Citrus Sinensis ID: 045118


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
LKNLIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRPEMLDLEPFDRSKKINIT
ccccEEEcEEccccccHHHHcccccccEEEEEccccccHHHHHHHccccccccEEEEEEccccccccccccccccccccccEEEEEccccccccHHHHcccccccEEEEEccEEcccEEEEEcccccccccEEEEcccccccEEEEEcccccccccEEEccccccccccccccccccccEEEEEcccHHHHHHHHHccccccccccccccccccccccccc
cccHHHHcccccccccHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHccEEEEEccccccccccccccccccccccEEEEEEccccccccHHHHHHcccccEEEEEcccccccEEEEEcccccccHEEEEEccHHHHHEEEEcccccccccEEEEccHHHHHHccccHHHHHHHcEEEEccccHHHHHHHccccccEEEEEccEEEEEEcccccccc
LKNLIFIsalhpssctpdilgrlpnvrtfrisgdlsyyhsgvskslcklhklECLKLVNKGKMWQLSRMIlseykfppsltqlslsntelmedpmptleklphleVLKLKQNSYLERklacvgcssfsqlKILHLKSMLWLEewtmgagampkleslilnpcaylRKLPEELWCIKSLCklelhwpqpeLRQRLRAFEdmewrpemldlepfdrskkinit
LKNLIFIsalhpssctpdilgRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKlelhwpqpELRQRLRAFEDMEWrpemldlepfdrskkinit
LKNLIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVskslcklhkleclklVNKGKMWQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRPEMLDLEPFDRSKKINIT
***LIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMILSEYKFPPSLT******************KLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEW*******************
LKNLIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRPEMLDLEPFDRSKKINI*
LKNLIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRPEMLDLEPFDRSKKINIT
LKNLIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRPEMLDLEPFDRSK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LKNLIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRPEMLDLEPFDRSKKINIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query221 2.2.26 [Sep-21-2011]
P59584910 Disease resistance protei yes no 0.873 0.212 0.277 6e-16
Q9FJB5901 Disease resistance RPP8-l yes no 0.891 0.218 0.276 2e-15
Q8W4J9908 Disease resistance protei no no 0.561 0.136 0.352 6e-14
Q9FJK8908 Probable disease resistan no no 0.561 0.136 0.352 7e-14
Q9XIF0906 Putative disease resistan no no 0.877 0.214 0.330 1e-13
Q8W474907 Probable disease resistan no no 0.787 0.191 0.335 2e-13
P0C8S1906 Probable disease resistan no no 0.552 0.134 0.349 7e-13
P0DI181049 Probable disease resistan no no 0.443 0.093 0.444 7e-12
P0DI171049 Probable disease resistan no no 0.443 0.093 0.444 7e-12
Q8W3K3910 Putative disease resistan no no 0.502 0.121 0.339 6e-10
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 104/216 (48%), Gaps = 23/216 (10%)

Query: 1   LKNLIFISALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNK 60
           L NL ++        +   L R+  +R   +S    Y    +S SL +L  LE L ++  
Sbjct: 673 LVNLEYLYGFSTQHTSVTDLLRMTKLRNLTVSLSERYNFKTLSSSLRELRNLETLYVLFS 732

Query: 61  GKMWQLSRM----------------------ILSEYKFPPSLTQLSLSNTELMEDPMPTL 98
            K + +  M                      I  +++FPP L  + L    + EDPMP L
Sbjct: 733 RKTYMVDHMGEFVLDHFIHLKELGLVVRMSKIPDQHQFPPHLVHIFLFYCGMEEDPMPIL 792

Query: 99  EKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLI 158
           EKL HL+ ++L+  +++ R++ C     F+QL  L +     LE+W +  G+MP L +L 
Sbjct: 793 EKLHHLKSVQLRYKAFVGRRMVC-SKDGFTQLCALDISKQSELEDWIVEEGSMPCLRTLT 851

Query: 159 LNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRL 194
           ++ C  L++LP+ L  I SL +L++   + E +++L
Sbjct: 852 IHDCEKLKELPDGLKYITSLKELKIEGMKREWKEKL 887




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. In contrast to RPP8, it does not specifically recognize the Emco5 avirulence protein from Hyaloperonospora parasitica.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
359496848 856 PREDICTED: disease resistance RPP8-like 0.846 0.218 0.294 2e-15
255566504 857 Disease resistance protein RPP8, putativ 0.742 0.191 0.340 1e-14
359491404 922 PREDICTED: probable disease resistance R 0.864 0.207 0.298 2e-14
32453357 506 resistance protein RPP8-like protein [Ar 0.574 0.250 0.379 2e-14
224075299 896 nbs-lrr resistance protein [Populus tric 0.597 0.147 0.391 2e-14
32453355 502 resistance protein RPP8-like protein [Ar 0.873 0.384 0.297 2e-14
29839503 910 RecName: Full=Disease resistance protein 0.873 0.212 0.277 3e-14
147766035 902 hypothetical protein VITISV_038742 [Viti 0.787 0.192 0.293 4e-14
359489790 944 PREDICTED: probable disease resistance p 0.570 0.133 0.417 4e-14
255577203 1064 conserved hypothetical protein [Ricinus 0.601 0.125 0.364 4e-14
>gi|359496848|ref|XP_002269653.2| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 108/207 (52%), Gaps = 20/207 (9%)

Query: 9   ALHPSSCTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLS- 67
           +++ +   PD+LG+L N+R   I G  +     +S+ L KL  L+ L+L     + + + 
Sbjct: 636 SIYGNQWIPDLLGKLTNLRKLGIHGYFASQTEALSRCLVKLSNLQNLQLRGTELILEPTI 695

Query: 68  RMILSE------------------YKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKL 109
           +++L++                   +  P+LT++ L N+ L++D    L KLP+L++LKL
Sbjct: 696 KLLLNQPNIHKLHLSGPIEKLPDPQEIQPNLTKIILENSLLVQDIFVILGKLPNLQMLKL 755

Query: 110 KQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLP 169
             NS+  +++ C   S F +L  L L  ++ LEEW +  GAMP L  LI++ C  L+K+P
Sbjct: 756 LINSFFGKEITC-SASGFPKLHGLELSELVNLEEWRVDDGAMPSLRHLIIDHCDQLKKIP 814

Query: 170 EELWCIKSLCKLELHWPQPELRQRLRA 196
           E    + +L +L L     E   R++ 
Sbjct: 815 EGFQYLTALRELFLLNMPDEFEARIKG 841




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255566504|ref|XP_002524237.1| Disease resistance protein RPP8, putative [Ricinus communis] gi|223536514|gb|EEF38161.1| Disease resistance protein RPP8, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359491404|ref|XP_002274414.2| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|32453357|gb|AAP82810.1| resistance protein RPP8-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224075299|ref|XP_002304589.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222842021|gb|EEE79568.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|32453355|gb|AAP82809.1| resistance protein RPP8-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|29839503|sp|P59584.1|RP8HA_ARATH RecName: Full=Disease resistance protein RPH8A; AltName: Full=RPP8 homolog A Back     alignment and taxonomy information
>gi|147766035|emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489790|ref|XP_003633978.1| PREDICTED: probable disease resistance protein At1g58602-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577203|ref|XP_002529484.1| conserved hypothetical protein [Ricinus communis] gi|223531042|gb|EEF32894.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.574 0.140 0.341 2e-15
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.561 0.136 0.352 5.5e-15
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.561 0.136 0.352 1.2e-14
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.556 0.135 0.376 5e-14
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.461 0.112 0.436 8.3e-14
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.524 0.110 0.406 2.1e-13
TAIR|locus:28269781049 AT1G59218 [Arabidopsis thalian 0.524 0.110 0.406 2.1e-13
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.538 0.104 0.393 4.4e-12
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.511 0.111 0.362 2.1e-11
TAIR|locus:2827038 1017 AT1G59124 "AT1G59124" [Arabido 0.511 0.111 0.362 2.1e-11
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 206 (77.6 bits), Expect = 2.0e-15, P = 2.0e-15
 Identities = 44/129 (34%), Positives = 77/129 (59%)

Query:    66 LSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCS 125
             LS+ I  +++ PP +  + L    + EDPMP LEKL HL+ ++L++ +++ R++ C    
Sbjct:   750 LSK-IPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVC-SKG 807

Query:   126 SFSQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHW 185
              F QL+ L +     LEEW +  G+MP L  LI++ C  L +LP+ L  + SL +L++  
Sbjct:   808 GFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEG 867

Query:   186 PQPELRQRL 194
              + E +++L
Sbjct:   868 MKREWKEKL 876




GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 221
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.6
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.39
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.3
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.29
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.21
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.21
KOG0617264 consensus Ras suppressor protein (contains leucine 99.2
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.12
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.11
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.07
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.92
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.91
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.75
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.66
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.65
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.52
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.47
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.43
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.38
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.38
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.3
PLN03150623 hypothetical protein; Provisional 98.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.25
PLN03150623 hypothetical protein; Provisional 98.24
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.08
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.7
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.68
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.62
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.55
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.44
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.43
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.3
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.29
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.15
PRK15386 426 type III secretion protein GogB; Provisional 97.14
KOG4341483 consensus F-box protein containing LRR [General fu 97.13
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.0
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.73
PRK15386 426 type III secretion protein GogB; Provisional 96.69
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.63
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.99
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.45
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.45
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.36
KOG4341483 consensus F-box protein containing LRR [General fu 94.35
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.5
KOG1947 482 consensus Leucine rich repeat proteins, some prote 93.01
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.32
smart0037026 LRR Leucine-rich repeats, outliers. 86.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.88
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.9
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.11
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.60  E-value=3.9e-15  Score=138.23  Aligned_cols=167  Identities=23%  Similarity=0.246  Sum_probs=91.2

Q ss_pred             ChhhcCCCCCccEEEEEecCCccccchhHhhccCCCCcEEEeeecCc--e----e----eehhh----------cc-ccC
Q 045118           16 TPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGK--M----W----QLSRM----------IL-SEY   74 (221)
Q Consensus        16 ~~~~l~~l~~Lr~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~--~----~----~L~~L----------lp-~l~   74 (221)
                      .|..++.+++|+.|+++++.  ....+|..++++++|++|+++++.-  .    +    +|+.+          +| .++
T Consensus       156 ~p~~~~~l~~L~~L~L~~n~--l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~  233 (968)
T PLN00113        156 IPNDIGSFSSLKVLDLGGNV--LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIG  233 (968)
T ss_pred             CChHHhcCCCCCEEECccCc--ccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHh
Confidence            55566777777777777665  4456666677777777777765310  0    0    11111          23 344


Q ss_pred             cCCCCccEEEeecccCCCCCchhhccCCCCcEEEecCCccCCceeeeeCCCCCCcccEEeccccccccceeeCCCCCCCc
Q 045118           75 KFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGAMPKL  154 (221)
Q Consensus        75 ~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~L~~L~L~~~~~l~~~~~~~~~l~~L  154 (221)
                      .+ ++|++|++++|.+....+..++.+++|++|++++|.+.+. ++.. +..+++|+.|++++|.....++..+..+++|
T Consensus       234 ~l-~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~-~p~~-l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L  310 (968)
T PLN00113        234 GL-TSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGP-IPPS-IFSLQKLISLDLSDNSLSGEIPELVIQLQNL  310 (968)
T ss_pred             cC-CCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeecc-Cchh-HhhccCcCEEECcCCeeccCCChhHcCCCCC
Confidence            44 5555555555555443334455555555555555544322 2323 4445566666666555222334445556666


Q ss_pred             cEEEecCCccccCcchhhccCCcCcEEEccCCC
Q 045118          155 ESLILNPCAYLRKLPEELWCIKSLCKLELHWPQ  187 (221)
Q Consensus       155 ~~L~l~~~~~l~~~~~~~~~l~~L~~l~l~~~~  187 (221)
                      +.|++.+|......|..+..+++|+.|++.++.
T Consensus       311 ~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~  343 (968)
T PLN00113        311 EILHLFSNNFTGKIPVALTSLPRLQVLQLWSNK  343 (968)
T ss_pred             cEEECCCCccCCcCChhHhcCCCCCEEECcCCC
Confidence            666666654444555566667777777776553



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 46.9 bits (112), Expect = 1e-06
 Identities = 38/175 (21%), Positives = 73/175 (41%), Gaps = 14/175 (8%)

Query: 17  PDILGRLPNVRTFRISG-DLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQL-----SRMI 70
           PD + +   + T  ++   L      +  S+  L++L  L +    ++ +L     S   
Sbjct: 120 PDTMQQFAGLETLTLARNPLR----ALPASIASLNRLRELSIRACPELTELPEPLASTDA 175

Query: 71  LSEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQL 130
             E++   +L  L L  T +   P  ++  L +L+ LK++ +  L      +      +L
Sbjct: 176 SGEHQGLVNLQSLRLEWTGIRSLP-ASIANLQNLKSLKIRNSP-LSALGPAIH--HLPKL 231

Query: 131 KILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHW 185
           + L L+    L  +    G    L+ LIL  C+ L  LP ++  +  L KL+L  
Sbjct: 232 EELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRG 286


>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.7
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.68
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.64
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.64
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.63
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.63
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.62
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.62
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.62
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.61
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.61
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.61
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.6
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.6
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.6
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.59
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.59
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.58
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.58
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.58
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.58
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.58
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.57
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.57
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.57
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.57
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.57
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.57
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.56
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.56
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.56
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.54
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.54
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.54
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.54
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.54
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.53
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.53
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.52
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.52
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.51
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.51
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.5
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.5
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.5
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.5
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.49
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.47
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.46
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.45
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.45
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.44
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.44
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.43
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.42
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.4
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.39
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.39
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.38
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.37
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.33
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.32
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.29
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.2
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.19
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.19
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.19
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.17
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.16
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.1
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.96
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.96
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.84
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.81
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.79
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.78
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.69
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.64
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.61
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.57
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.06
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.93
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.84
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.97
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.51
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.44
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 87.9
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 86.26
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 81.31
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.81  E-value=5.1e-19  Score=144.21  Aligned_cols=174  Identities=20%  Similarity=0.293  Sum_probs=122.4

Q ss_pred             CCcceeceecCCC-CChhhcCCCCCccEEEEEecCCccccchhHhhccCCCCcEEEeeecCceeeehhhcc-cc------
Q 045118            2 KNLIFISALHPSS-CTPDILGRLPNVRTFRISGDLSYYHSGVSKSLCKLHKLECLKLVNKGKMWQLSRMIL-SE------   73 (221)
Q Consensus         2 ~~L~~L~~~~~~~-~~~~~l~~l~~Lr~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~L~~Llp-~l------   73 (221)
                      ++|+.|..-.... .+|..++++++|++|++++|.   ...+|..+.++++|++|+++++...   .. +| .+      
T Consensus       104 ~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~---l~~lp~~l~~l~~L~~L~L~~n~~~---~~-~p~~~~~~~~~  176 (328)
T 4fcg_A          104 SHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP---LRALPASIASLNRLRELSIRACPEL---TE-LPEPLASTDAS  176 (328)
T ss_dssp             TTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCC---CCCCCGGGGGCTTCCEEEEEEETTC---CC-CCSCSEEEC-C
T ss_pred             CCCCEEECCCCCccchhHHHhccCCCCEEECCCCc---cccCcHHHhcCcCCCEEECCCCCCc---cc-cChhHhhccch
Confidence            3455554332221 255556677777777777764   2366667777777777777662100   11 33 22      


Q ss_pred             ---CcCCCCccEEEeecccCCCCCchhhccCCCCcEEEecCCccCCceeeeeCCCCCCcccEEeccccccccceeeCCCC
Q 045118           74 ---YKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMGAGA  150 (221)
Q Consensus        74 ---~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~L~~L~L~~~~~l~~~~~~~~~  150 (221)
                         ..+ ++|++|++++|.+...+ ..++.+++|++|++++|.+.+  ++.. +..+++|+.|++++|.....++..++.
T Consensus       177 ~~~~~l-~~L~~L~L~~n~l~~lp-~~l~~l~~L~~L~L~~N~l~~--l~~~-l~~l~~L~~L~Ls~n~~~~~~p~~~~~  251 (328)
T 4fcg_A          177 GEHQGL-VNLQSLRLEWTGIRSLP-ASIANLQNLKSLKIRNSPLSA--LGPA-IHHLPKLEELDLRGCTALRNYPPIFGG  251 (328)
T ss_dssp             CCEEES-TTCCEEEEEEECCCCCC-GGGGGCTTCCEEEEESSCCCC--CCGG-GGGCTTCCEEECTTCTTCCBCCCCTTC
T ss_pred             hhhccC-CCCCEEECcCCCcCcch-HhhcCCCCCCEEEccCCCCCc--Cchh-hccCCCCCEEECcCCcchhhhHHHhcC
Confidence               336 88888888888887544 568888888888888888765  4445 667888888888888766777777888


Q ss_pred             CCCccEEEecCCccccCcchhhccCCcCcEEEccCCC
Q 045118          151 MPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQ  187 (221)
Q Consensus       151 l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~l~l~~~~  187 (221)
                      +++|++|++++|.....+|..+..+++|++|++.+|+
T Consensus       252 l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~  288 (328)
T 4fcg_A          252 RAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCV  288 (328)
T ss_dssp             CCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCT
T ss_pred             CCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCC
Confidence            8888888888888888888888888888888888875



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.43
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.41
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.4
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.4
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.31
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.3
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.28
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.24
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.21
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.16
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.13
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.11
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.97
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.47
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.22
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.62
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.49
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.48
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.72
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62  E-value=3.8e-15  Score=115.84  Aligned_cols=111  Identities=26%  Similarity=0.270  Sum_probs=76.8

Q ss_pred             ccCcCCCCccEEEeecccCCCCCchhhccCCCCcEEEecCCccCCceeeeeCCCCCCcccEEeccccccccceeeC-CCC
Q 045118           72 SEYKFPPSLTQLSLSNTELMEDPMPTLEKLPHLEVLKLKQNSYLERKLACVGCSSFSQLKILHLKSMLWLEEWTMG-AGA  150 (221)
Q Consensus        72 ~l~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~l~~~~~~~~~~L~~L~L~~~~~l~~~~~~-~~~  150 (221)
                      .+..+ ++|+.|+++++.+.......+..+.++++|.+++|.+..  ++......++.++.++++++. ++.++.. ++.
T Consensus        95 ~~~~l-~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~--l~~~~~~~l~~l~~l~l~~N~-l~~~~~~~~~~  170 (266)
T d1p9ag_          95 LGQTL-PALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKT--LPPGLLTPTPKLEKLSLANNN-LTELPAGLLNG  170 (266)
T ss_dssp             CTTTC-TTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCC--CCTTTTTTCTTCCEEECTTSC-CSCCCTTTTTT
T ss_pred             ccccc-cccccccccccccceeeccccccccccccccccccccce--eccccccccccchhccccccc-ccccCcccccc
Confidence            34444 555566665555554444445555666666665555433  221113457889999999887 7777543 677


Q ss_pred             CCCccEEEecCCccccCcchhhccCCcCcEEEccCCC
Q 045118          151 MPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQ  187 (221)
Q Consensus       151 l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~l~l~~~~  187 (221)
                      +++|++|++++ +.++.+|.++..+++|+.|++.++|
T Consensus       171 l~~L~~L~Ls~-N~L~~lp~~~~~~~~L~~L~L~~Np  206 (266)
T d1p9ag_         171 LENLDTLLLQE-NSLYTIPKGFFGSHLLPFAFLHGNP  206 (266)
T ss_dssp             CTTCCEEECCS-SCCCCCCTTTTTTCCCSEEECCSCC
T ss_pred             ccccceeeccc-CCCcccChhHCCCCCCCEEEecCCC
Confidence            99999999998 5688999999999999999999875



>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure