255 Electron transfer flavoprotein; electron transport 82.13
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 80.93
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 80.48
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 80.1
2j07_A 420 Deoxyribodipyrimidine photo-lyase; flavoprotein, n 80.09
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.95  E-value=2.4e-26  Score=169.32  Aligned_cols=139  Identities=20%  Similarity=0.307  Sum_probs=122.8

Q ss_pred             CEEEEEeCCChhhHHHHHHHHHHhccccCCCCCCCCCCCCCEEEEEEeeCCCCCccccCCCCCCccccCchhHHHHHHHH
Q 044973           27 MKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPGGAAFYATSSVEQSIRKAQ  106 (197)
Q Consensus        27 ~~ILv~~d~s~~s~~al~~a~~la~~~~~~~~~~~~~~~~~~l~lv~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  106 (197)
                      ++||||+|+|+.+..++++|+.+|+.            .+++|+++||.++.......          .........+..
T Consensus         6 ~~ILv~~D~s~~s~~al~~A~~la~~------------~~a~l~ll~v~~~~~~~~~~----------~~~~~~~~~~~~   63 (146)
T 3s3t_A            6 TNILVPVDSSDAAQAAFTEAVNIAQR------------HQANLTALYVVDDSAYHTPA----------LDPVLSELLDAE   63 (146)
T ss_dssp             CEEEEECCSSHHHHHHHHHHHHHHHH------------HTCEEEEEEEEECCCCCCGG----------GHHHHHHHHHHH
T ss_pred             ceEEEEcCCCHHHHHHHHHHHHHHHh------------cCCEEEEEEEecCccccccc----------cccccHHHHHHH
Confidence            89999999999999999999999999            89999999999875432111          011345556677


Q ss_pred             HHHHHHHHHHHHHHHhhcCC-ceEEEEecCChHHHHHH-HHHHcCCCEEEEecCCCCcccccccccHHHHHHhhCCCCEE
Q 044973          107 EENSAALLSRALQICKDKNV-KAETLVLTGDPKDMICQ-AAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPII  184 (197)
Q Consensus       107 ~~~~~~~l~~~~~~~~~~gi-~~~~~v~~g~~~~~I~~-~a~~~~~dliViG~~~~~~~~~~~~gs~~~~il~~~~~pVl  184 (197)
                      .+..++.++++.+.+.+.|+ ++++.+..|++.+.|++ +|++.++||||||+++++.+.++++||++++++++++||||
T Consensus        64 ~~~~~~~l~~~~~~~~~~g~~~~~~~~~~g~~~~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs~~~~vl~~~~~pVl  143 (146)
T 3s3t_A           64 AAHAKDAMRQRQQFVATTSAPNLKTEISYGIPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVI  143 (146)
T ss_dssp             HHHHHHHHHHHHHHHTTSSCCCCEEEEEEECHHHHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCHHHHHHHHHCSSEEE
T ss_pred             HHHHHHHHHHHHHHHHhcCCcceEEEEecCChHHHHHHHHHhhcCCCEEEECCCCCCCcceEEEcchHHHHhccCCCCEE
Confidence            78888899999999999999 99999999999999999 99999999999999999999999999999999999999999


Q ss_pred             EEC
Q 044973          185 IVK  187 (197)
Q Consensus       185 vv~  187 (197)
                      +||
T Consensus       144 vV~  146 (146)
T 3s3t_A          144 VIR  146 (146)
T ss_dssp             EEC
T ss_pred             EeC
Confidence            997
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 8e-32
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 5e-25
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 2e-20
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 9e-20
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 1e-13
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 2e-08
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  111 bits (277), Expect = 8e-32
 Identities = 53/174 (30%), Positives = 84/174 (48%), Gaps = 22/174 (12%)

Query: 28  KVMVALDESGESFY---------ALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPF 78
           KVMVA++ S    Y         A +W L+        V   TSD     + L+HVQ   
Sbjct: 3   KVMVAVNASTIKDYPNPSISCKRAFEWTLEK------IVRSNTSDF---KILLLHVQVVD 53

Query: 79  QHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPK 138
           +             YA+    + +R++ +     LL   +  C +  V  E  + TGDPK
Sbjct: 54  EDGFDDVDS----IYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPK 109

Query: 139 DMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCAHHVQCPIIIVKPPPKQ 192
           D+ICQ  +++  D LVVGSRGLG+ ++  +G+VS +C  H +CP++ +K    +
Sbjct: 110 DVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADE 163
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.97
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.94
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.93
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.93
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.89
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.87
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 96.27
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 94.06
d1efpb_246 Small, beta subunit of electron transfer flavoprot 93.88
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 93.17
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 92.76
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 92.34
d1efvb_252 Small, beta subunit of electron transfer flavoprot 92.01
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 91.83
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 91.76
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.29
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 90.88
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 90.27
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 88.38
d3clsd1192 Large, alpha subunit of electron transfer flavopro 86.09
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 85.32
d1ls1a2207 GTPase domain of the signal sequence recognition p 83.11
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 83.07
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.97  E-value=3.4e-29  Score=186.28  Aligned_cols=155  Identities=22%  Similarity=0.247  Sum_probs=129.1

Q ss_pred             hccCCCCEEEEEeCCChhhHHHHHHHHHHhccccCCCCCCCCCCCCCEEEEEEeeCCCCCccccCCCC----CCccccCc
Q 044973           21 MMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDRGAGTVTLVHVQQPFQHFVFPAGPG----GAAFYATS   96 (197)
Q Consensus        21 ~m~~~~~~ILv~~d~s~~s~~al~~a~~la~~~~~~~~~~~~~~~~~~l~lv~V~~~~~~~~~~~~~~----~~~~~~~~   96 (197)
                      ||+   +|||||+|+|+.+.+++++|..+|+.            .+++|+++||.++...........    ........
T Consensus         1 ~m~---~~ILvavD~s~~s~~al~~a~~la~~------------~~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~   65 (160)
T d1mjha_           1 VMY---KKILYPTDFSETAEIALKHVKAFKTL------------KAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVE   65 (160)
T ss_dssp             CCC---CEEEEECCSCHHHHHHHHHHHHTCCS------------SCCEEEEEEEEEGGGTC-----------------CH
T ss_pred             CCc---CeEEEEECCCHHHHHHHHHHHHHHHh------------cCCEEEEEEecccccccccccccccccccccchhHH
Confidence            466   99999999999999999999999999            899999999987755332211111    11222334


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHhhcCCceEEEEecCChHHHHHHHHHHcCCCEEEEecCCCCcccccccccHHHHHH
Q 044973           97 SVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMICQAAEQMHMDLLVVGSRGLGKIKRALLGSVSDYCA  176 (197)
Q Consensus        97 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~gi~~~~~v~~g~~~~~I~~~a~~~~~dliViG~~~~~~~~~~~~gs~~~~il  176 (197)
                      +......+...+++++.++.+...+...|+++++++..|++.+.|+++|++.++||||||+++++.+.++++||++++|+
T Consensus        66 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl  145 (160)
T d1mjha_          66 EFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVI  145 (160)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHH
Confidence            44556667778888899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCCCCEEEECCCC
Q 044973          177 HHVQCPIIIVKPPP  190 (197)
Q Consensus       177 ~~~~~pVlvv~~~~  190 (197)
                      ++++|||||||++.
T Consensus       146 ~~s~~pVlvV~~~~  159 (160)
T d1mjha_         146 KKSNKPVLVVKRKN  159 (160)
T ss_dssp             HHCCSCEEEECCCC
T ss_pred             hcCCCCEEEEcCCC
Confidence            99999999999874
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure