Citrus Sinensis ID: 045047

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MESPQSVVSIFKSLLLLSLRSINLISLLPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRYASDELQLMKAKPKKRKQCGSTIWKQLKIS
cccccEEEEEccccEEEEEEcccccccccccEEEEEEEEEEccccccccccccccEEEEEEEcccccEEEEEEccccccccccccEEEEEEEcccccEEEEEEEEEEccccccccccEEEEEEcccEEEcccEEEEEEEEEcccccccccEEEEEEEEEEEccccccccccccccccccccHHHcccc
ccccccEEcccccEEEEEcccccccccccEEEEEEEEEEEccccccEEEEccccEEEEEEEccccccccccEEccccccccccccccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcEccHHHHHHccccEEEEccccccccccccccEEEEEEEEccccccEEEccccccccccEEEEEEEEcc
MESPQSVVSIFKSLLLLSLRSINLISLLPLASVFLKFIYIARDIHDIGVYHKQDVYATLcltsdpentvTTKIIYaggsnpvfnesrqlkvktvdsslkseiFTVSRIKSFVEDQLLGFTLVPLSEVllnngkldtefslsstdflhspagfVQLSLRYASDELQLmkakpkkrkqcgsTIWKQLKIS
MESPQSVVSIFKSLLLLSLRSINLISLLPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAggsnpvfnesrqlkvktvdsslkseifTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRYASDELQlmkakpkkrkqcgstiwkqlkis
MESPQSVVsifksllllslrsinlisllplASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRYASDELQLMKAKPKKRKQCGSTIWKQLKIS
******VVSIFKSLLLLSLRSINLISLLPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRYAS***************************
******************************ASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLS********AGFVQLSLRY**********************W*QLK**
********SIFKSLLLLSLRSINLISLLPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRYASDELQLM*********************
*****SVVSIFKSLLLLSLRSINLISLLPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRYASDELQLMKAKPKKRKQCGSTIWKQLKIS
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESPQSVVSIFKSLLLLSLRSINLISLLPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRYASDELQLMKAKPKKRKQCGSTIWKQLKIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
255576298 429 conserved hypothetical protein [Ricinus 0.952 0.417 0.544 2e-50
225460783 437 PREDICTED: uncharacterized protein LOC10 0.909 0.391 0.545 4e-48
297852756 672 hypothetical protein ARALYDRAFT_314445 [ 0.888 0.248 0.574 5e-48
224116570 432 predicted protein [Populus trichocarpa] 0.909 0.395 0.540 6e-48
147783403 776 hypothetical protein VITISV_003516 [Viti 0.718 0.173 0.678 1e-47
224056427 432 predicted protein [Populus trichocarpa] 0.909 0.395 0.540 2e-47
18403117 388 calcium-dependent lipid-binding domain-c 0.888 0.430 0.551 2e-47
21593485 388 unknown [Arabidopsis thaliana] 0.888 0.430 0.551 3e-47
12322326 675 unknown protein [Arabidopsis thaliana] 0.888 0.247 0.551 4e-47
356566596 428 PREDICTED: uncharacterized protein LOC10 0.920 0.404 0.505 2e-46
>gi|255576298|ref|XP_002529042.1| conserved hypothetical protein [Ricinus communis] gi|223531522|gb|EEF33353.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 141/204 (69%), Gaps = 25/204 (12%)

Query: 1   MESPQSVVSIFKSLLLL------SLRSI-NLISLLPLASVFLK----------------F 37
           M+SPQSVVS FK+ ++L      S  S+ NL+ L     V  K                +
Sbjct: 1   MDSPQSVVSPFKTSVVLEPEKQNSDHSVRNLVKLSKGVEVQRKEAMVGNPEDYIGILEVY 60

Query: 38  IYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSS 97
           I+ ARDIH+I +YHKQDVYA +CLTSDPENTV+TKII  GG NPVFN++ +L VKTV+SS
Sbjct: 61  IHQARDIHNICIYHKQDVYAKICLTSDPENTVSTKIINGGGRNPVFNDNLRLNVKTVESS 120

Query: 98  LKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSL 157
           LK EIF +SR+++++EDQLLGF LVPLSEV++ NGKL+ EFSLSSTD  HSPAGFVQLSL
Sbjct: 121 LKCEIFMMSRVRNYLEDQLLGFALVPLSEVVIKNGKLEKEFSLSSTDLFHSPAGFVQLSL 180

Query: 158 RY--ASDELQLMKAKPKKRKQCGS 179
            Y  +S E+  + A P  +   G+
Sbjct: 181 SYIGSSPEVMAIPAMPTAQATDGT 204

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225460783|ref|XP_002274753.1| PREDICTED: uncharacterized protein LOC100262283 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297852756|ref|XP_002894259.1| hypothetical protein ARALYDRAFT_314445 [Arabidopsis lyrata subsp. lyrata] gi|297340101|gb|EFH70518.1| hypothetical protein ARALYDRAFT_314445 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224116570|ref|XP_002317334.1| predicted protein [Populus trichocarpa] gi|222860399|gb|EEE97946.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147783403|emb|CAN75215.1| hypothetical protein VITISV_003516 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224056427|ref|XP_002298851.1| predicted protein [Populus trichocarpa] gi|222846109|gb|EEE83656.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18403117|ref|NP_564576.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|79319640|ref|NP_001031166.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|9454555|gb|AAF87878.1|AC012561_11 Unknown protein [Arabidopsis thaliana] gi|110737835|dbj|BAF00856.1| hypothetical protein [Arabidopsis thaliana] gi|115311401|gb|ABI93881.1| At1g50570 [Arabidopsis thaliana] gi|332194442|gb|AEE32563.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|332194443|gb|AEE32564.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21593485|gb|AAM65452.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12322326|gb|AAG51182.1|AC079279_3 unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356566596|ref|XP_003551516.1| PREDICTED: uncharacterized protein LOC100796499 isoform 1 [Glycine max] gi|356566598|ref|XP_003551517.1| PREDICTED: uncharacterized protein LOC100796499 isoform 2 [Glycine max] gi|356566600|ref|XP_003551518.1| PREDICTED: uncharacterized protein LOC100796499 isoform 3 [Glycine max] gi|356566602|ref|XP_003551519.1| PREDICTED: uncharacterized protein LOC100796499 isoform 4 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
TAIR|locus:2008011 388 AT1G50570 "AT1G50570" [Arabido 0.696 0.337 0.656 1.7e-43
TAIR|locus:2173937 405 AT5G55530 "AT5G55530" [Arabido 0.654 0.303 0.658 4.1e-43
TAIR|locus:505006598 374 AT5G12300 "AT5G12300" [Arabido 0.670 0.336 0.430 5.9e-25
TAIR|locus:2008011 AT1G50570 "AT1G50570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 459 (166.6 bits), Expect = 1.7e-43, P = 1.7e-43
 Identities = 86/131 (65%), Positives = 109/131 (83%)

Query:    37 FIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDS 96
             F++ ARDIH+I +YHKQDVYA LCLT+DPEN+++TKII  GG NPVF+++ Q  VK +D 
Sbjct:    44 FVHQARDIHNICIYHKQDVYAKLCLTNDPENSLSTKIINGGGQNPVFDDTLQFDVKNLDC 103

Query:    97 SLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLS 156
             SLK EIF +SR+K+++EDQLLGF+LVPLSEV++ NGKL+ EFSLSSTD  HSPAGFV+LS
Sbjct:   104 SLKCEIFMMSRVKNYLEDQLLGFSLVPLSEVIVRNGKLEKEFSLSSTDLYHSPAGFVELS 163

Query:   157 LRYASDELQLM 167
             L YA D   +M
Sbjct:   164 LSYAGDSPDVM 174
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2173937 AT5G55530 "AT5G55530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006598 AT5G12300 "AT5G12300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 1e-08
cd00030102 cd00030, C2, C2 domain 3e-07
smart00239101 smart00239, C2, Protein kinase C conserved region 3e-06
pfam0016885 pfam00168, C2, C2 domain 1e-05
cd08681118 cd08681, C2_fungal_Inn1p-like, C2 domain found in 9e-04
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information 
 Score = 50.7 bits (122), Expect = 1e-08
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 16/109 (14%)

Query: 41  ARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVD----- 95
           A D+ ++ ++ K  VYA +    DP +  +T +   GG+NP +NE   L+   +D     
Sbjct: 9   AEDLKNVNLFGKMKVYAVV--WIDPSHKQSTPVDRDGGTNPTWNE--TLRF-PLDERLLQ 63

Query: 96  ---SSLKSEIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLS 141
               +L  E++     +  + D+L+G   VPL ++L           LS
Sbjct: 64  QGRLALTIEVYCE---RPSLGDKLIGEVRVPLKDLLDGASPAGELRFLS 109

SRC2 production is a response to pathogen infiltration. The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins. SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 125
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 188
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.96
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.94
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.93
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.9
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.9
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.9
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.89
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.89
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.88
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.88
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.88
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.88
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.88
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.87
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.87
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.87
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.87
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.86
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.86
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.86
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.86
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.86
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.85
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.85
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.85
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.85
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.84
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.84
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.84
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.84
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.84
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.82
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.82
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.82
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.81
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.81
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.81
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.81
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.8
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.8
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.8
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.8
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.8
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.79
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.79
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.79
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.78
PLN03008 868 Phospholipase D delta 99.78
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.78
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.78
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.78
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.78
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.77
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.77
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.76
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.76
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.76
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.76
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.75
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.75
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.75
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.74
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.74
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.74
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.73
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.73
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.73
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.72
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.72
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.72
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.71
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.71
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.7
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.69
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.69
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.68
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.68
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.68
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.67
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.67
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.67
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.66
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.65
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.65
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.65
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.64
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.64
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.63
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.63
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.61
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.61
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.59
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.59
PLN02270 808 phospholipase D alpha 99.58
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.49
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.49
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.48
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.38
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 99.34
PLN02952599 phosphoinositide phospholipase C 99.27
PLN02223537 phosphoinositide phospholipase C 99.23
PLN02352 758 phospholipase D epsilon 99.21
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.2
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.15
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.13
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.13
PLN02228567 Phosphoinositide phospholipase C 99.11
PLN02222581 phosphoinositide phospholipase C 2 99.04
PLN02230598 phosphoinositide phospholipase C 4 99.03
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 98.87
KOG0169746 consensus Phosphoinositide-specific phospholipase 98.75
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.47
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 98.43
KOG12641267 consensus Phospholipase C [Lipid transport and met 98.3
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.17
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.08
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 97.93
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 97.86
KOG1013 362 consensus Synaptic vesicle protein rabphilin-3A [I 97.64
KOG10111283 consensus Neurotransmitter release regulator, UNC- 97.34
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 97.29
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 97.25
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 97.03
PLN02964 644 phosphatidylserine decarboxylase 96.89
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 96.55
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 96.48
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 96.44
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 96.19
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.7
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.48
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 94.7
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 94.64
PF15627156 CEP76-C2: CEP76 C2 domain 94.19
KOG3837523 consensus Uncharacterized conserved protein, conta 94.17
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 93.71
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 93.37
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 93.15
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 92.91
cd08397159 C2_PI3K_class_III C2 domain present in class III p 92.53
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 92.32
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 91.85
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 91.41
KOG1327 529 consensus Copine [Signal transduction mechanisms] 91.11
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 90.01
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 89.22
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 87.95
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 87.46
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 84.98
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 84.77
KOG1329 887 consensus Phospholipase D1 [Lipid transport and me 81.51
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 81.48
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information 
Probab=99.96  E-value=2.8e-29  Score=195.23  Aligned_cols=119  Identities=24%  Similarity=0.396  Sum_probs=99.9

Q ss_pred             ceEEEEEEEeecCCCCCCCccCCCceEEEEEecCCCCeEeeecccCCCCCCccCceeEEEeecCCCcceEEEEEEeeecc
Q 045047           31 ASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSRIKS  110 (188)
Q Consensus        31 ~GtLEV~visAkdLkdv~~fgKqDpYavl~l~g~~~~~~~T~v~~~GG~NP~WNe~f~f~V~~~~~~L~~ei~~~~r~~~  110 (188)
                      .|+|+|+|++||+|+|.+ ||+|||||+|++++   ++++|+|+.++|.||+|||+|.|+|......|.++||    +++
T Consensus         1 ~g~L~v~v~~Ak~l~~~~-~g~sDPYv~i~lg~---~~~kT~v~~~~~~nP~WNe~F~f~v~~~~~~l~~~V~----d~d   72 (121)
T cd04016           1 VGRLSITVVQAKLVKNYG-LTRMDPYCRIRVGH---AVYETPTAYNGAKNPRWNKTIQCTLPEGVDSIYIEIF----DER   72 (121)
T ss_pred             CcEEEEEEEEccCCCcCC-CCCCCceEEEEECC---EEEEeEEccCCCCCCccCeEEEEEecCCCcEEEEEEE----eCC
Confidence            489999999999999999 99999999999977   7889999999999999999999999765455666665    445


Q ss_pred             -cccCccceEEEEechhhhhcCC-CcceeEEeeecCCCCCcceEEEEEEEE
Q 045047          111 -FVEDQLLGFTLVPLSEVLLNNG-KLDTEFSLSSTDFLHSPAGFVQLSLRY  159 (188)
Q Consensus       111 -~~~Dd~IG~a~VpL~ell~~~G-~~~~~~~l~s~d~~~kp~G~V~Lsl~f  159 (188)
                       +..|++||++.|||.+.+. .| ..+.||+|.... ..+..|.|+|+|+|
T Consensus        73 ~~~~dd~iG~~~i~l~~~~~-~g~~~~~W~~L~~~~-~~~~~g~i~l~l~y  121 (121)
T cd04016          73 AFTMDERIAWTHITIPESVF-NGETLDDWYSLSGKQ-GEDKEGMINLVFSY  121 (121)
T ss_pred             CCcCCceEEEEEEECchhcc-CCCCccccEeCcCcc-CCCCceEEEEEEeC
Confidence             5679999999999975442 45 467899997643 23467999999987

Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice varian
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>KOG1329 consensus Phospholipase D1 [Lipid transport and metabolism] Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 3e-09
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 2e-08
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 3e-07
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 4e-06
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 4e-05
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 1e-04
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 2e-04
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 3e-04
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 4e-04
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 4e-04
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 4e-04
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 4e-04
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 6e-04
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 7e-04
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
 Score = 52.4 bits (126), Expect = 3e-09
 Identities = 23/119 (19%), Positives = 46/119 (38%), Gaps = 9/119 (7%)

Query: 41  ARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKS 100
           A+ + D    +  D Y  L   +       + +    G+ P +NE+    V    + LK+
Sbjct: 19  AKGLEDADFLNNMDPYVQLTCRTQ---DQKSNVAEGMGTTPEWNETFIFTVSEGTTELKA 75

Query: 101 EIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRY 159
           +IF         ED  +G   +PL  V +      T +++   +      G + ++L +
Sbjct: 76  KIFDKDV---GTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDE---EYKGEIWVALSF 128
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.93
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.93
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.93
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.92
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.91
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.9
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.9
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.88
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.88
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.87
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.86
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.86
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.84
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.84
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.84
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.83
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.83
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.83
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.83
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.82
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.82
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.82
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.81
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.81
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.81
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.8
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.8
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.8
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.8
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.79
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.79
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.78
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.78
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.78
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.77
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.75
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.75
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.75
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.72
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.7
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.68
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.67
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.63
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.61
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.53
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.48
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.47
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.47
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.45
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.41
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.35
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 97.2
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 91.52
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 86.86
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 86.77
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 82.43
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 80.09
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.93  E-value=9.5e-26  Score=170.25  Aligned_cols=125  Identities=20%  Similarity=0.312  Sum_probs=107.2

Q ss_pred             CccceEEEEEEEeecCCCCCCCccCCCceEEEEEecCCCCeEeeecccCCCCCCccCceeEEEeecCCCcceEEEEEEee
Q 045047           28 LPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSR  107 (188)
Q Consensus        28 ~~~~GtLEV~visAkdLkdv~~fgKqDpYavl~l~g~~~~~~~T~v~~~GG~NP~WNe~f~f~V~~~~~~L~~ei~~~~r  107 (188)
                      .+..|.|.|+|++|+||+..+.++++||||++++.+   ++++|+++++++.||+|||+|.|.+......|.++||.   
T Consensus         6 ~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~---~~~kT~~~~~~~~nP~Wne~f~f~v~~~~~~l~~~V~d---   79 (136)
T 1wfj_A            6 SGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRT---QDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFD---   79 (136)
T ss_dssp             CCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSS---CEEECCCCTTCCSSCEEEEEEEEEEESSCCEEEEEECC---
T ss_pred             CCCcEEEEEEEEeccCCCCcccCCCcCceEEEEECC---ccceeEeccCCCCCCccCcEEEEEECCCCCEEEEEEEE---
Confidence            447899999999999999999999999999999976   67899999999999999999999998766678777763   


Q ss_pred             ecc-cccCccceEEEEechhhhhcCCC-cceeEEeeecCCCCCcceEEEEEEEEeecc
Q 045047          108 IKS-FVEDQLLGFTLVPLSEVLLNNGK-LDTEFSLSSTDFLHSPAGFVQLSLRYASDE  163 (188)
Q Consensus       108 ~~~-~~~Dd~IG~a~VpL~ell~~~G~-~~~~~~l~s~d~~~kp~G~V~Lsl~f~~~~  163 (188)
                       ++ +..|++||++.|||.+++. .|. .+.||+|. .  .++.+|+|+|+++|.+..
T Consensus        80 -~~~~~~d~~lG~~~i~l~~l~~-~~~~~~~w~~L~-~--~~~~~G~i~l~l~~~p~~  132 (136)
T 1wfj_A           80 -KDVGTEDDAVGEATIPLEPVFV-EGSIPPTAYNVV-K--DEEYKGEIWVALSFKPSG  132 (136)
T ss_dssp             -SSSCTTTCCSEEEEEESHHHHH-HSEEEEEEEEEE-E--TTEEEEEEEEEEEEEECC
T ss_pred             -CCCCCCCceEEEEEEEHHHhcc-CCCCCcEEEEee-c--CCccCEEEEEEEEEEeCC
Confidence             34 4579999999999999974 454 34799998 3  347899999999998754
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 188
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 8e-09
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-07
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 2e-04
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-04
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 8e-04
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 0.001
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 49.7 bits (118), Expect = 8e-09
 Identities = 20/119 (16%), Positives = 40/119 (33%), Gaps = 9/119 (7%)

Query: 41  ARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKS 100
           A+ + D    +  D Y  L           + +    G+ P +NE+      TV      
Sbjct: 19  AKGLEDADFLNNMDPYVQLTC---RTQDQKSNVAEGMGTTPEWNETFIF---TVSEGTTE 72

Query: 101 EIFTVSRIKSFVEDQLLGFTLVPLSEVLLNNGKLDTEFSLSSTDFLHSPAGFVQLSLRY 159
               +       ED  +G   +PL  V +      T +++   +      G + ++L +
Sbjct: 73  LKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDE---EYKGEIWVALSF 128
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.96
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.93
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.88
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.88
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.88
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.85
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.83
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.81
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.79
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.78
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.74
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.74
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.72
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.67
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.64
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.64
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.64
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.62
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.52
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.48
d2yrba1142 Fantom {Human (Homo sapiens) [TaxId: 9606]} 96.5
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 93.87
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.96  E-value=9.5e-30  Score=192.76  Aligned_cols=126  Identities=20%  Similarity=0.328  Sum_probs=108.3

Q ss_pred             CccceEEEEEEEeecCCCCCCCccCCCceEEEEEecCCCCeEeeecccCCCCCCccCceeEEEeecCCCcceEEEEEEee
Q 045047           28 LPLASVFLKFIYIARDIHDIGVYHKQDVYATLCLTSDPENTVTTKIIYAGGSNPVFNESRQLKVKTVDSSLKSEIFTVSR  107 (188)
Q Consensus        28 ~~~~GtLEV~visAkdLkdv~~fgKqDpYavl~l~g~~~~~~~T~v~~~GG~NP~WNe~f~f~V~~~~~~L~~ei~~~~r  107 (188)
                      ....|+|+|+|++||||++.+++|++||||++++.+   ++++|+++++++.||+|||+|.|.|......|.++||.   
T Consensus         6 ~~p~G~L~V~v~~a~~L~~~d~~g~~Dpyv~v~~~~---~~~~t~~~~~~~~nP~Wne~f~f~v~~~~~~L~v~V~d---   79 (136)
T d1wfja_           6 SGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRT---QDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFD---   79 (136)
T ss_dssp             CCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSS---CEEECCCCTTCCSSCEEEEEEEEEEESSCCEEEEEECC---
T ss_pred             CCCcEEEEEEEEEeeCCCCCCCCCCCCccEEEEEee---eeEEEEEEecCCCcEEEeeEEEEEEcCccceEEEEEEE---
Confidence            346799999999999999999999999999999976   78889999999999999999999998776678777763   


Q ss_pred             ecc-cccCccceEEEEechhhhhcCCCc-ceeEEeeecCCCCCcceEEEEEEEEeeccc
Q 045047          108 IKS-FVEDQLLGFTLVPLSEVLLNNGKL-DTEFSLSSTDFLHSPAGFVQLSLRYASDEL  164 (188)
Q Consensus       108 ~~~-~~~Dd~IG~a~VpL~ell~~~G~~-~~~~~l~s~d~~~kp~G~V~Lsl~f~~~~~  164 (188)
                       ++ +..|++||++.|||.+++. .|.. ..+|.+...   ++++|+|+|+++|.+..|
T Consensus        80 -~d~~~~d~~iG~~~i~L~~l~~-~~~~~~~~~~l~~~---~~~~G~i~l~l~~~p~~p  133 (136)
T d1wfja_          80 -KDVGTEDDAVGEATIPLEPVFV-EGSIPPTAYNVVKD---EEYKGEIWVALSFKPSGP  133 (136)
T ss_dssp             -SSSCTTTCCSEEEEEESHHHHH-HSEEEEEEEEEEET---TEEEEEEEEEEEEEECCS
T ss_pred             -ecCCCCCCEEEEEEEEhHHhcc-cCCcCcEEEEecCC---CccCEEEEEEEEEEeCCC
Confidence             44 4579999999999999985 4544 479998764   378999999999987554
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure