Citrus Sinensis ID: 045263

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740--

MALTVAVSQSCGMCFGGKQLRCAIILKAGRGCRNVLGTNMRFSNLLLPKIPKICSRSKHKYAECMLKLVEPYDESSIPQPKLLKKASVVMGYDSLNDLFKYGRADKDAMDDFDISLACKRFPCITLGSTPPVGLYDETKAGGSEMKSLLADQSCEAVVSNPMDAELRVDRFGLSEAWPSLYPALPNESSTSSEVGSLPSEASIEPLLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYK

ccEEEEEcccccccccccHHHHHHEEcccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHccccccccccccHHHHccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHccccccccccccccccccccEEEEEEEEEEEcccccccccEEEEEEEEccccccccccccEEEEEccccEEEEEEEEcccccccccccHHHHHHHHcccccccEEEEEEEEEEcccccEEEEEccEEEccccccHHHHHcccccEEEccccccccHHHHHHHHHHHHHHcccccccccHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHcccccEEEccccccccccccccccEEEccccccccHHHHHHHHccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHccccccccccccccccEEEEEEcccccHHHHHcc

ccEEEEEEcccccccccccHHEEEEEEEccccHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHEccccHHHHHHHHHHcHcccccccHHHHHHcccEEEEccccccEEccccccccccHHHHHHcccHHHccccccccccEccccHHHHcccccccccccccccccccccccccccHHHHHccccHHcccccHHHHHHHHHcccccHHHHHHHcccccHHccccccccccccEEEEEEEEEccccEEcccEEEEEEEEEEEEEEcccccEEEEEEEEccccccEEEEEEcEEEEEEEEccHHHHHHHHHHcccccEEEEEEEEEcccccEEEEccEEEEEEcccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHEEEcccccHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccHHHHHHHHHHHHcccccEEEEcHHHHHccccHHccEEEEEccHHHccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccHHHHHHHEccccEEEEcccccccccEEEEEEcccccHHHHHcc

MALTVAVSqscgmcfggkQLRCAIILKAGrgcrnvlgtnmrfsnlllpkipkicsrskHKYAECMLKLVepydessipqpkllKKASVVMGYDSLNDLFkygradkdamddfdislackrfpcitlgstppvglydetkaggseMKSLLADQSCeavvsnpmdaelrvdrfglseawpslypalpnesstssevgslpseasieplldkciscvpglskrLYHQLENCGFYTLRKLLHHFPRTYADLQnaqidlddgqyfIFIGEIissrgmkagcsFSFLEVIVGCeiadtettsgdevvnidsgqkKKIYLHLKKFfrgtrftsipflksiegkhkvGEFVCVSGKVramrsnnhyemreynidvlkdeddlslrakgrpypiypskgglnaSLLRDTIARALQAlpanfdpvpkEITQEFGLLCLFdaymgihqpkhidEADLARKRLIFDEFFYLQLGRLYQMLEGLgtqfekeglldkyrkprlnaaYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWdlkqpvpmnrllqgdvgcgKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNmeedkhkpkialltgstpvkqsrmirkdlqtgditLVIGTHSLIAEKVEFSALRLAIVDEQqrfgvvqrgrfnSKLYYTSMSsgmamvnsdgspkddqhmaphvlamsatpiPRTLALALYgdmsltqitdlppgripiktYIIEGnekgyenvyk

maltvavsqscgmcfgGKQLRCAIILKAGRGCRNVLGtnmrfsnlllpkipkicsRSKHKYAECMLKLVEPYDESSIPQPKLLKKASVVMGYDSLNDLFKYGRADKDAMDDFDISLACKRFpcitlgstppvgLYDETKAGGSEMKSLLADQSCEAVVSNPMDAELRVDRFGLSEAWPSLYPALPNESSTSSEVGSLPSEASIEPLLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVGCEIadtettsgdevvnidsgqkkKIYLHLKKFFRGTRFTSIPflksiegkhkvgeFVCVSgkvramrsnnhyemreynidvlkdeddlslrakgrpypiypskgglNASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPkialltgstpvkqsrmirkdlqtgdiTLVIGTHSLIAEKVEFSALRLAIVdeqqrfgvvqrgrfNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSltqitdlppgriPIKTyiiegnekgyenvyk

****VAVSQSCGMCFGGKQLRCAIILKAGRGCRNVLGTNMRFSNLLLPKIPKICSRSKHKYAECMLKLVEPYDESSIPQPKLLKKASVVMGYDSLNDLFKYGRADKDAMDDFDISLACKRFPCITLGSTPPVGLYD****************************ELRVDRFGLSEAWPS*************************PLLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNM********IALLT*********MIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYT************************VLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGN*********

***TV**SQSCGMCFGGKQLRCAIILKAGRGCRNVLGTNMRFSNLLLPKIPKICSRSKHKYAECMLK*V************LLKKASVVMGYDSLNDLFKYGRADKDAMDDFDISLACKRFPCI************************************************************************************KCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGM*****FSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLK********AKGRPYPIYPSKGGLNASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQ********************EGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVK**RMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYK

MALTVAVSQSCGMCFGGKQLRCAIILKAGRGCRNVLGTNMRFSNLLLPKIPKICSRSKHKYAECMLKLVEPYDESSIPQPKLLKKASVVMGYDSLNDLFKYGRADKDAMDDFDISLACKRFPCITLGSTPPVGLYDETKAGGSEMKSLLADQSCEAVVSNPMDAELRVDRFGLSEAWPSLYPAL***************EASIEPLLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYK

*ALTVAVSQSCGMCFGGKQLRCAIILKAGRGCRNVLGTNMRFSNLLLPKIPKICSRSKHKYAECMLKLVEPYDESSIPQPKLLKKASVVMGYDSLNDLFKYGRADKDAMDDFDISLACKRFPCITLGSTPPVGLYDETKAGGSEMKSLLADQSCEAVVSNPMDAELRVDRFGLSEA*************************SIEPLLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKL***********************MAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYEN*YK

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		742	2.2.26 [Sep-21-2011]
Q55681		831	ATP-dependent DNA helicas	N/A	no	0.636	0.567	0.351	4e-75
P96130		686	ATP-dependent DNA helicas	yes	no	0.448	0.485	0.380	7e-57
Q54900		671	ATP-dependent DNA helicas	yes	no	0.584	0.646	0.306	7e-54
O34942		682	ATP-dependent DNA helicas	yes	no	0.571	0.621	0.294	1e-51
O69460		743	ATP-dependent DNA helicas	yes	no	0.605	0.604	0.297	4e-51
O51528		686	ATP-dependent DNA helicas	yes	no	0.606	0.655	0.297	4e-51
P64322		737	ATP-dependent DNA helicas	yes	no	0.606	0.610	0.290	8e-51
P64323		737	ATP-dependent DNA helicas	yes	no	0.606	0.610	0.290	8e-51
O67837		792	ATP-dependent DNA helicas	yes	no	0.338	0.316	0.408	1e-50
Q5HPW4		682	ATP-dependent DNA helicas	yes	no	0.466	0.507	0.339	2e-49

>sp\|Q55681\|RECG_SYNY3 ATP-dependent DNA helicase RecG OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recG PE=3 SV=1	Back alignment and function desciption

 Score =  283 bits (724), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 190/541 (35%), Positives = 274/541 (50%), Gaps = 69/541 (12%)

Query: 198 PSEASIEPLLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDG 257
           P    IE  L   ++ V   S+     L+N G  T+  LL +FPR Y D           
Sbjct: 127 PKSGQIE--LHTPLATVVSQSQHQTKLLKNLGLATVEDLLFYFPRDYLDYAQQ------- 177

Query: 258 QYFIFIGEIISSRGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNID-SGQKKKIYLHLK 316
              + I E      + AG + + +  +V C    +       ++ I    Q  +I   L 
Sbjct: 178 ---VTIAE------LTAGETVTIVGRVVNCTCFTSPKNQNLNILQIQLRDQTGRI--KLS 226

Query: 317 KFFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSL 376
           +F+ G RF    + + I+  +     V  SG V++  S     +    I+VL D    S+
Sbjct: 227 RFYAGKRFAHRGWQEKIKKLYPPQAVVAASGLVKS--SKFGLTLDNPEIEVL-DRHSPSI 283

Query: 377 RA--KGRPYPIYPSKGGLNASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMG 434
            +   GR  P+YP   G+ A  LR  +     A+    DP+P+EI +++ L+ L  A   
Sbjct: 284 DSFKVGRVLPVYPLTEGITADFLRKLVLACQTAIAKLSDPLPQEIREKYELIDLQTAIAQ 343

Query: 435 IHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYM 494
           IH P++ ++  LAR+RL+FDEFFYLQLG L +  E               +K +  +A  
Sbjct: 344 IHFPENTEKLSLARRRLVFDEFFYLQLGFLQRRYE---------------QKQQQQSAIF 388

Query: 495 EGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACM 554
                L +K    LP+ LT +Q   ++EI+ DL +P PMNRL+QGDVG GKTVV   A +
Sbjct: 389 TPHGELLEKFSDLLPFRLTQAQQRVVNEILQDLNKPSPMNRLVQGDVGSGKTVVGVFAIL 448

Query: 555 EVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKD 614
             +  GYQAA M PTE+LA QHY+ L+   + +    + P + LLTGST   + R I   
Sbjct: 449 AALQGGYQAALMAPTEVLAEQHYQKLVSWFNLL----YLP-VELLTGSTKTAKRREIHAQ 503

Query: 615 LQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMV 674
           L TG + L++GTH+LI E V F  L L ++DEQ RFGV QR +  +K             
Sbjct: 504 LSTGQLPLLVGTHALIQETVNFQRLGLVVIDEQHRFGVQQRAKLLAK------------- 550

Query: 675 NSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNE 734
              G+       APHVL+M+ATPIPRTLAL L+GD+ ++QI +LPPGR PI T +I   E
Sbjct: 551 ---GN-------APHVLSMTATPIPRTLALTLHGDLEVSQIDELPPGRQPIHTSVITAKE 600

Query: 735 K 735
           +
Sbjct: 601 R 601

Critical role in recombination and DNA repair. Help process Holliday junction intermediates to mature products by catalyzing branch migration. Has a DNA unwinding activity characteristic of a DNA helicase with a 3' to 5' polarity. RecG unwind branched duplex DNA (Y-DNA).
Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2

>sp\|P96130\|RECG_TREPA ATP-dependent DNA helicase RecG OS=Treponema pallidum (strain Nichols) GN=recG PE=3 SV=1	Back alignment and function description

>sp\|Q54900\|RECG_STRPN ATP-dependent DNA helicase RecG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=recG PE=3 SV=2	Back alignment and function description

>sp\|O34942\|RECG_BACSU ATP-dependent DNA helicase RecG OS=Bacillus subtilis (strain 168) GN=recG PE=3 SV=1	Back alignment and function description

>sp\|O69460\|RECG_MYCLE ATP-dependent DNA helicase RecG OS=Mycobacterium leprae (strain TN) GN=recG PE=3 SV=2	Back alignment and function description

>sp\|O51528\|RECG_BORBU ATP-dependent DNA helicase RecG OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=recG PE=3 SV=1	Back alignment and function description

>sp\|P64322\|RECG_MYCTU ATP-dependent DNA helicase RecG OS=Mycobacterium tuberculosis GN=recG PE=3 SV=1	Back alignment and function description

>sp\|P64323\|RECG_MYCBO ATP-dependent DNA helicase RecG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=recG PE=3 SV=1	Back alignment and function description

>sp\|O67837\|RECG_AQUAE ATP-dependent DNA helicase RecG OS=Aquifex aeolicus (strain VF5) GN=recG PE=3 SV=1	Back alignment and function description

>sp\|Q5HPW4\|RECG_STAEQ ATP-dependent DNA helicase RecG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=recG PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		742
297737705		988	unnamed protein product [Vitis vinifera]	0.995	0.747	0.653	0.0
359472626		1036	PREDICTED: ATP-dependent DNA helicase re	0.985	0.705	0.640	0.0
255570116		983	conserved hypothetical protein [Ricinus	0.940	0.710	0.624	0.0
224108331		888	predicted protein [Populus trichocarpa]	0.869	0.726	0.659	0.0
186498546		973	ATP-dependent DNA helicase RecG [Arabido	0.973	0.742	0.591	0.0
356523432		1178	PREDICTED: ATP-dependent DNA helicase re	0.907	0.571	0.608	0.0
449445431		1544	PREDICTED: uncharacterized protein LOC10	0.862	0.414	0.594	0.0
3785974		845	putative ATP-dependent DNA helicase RECG	0.820	0.720	0.596	0.0
222623538		946	hypothetical protein OsJ_08114 [Oryza sa	0.938	0.735	0.512	0.0
357143281		1009	PREDICTED: ATP-dependent DNA helicase re	0.846	0.622	0.483	0.0

>gi\|297737705\|emb\|CBI26906.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/770 (65%), Positives = 597/770 (77%), Gaps = 31/770 (4%)

Query: 1   MALTVAVSQSCGMCFGGKQLRCAIILKAGRGCRNVLGTNMRFSNLLLPKIPKICSRSKHK 60
           MAL V+V +SCGMC   K LR AI  +A RG +N LG  MRFSN LL KI K+CSRSKHK
Sbjct: 1   MALAVSVVRSCGMCCSEKPLRIAIAFEAERGYQNALGRKMRFSNFLLSKISKLCSRSKHK 60

Query: 61  YAECMLKLVEPYDESSIP-QPKLLKKASVVMGYDSLNDLFKYGRADK-------DAMDDF 112
           + E +L  V+ Y ++SI  + KLL K SV+MGYDSL+DL +  R  K       D +++ 
Sbjct: 61  FPEKLLDEVDSYGKASISDRSKLLNKVSVLMGYDSLHDLIENERVQKESDMNLKDEINNV 120

Query: 113 DISLACKRFPCITLGSTPPVGLYDETKAGGSEMKSLLADQSCEAVVSNPMDAELR-VDRF 171
           DISLAC++FP I LG++PPV LYDE K   S+++SLLA Q CE  +S+    +    DRF
Sbjct: 121 DISLACRKFPSIILGNSPPVELYDENKCH-SDVRSLLAAQICEEFLSSSGAEKWDGPDRF 179

Query: 172 GLSEAWPSLYPALPNESST------SSEV----------GSLPSEASIEP---LLDKCIS 212
             SE WPSL P LPN +++       S+V            L S+ + EP   +LDK IS
Sbjct: 180 --SETWPSLCPTLPNINASLLRKEKKSDVLVTVEGPPANMVLESQNNAEPVELILDKSIS 237

Query: 213 CVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGM 272
            +PGL KR   QLENCGF+TLRKLL HFPRTYADL+NA I +DDGQY I IG+I+SSRG+
Sbjct: 238 FIPGLQKRHCRQLENCGFHTLRKLLQHFPRTYADLKNALIGIDDGQYMISIGKILSSRGV 297

Query: 273 KAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIPFLKS 332
           KA CSFSFLEV+VGCEIAD E+     +   DS  KK IYLHLKKFFRGTRFT++PFL+ 
Sbjct: 298 KASCSFSFLEVVVGCEIADCESKYEQMIGANDSWGKKTIYLHLKKFFRGTRFTNVPFLRC 357

Query: 333 IEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSLRAKGRPYPIYPSKGGL 392
           ++ KHK G+ VCVSGKVR MR+ +HYEMREYN+D+++D+ D S+  KGRPY IYPSKGGL
Sbjct: 358 LQEKHKEGDIVCVSGKVRTMRTKDHYEMREYNLDLIEDDQDSSVCPKGRPYSIYPSKGGL 417

Query: 393 NASLLRDTIARALQALPANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLI 452
           N++ LRD I+RAL +LP N DP+PK+I ++FGLL L  AY+GIHQPK + EADLARKRLI
Sbjct: 418 NSNFLRDIISRALHSLPVNIDPIPKDIIEDFGLLSLHSAYVGIHQPKDLKEADLARKRLI 477

Query: 453 FDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSL 512
           FDEFFYLQLGRL+Q+LEGLGT+ EK+GLLDKYRKP LN  ++E WSSLTK  L+ALPYSL
Sbjct: 478 FDEFFYLQLGRLFQILEGLGTKIEKDGLLDKYRKPELNTVFVEEWSSLTKNFLKALPYSL 537

Query: 513 TSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELL 572
           TSSQLSA SEIIWDLK+PVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELL
Sbjct: 538 TSSQLSAASEIIWDLKRPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELL 597

Query: 573 ATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAE 632
           A QHYE L+ LL+NME  + KP IALLTGSTP KQSRM  K LQ GDI+LVIGTHSLI+E
Sbjct: 598 ALQHYEQLINLLENMEGAECKPSIALLTGSTPSKQSRMTHKGLQNGDISLVIGTHSLISE 657

Query: 633 KVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLA 692
           KVEFSALR+A+VDEQ RFGV+QRGRFNSKLYY S+SS MA  +SD   + D  MAPH+LA
Sbjct: 658 KVEFSALRIAVVDEQHRFGVIQRGRFNSKLYYNSISSRMAEASSDVLSEGDTRMAPHILA 717

Query: 693 MSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYK 742
           MSATPIPRTLALALYGDMSLTQITDLPPGR P++TY IEG + G+E+VY+
Sbjct: 718 MSATPIPRTLALALYGDMSLTQITDLPPGRTPVETYTIEGCDAGFEDVYQ 767

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359472626\|ref\|XP_002280664.2\| PREDICTED: ATP-dependent DNA helicase recG-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255570116\|ref\|XP_002526020.1\| conserved hypothetical protein [Ricinus communis] gi\|223534667\|gb\|EEF36360.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|224108331\|ref\|XP_002314808.1\| predicted protein [Populus trichocarpa] gi\|222863848\|gb\|EEF00979.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|186498546\|ref\|NP_178253.3\| ATP-dependent DNA helicase RecG [Arabidopsis thaliana] gi\|330250357\|gb\|AEC05451.1\| ATP-dependent DNA helicase RecG [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356523432\|ref\|XP_003530343.1\| PREDICTED: ATP-dependent DNA helicase recG-like [Glycine max]	Back alignment and taxonomy information

>gi\|449445431\|ref\|XP_004140476.1\| PREDICTED: uncharacterized protein LOC101221994 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|3785974\|gb\|AAC67321.1\| putative ATP-dependent DNA helicase RECG [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|222623538\|gb\|EEE57670.1\| hypothetical protein OsJ_08114 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|357143281\|ref\|XP_003572867.1\| PREDICTED: ATP-dependent DNA helicase recG-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		742
TAIR\|locus:2049541		973	AT2G01440 [Arabidopsis thalian	0.745	0.568	0.682	2.3e-227
TIGR_CMR\|GSU_1326		767	GSU_1326 "ATP-dependent DNA he	0.351	0.340	0.386	4.8e-51
TIGR_CMR\|CHY_1468		677	CHY_1468 "ATP-dependent DNA he	0.382	0.419	0.381	4.2e-50
TIGR_CMR\|DET_1268		740	DET_1268 "ATP-dependent DNA he	0.427	0.428	0.355	7.1e-46
UNIPROTKB\|P64322		737	recG "ATP-dependent DNA helica	0.431	0.434	0.346	1.2e-42
TIGR_CMR\|BA_3993		682	BA_3993 "ATP-dependent DNA hel	0.339	0.369	0.362	2.8e-42
TIGR_CMR\|ECH_0062		679	ECH_0062 "ATP-dependent DNA he	0.218	0.238	0.448	4.4e-39
TIGR_CMR\|CBU_0305		704	CBU_0305 "ATP-dependent DNA he	0.397	0.419	0.352	5.1e-39
TIGR_CMR\|SPO_1681		696	SPO_1681 "ATP-dependent DNA he	0.338	0.360	0.370	5.6e-39
TIGR_CMR\|APH_1298		702	APH_1298 "ATP-dependent DNA he	0.206	0.217	0.462	5.3e-38

TAIR\|locus:2049541 AT2G01440 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1977 (701.0 bits), Expect = 2.3e-227, Sum P(2) = 2.3e-227
 Identities = 378/554 (68%), Positives = 456/554 (82%)

Query:   189 STSSEVGSLPSEA-SIEPLLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADL 247
             + +SEV +   +  + +  L   I  +PGLSKR  +QL++CGF+T++KLLHHFPRTYADL
Sbjct:   198 TATSEVEATSDDVFAAQRFLATSIDSMPGLSKRHSNQLDSCGFHTMKKLLHHFPRTYADL 257

Query:   248 QNAQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQ 307
             QNAQ+D++DGQY IF+G+++SS+G++A  SFSFLEVIV CE++  + T  D   N +   
Sbjct:   258 QNAQVDIEDGQYLIFVGKVLSSKGVRASSSFSFLEVIVSCEVSGRDRTPEDLSHNAEDKA 317

Query:   308 KKKIYLHLKKFFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDV 367
              K I+LHLKKFFRGTRFT  PFL SI+ KHKVG+ VC+SGKV+++R+ +H+EMREYNIDV
Sbjct:   318 GKSIFLHLKKFFRGTRFTWQPFLNSIQEKHKVGDLVCISGKVKSLRAEDHFEMREYNIDV 377

Query:   368 LKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQALPANFDPVPKEITQEFGLLC 427
             LKDE++ S RA+GRPYPIYPSKGGLN   L D I+RAL+ LPAN DP+PKEIT+ FGL  
Sbjct:   378 LKDEEESSHRAQGRPYPIYPSKGGLNPKFLSDVISRALRVLPANMDPIPKEITKVFGLPS 437

Query:   428 LFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKP 487
             L DAY+GIH+PK +DEADLARKRLIFDEFFYLQL RLYQML+ LGT+ EK+ LL+K+RKP
Sbjct:   438 LNDAYVGIHEPKTLDEADLARKRLIFDEFFYLQLARLYQMLQSLGTKIEKDVLLEKFRKP 497

Query:   488 RLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTV 547
              LN+ Y+E WS+LTK  L+ALPYSLT SQLSA+SEIIWDLK+PVPMNRLLQGDVGCGKTV
Sbjct:   498 VLNSVYIEEWSTLTKSFLKALPYSLTPSQLSAVSEIIWDLKRPVPMNRLLQGDVGCGKTV 557

Query:   548 VAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQ 607
             VAFLACMEVIGSGYQAAFM PTELLA QHYE    LL+NME    KP I LLTGSTP KQ
Sbjct:   558 VAFLACMEVIGSGYQAAFMAPTELLAIQHYEQCRDLLENMEGVSSKPTIGLLTGSTPAKQ 617

Query:   608 SRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSM 667
             SRMIR+DLQ+G I+ +IGTHSLIAEK+E+SALR+A+VDEQQRFGV+QRG+FNSKLY TSM
Sbjct:   618 SRMIRQDLQSGAISFIIGTHSLIAEKIEYSALRIAVVDEQQRFGVIQRGKFNSKLYGTSM 677

Query:   668 SSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKT 727
              S     +SD + K D  MAPHVLAMSATPIPR+LALALYGD+SLTQIT +P GRIP++T
Sbjct:   678 ISKSGSSDSDDTSKADLSMAPHVLAMSATPIPRSLALALYGDISLTQITGMPLGRIPVET 737

Query:   728 YIIEGNEKGYENVY 741
             +I EGNE G + VY
Sbjct:   738 HIFEGNETGIKEVY 751

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0004003 "ATP-dependent DNA helicase activity" evidence=IEA

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006281 "DNA repair" evidence=IEA

GO:0006310 "DNA recombination" evidence=IEA

GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS

TIGR_CMR\|GSU_1326 GSU_1326 "ATP-dependent DNA helicase RecG" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_1468 CHY_1468 "ATP-dependent DNA helicase RecG" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|DET_1268 DET_1268 "ATP-dependent DNA helicase RecG" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

UNIPROTKB\|P64322 recG "ATP-dependent DNA helicase RecG" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_3993 BA_3993 "ATP-dependent DNA helicase RecG" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

TIGR_CMR\|ECH_0062 ECH_0062 "ATP-dependent DNA helicase RecG" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0305 CBU_0305 "ATP-dependent DNA helicase RecG" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_1681 SPO_1681 "ATP-dependent DNA helicase RecG" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

TIGR_CMR\|APH_1298 APH_1298 "ATP-dependent DNA helicase RecG" [Anaplasma phagocytophilum HZ (taxid:212042)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_X6520	hypothetical protein (888 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	grail3.17963000101	Predicted protein (126 aa)	•	•	•	0.812
	fgenesh4_pm.C_LG_X000986	hypothetical protein (932 aa)	•		•	0.785
	eugene3.27440001	Peptide exporter, ABC transporter family protein (648 aa)			•	0.747
	eugene3.160500001	Predicted protein (113 aa)	•		•	0.731
	gw1.XI.1444.1	aminoacyl-tRNA ligase (EC-6.1.1.4) (889 aa)			•	0.726
	gw1.I.445.1	hypothetical protein (430 aa)			•	0.714
	gw1.X.4012.1	isoleucyl-tRNA synthetase (1029 aa)	•		•	0.678
	fgenesh4_pg.C_scaffold_11806000001	Predicted protein (423 aa)			•	0.657
	eugene3.12840002	annotation not avaliable (500 aa)	•		•	0.655
	gw1.VI.1090.1	hypothetical protein (653 aa)			•	0.640

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		742
TIGR00643		630	TIGR00643, recG, ATP-dependent DNA helicase RecG	1e-148
PRK10917		681	PRK10917, PRK10917, ATP-dependent DNA helicase Rec	1e-142
COG1200		677	COG1200, RecG, RecG-like helicase [DNA replication	1e-123
COG1197		1139	COG1197, Mfd, Transcription-repair coupling factor	9e-51
TIGR00580		926	TIGR00580, mfd, transcription-repair coupling fact	2e-48
PRK10689		1147	PRK10689, PRK10689, transcription-repair coupling	1e-29
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	3e-18
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	3e-17
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	6e-17
TIGR00595		505	TIGR00595, priA, primosomal protein N'	6e-04
cd00268		203	cd00268, DEADc, DEAD-box helicases	8e-04
COG1198		730	COG1198, PriA, Primosomal protein N' (replication	0.002

>gnl\|CDD\|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG	Back alignment and domain information

 Score =  446 bits (1148), Expect = e-148
 Identities = 194/517 (37%), Positives = 262/517 (50%), Gaps = 80/517 (15%)

Query: 228 CGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVGC 287
            G +T++ LL +FPR Y D    Q           IGE++   G +A      L      
Sbjct: 1   LGIHTVQDLLFYFPRRYEDRTLLQ----------TIGELLP--GERATIVGEVLSH---- 44

Query: 288 EIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGT-RFTSIPFLKSIEGKHKVGEFVCVS 346
                       +      +  K+ L    + +   RF +  FLK    K KVG  V V 
Sbjct: 45  -----------CIFGFKRRKVLKLRLKDGGYKKLELRFFNRAFLKK---KFKVGSKVVVY 90

Query: 347 GKVRAMRSNNHYEMREYNIDVLKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQ 406
           GKV++ +   +    E+  +    E +L      +  P+YP   GL    LR  I +AL 
Sbjct: 91  GKVKSSKFKAYLIHPEFISEKDGVEFEL------KILPVYPLTEGLTQKKLRKLIQQALD 144

Query: 407 ALPANF-DPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLY 465
            L  +  DP+P+E+ +++GLL L DA   IH PK +   +LAR+RLIFDEFFYLQL  L 
Sbjct: 145 QLDKSLEDPLPEELREKYGLLSLEDALRAIHFPKTLSLLELARRRLIFDEFFYLQLAMLA 204

Query: 466 QMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIW 525
           + L              + ++     A       L  K L +LP+ LT +Q   + EI+ 
Sbjct: 205 RRLG-------------EKQQFSAPPANPS--EELLTKFLASLPFKLTRAQKRVVKEILQ 249

Query: 526 DLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLD 585
           DLK  VPMNRLLQGDVG GKT+VA LA +  I +GYQ A M PTE+LA QHY  L  LL 
Sbjct: 250 DLKSDVPMNRLLQGDVGSGKTLVAALAMLAAIEAGYQVALMAPTEILAEQHYNSLRNLLA 309

Query: 586 NMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVD 645
            +       ++ALLTGS   K+ + + + + +G I LV+GTH+LI EKVEF  L L I+D
Sbjct: 310 PLG-----IEVALLTGSLKGKRRKELLETIASGQIHLVVGTHALIQEKVEFKRLALVIID 364

Query: 646 EQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALA 705
           EQ RFGV QR +   K                          PHVL MSATPIPRTLAL 
Sbjct: 365 EQHRFGVEQRKKLREKGQ--------------------GGFTPHVLVMSATPIPRTLALT 404

Query: 706 LYGDMSLTQITDLPPGRIPIKTYIIEGNEKGYENVYK 742
           +YGD+  + I +LPPGR PI T +I+ +EK  + VY+
Sbjct: 405 VYGDLDTSIIDELPPGRKPITTVLIKHDEK--DIVYE 439

[DNA metabolism, DNA replication, recombination, and repair]. Length = 630

>gnl\|CDD\|236794 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>gnl\|CDD\|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>gnl\|CDD\|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>gnl\|CDD\|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd)	Back alignment and domain information

>gnl\|CDD\|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|233040 TIGR00595, priA, primosomal protein N'	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|224119 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		742
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	100.0
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	100.0
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	100.0
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	99.97
PRK05580		679	primosome assembly protein PriA; Validated	99.92
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.89
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.89
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	99.85
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	99.84
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.84
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	99.83
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	99.83
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	99.82
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	99.81
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.81
PTZ00110		545	helicase; Provisional	99.81
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	99.81
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	99.81
PTZ00424		401	helicase 45; Provisional	99.8
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	99.8
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	99.8
PRK02362		737	ski2-like helicase; Provisional	99.78
PRK00254		720	ski2-like helicase; Provisional	99.78
PRK09401		1176	reverse gyrase; Reviewed	99.78
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	99.78
PRK01172		674	ski2-like helicase; Provisional	99.77
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	99.77
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	99.77
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	99.77
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	99.76
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	99.75
PRK14701		1638	reverse gyrase; Provisional	99.75
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.75
COG1201		814	Lhr Lhr-like helicases [General function predictio	99.74
PRK13767		876	ATP-dependent helicase; Provisional	99.74
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	99.73
PRK14873		665	primosome assembly protein PriA; Provisional	99.73
COG1204		766	Superfamily II helicase [General function predicti	99.73
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.73
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	99.73
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	99.72
PHA02558		501	uvsW UvsW helicase; Provisional	99.72
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	99.7
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.7
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.7
COG1205		851	Distinct helicase family with a unique C-terminal	99.69
KOG0343		758	consensus RNA Helicase [RNA processing and modific	99.69
KOG0346		569	consensus RNA helicase [RNA processing and modific	99.69
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	99.68
KOG0347		731	consensus RNA helicase [RNA processing and modific	99.68
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	99.66
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	99.66
PRK13766		773	Hef nuclease; Provisional	99.65
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.64
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.64
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.64
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	99.64
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	99.63
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	99.62
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.62
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	99.61
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	99.6
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.6
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.59
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.58
KOG4284		980	consensus DEAD box protein [Transcription]	99.58
KOG0354		746	consensus DEAD-box like helicase [General function	99.57
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	99.55
KOG0334		997	consensus RNA helicase [RNA processing and modific	99.55
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.55
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	99.54
COG1202		830	Superfamily II helicase, archaea-specific [General	99.52
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	99.48
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.47
PHA02653		675	RNA helicase NPH-II; Provisional	99.47
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	99.46
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.46
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.45
KOG0327		397	consensus Translation initiation factor 4F, helica	99.45
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.45
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.44
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	99.43
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	99.43
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.43
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.42
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.42
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.38
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.37
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	99.36
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	99.33
COG4096		875	HsdR Type I site-specific restriction-modification	99.33
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.33
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.31
PRK09694		878	helicase Cas3; Provisional	99.31
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.3
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.3
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	99.29
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.26
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.2
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.19
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	99.19
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.17
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.16
PRK04914		956	ATP-dependent helicase HepA; Validated	99.13
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.13
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.09
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.04
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	99.02
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	99.0
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	99.0
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.0
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	98.99
COG4889		1518	Predicted helicase [General function prediction on	98.91
PRK13107		908	preprotein translocase subunit SecA; Reviewed	98.91
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	98.91
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.89
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	98.83
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	98.74
KOG0353		695	consensus ATP-dependent DNA helicase [General func	98.65
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	98.63
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	98.56
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	98.51
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	98.5
CHL00122		870	secA preprotein translocase subunit SecA; Validate	98.46
PRK15483		986	type III restriction-modification system StyLTI en	98.46
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	98.43
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	98.42
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	98.37
KOG0387		923	consensus Transcription-coupled repair protein CSB	98.37
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	98.36
KOG1123		776	consensus RNA polymerase II transcription initiati	98.35
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	98.31
COG0610		962	Type I site-specific restriction-modification syst	98.21
cd04488		75	RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB f	98.12
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	98.11
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	98.06
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	98.05
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	98.03
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	98.03
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	97.99
KOG1803		649	consensus DNA helicase [Replication, recombination	97.99
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	97.97
TIGR00376		637	DNA helicase, putative. The gene product may repre	97.95
KOG4439		901	consensus RNA polymerase II transcription terminat	97.93
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.84
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.83
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.79
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	97.79
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	97.78
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	97.75
PRK05298		652	excinuclease ABC subunit B; Provisional	97.74
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	97.71
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	97.71
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	97.68
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	97.67
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	97.6
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	97.56
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	97.55
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	97.55
PF13245		76	AAA_19: Part of AAA domain	97.54
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.53
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.43
PRK10536		262	hypothetical protein; Provisional	97.43
PRK10689		1147	transcription-repair coupling factor; Provisional	97.42
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	97.36
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	97.32
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	97.32
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	97.29
PRK06526		254	transposase; Provisional	97.28
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	97.24
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	97.23
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	97.12
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	97.12
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	97.1
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	97.07
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	97.04
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	97.04
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	96.99
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	96.95
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	96.79
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	96.77
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	96.76
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	96.76
COG3587		985	Restriction endonuclease [Defense mechanisms]	96.72
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.69
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	96.61
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	96.6
PRK10875		615	recD exonuclease V subunit alpha; Provisional	96.6
KOG1805		1100	consensus DNA replication helicase [Replication, r	96.59
PRK08181		269	transposase; Validated	96.49
PRK13889		988	conjugal transfer relaxase TraA; Provisional	96.46
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	96.37
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	96.34
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	96.33
PF01336		75	tRNA_anti-codon: OB-fold nucleic acid binding doma	96.13
PRK11054		684	helD DNA helicase IV; Provisional	96.11
TIGR00595		505	priA primosomal protein N'. All proteins in this f	96.06
PRK07952		244	DNA replication protein DnaC; Validated	96.03
PRK04296		190	thymidine kinase; Provisional	96.01
smart00382		148	AAA ATPases associated with a variety of cellular	95.99
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	95.9
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	95.88
PRK08084		235	DNA replication initiation factor; Provisional	95.85
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	95.82
PRK13826		1102	Dtr system oriT relaxase; Provisional	95.71
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	95.66
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	95.63
COG2256		436	MGS1 ATPase related to the helicase subunit of the	95.63
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	95.61
PRK13342		413	recombination factor protein RarA; Reviewed	95.6
PRK05298		652	excinuclease ABC subunit B; Provisional	95.57
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	95.53
cd04485		84	DnaE_OBF DnaE_OBF: A subfamily of OB folds corresp	95.53
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	95.44
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	95.42
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	95.36
PRK09183		259	transposase/IS protein; Provisional	95.32
cd04492		83	YhaM_OBF_like YhaM_OBF_like: A subfamily of OB fol	95.29
PRK14974		336	cell division protein FtsY; Provisional	95.28
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	95.28
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	95.27
PRK08116		268	hypothetical protein; Validated	95.25
PF11798		32	IMS_HHH: IMS family HHH motif; InterPro: IPR024728	95.24
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	95.22
PLN03025		319	replication factor C subunit; Provisional	95.15
PRK13767		876	ATP-dependent helicase; Provisional	95.12
PRK13480		314	3'-5' exoribonuclease YhaM; Provisional	95.03
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	95.01
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	94.95
PTZ00110		545	helicase; Provisional	94.93
PHA03333		752	putative ATPase subunit of terminase; Provisional	94.93
KOG1001		674	consensus Helicase-like transcription factor HLTF/	94.91
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	94.84
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	94.78
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	94.73
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	94.72
PHA02533		534	17 large terminase protein; Provisional	94.71
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	94.62
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	94.59
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	94.59
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	94.55
PF04994		81	TfoX_C: TfoX C-terminal domain; InterPro: IPR00707	94.53
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	94.52
PRK08727		233	hypothetical protein; Validated	94.5
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	94.49
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	94.48
PRK05580		679	primosome assembly protein PriA; Validated	94.47
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	94.45
PF11731		93	Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd	94.39
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	94.38
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	94.34
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	94.33
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	94.29
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	94.26
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	94.26
PHA02558		501	uvsW UvsW helicase; Provisional	94.24
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	94.23
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	94.15
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	94.13
PRK13341		725	recombination factor protein RarA/unknown domain f	94.05
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	94.0
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	93.98
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	93.96
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	93.93
PF14520		60	HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU	93.93
PRK12402		337	replication factor C small subunit 2; Reviewed	93.91
PRK05973		237	replicative DNA helicase; Provisional	93.89
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	93.83
PRK00440		319	rfc replication factor C small subunit; Reviewed	93.81
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	93.79
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	93.74
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	93.72
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	93.69
COG3973		747	Superfamily I DNA and RNA helicases [General funct	93.66
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	93.64
PTZ00112		1164	origin recognition complex 1 protein; Provisional	93.64
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	93.62
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	93.61
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	93.57
PTZ00424		401	helicase 45; Provisional	93.57
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	93.56
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	93.56
TIGR00064		272	ftsY signal recognition particle-docking protein F	93.54
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	93.49
PRK09112		351	DNA polymerase III subunit delta'; Validated	93.45
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	93.45
PRK09694		878	helicase Cas3; Provisional	93.42
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	93.4
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	93.39
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	93.35
PRK07940		394	DNA polymerase III subunit delta'; Validated	93.28
PRK00771		437	signal recognition particle protein Srp54; Provisi	93.26
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	93.24
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	93.22
COG1484		254	DnaC DNA replication protein [DNA replication, rec	93.22
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	93.2
PHA02544		316	44 clamp loader, small subunit; Provisional	93.19
TIGR02237		209	recomb_radB DNA repair and recombination protein R	93.14
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	93.13
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	93.11
PRK00411		394	cdc6 cell division control protein 6; Reviewed	93.08
PRK00149		450	dnaA chromosomal replication initiation protein; R	93.07
PRK05707		328	DNA polymerase III subunit delta'; Validated	93.02
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	93.0
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	92.98
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	92.97
PRK13531		498	regulatory ATPase RavA; Provisional	92.89
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	92.87
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	92.87
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	92.8
COG4626		546	Phage terminase-like protein, large subunit [Gener	92.79
cd00983		325	recA RecA is a bacterial enzyme which has roles in	92.75
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	92.66
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	92.66
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	92.61
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	92.59
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	92.57
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	92.51
PRK11823		446	DNA repair protein RadA; Provisional	92.5
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	92.48
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	92.43
KOG2028		554	consensus ATPase related to the helicase subunit o	92.36
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	92.3
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	92.18
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	92.14
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	92.11
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	92.1
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	92.08
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	92.04
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	92.03
PRK08506		472	replicative DNA helicase; Provisional	92.03
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	91.99
PRK01172		674	ski2-like helicase; Provisional	91.99
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	91.95
PRK09354		349	recA recombinase A; Provisional	91.92
PF10391		52	DNA_pol_lambd_f: Fingers domain of DNA polymerase	91.92
PRK12377		248	putative replication protein; Provisional	91.91
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	91.85
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	91.79
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	91.77
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	91.76
smart00490		82	HELICc helicase superfamily c-terminal domain.	91.62
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	91.6
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	91.57
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	91.56
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	91.54
COG1221		403	PspF Transcriptional regulators containing an AAA-	91.54
PRK06835		329	DNA replication protein DnaC; Validated	91.5
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	91.48
PRK06921		266	hypothetical protein; Provisional	91.46
PRK10867		433	signal recognition particle protein; Provisional	91.38
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	91.36
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	91.25
TIGR00665		434	DnaB replicative DNA helicase. This model describe	91.2
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	91.19
PRK05642		234	DNA replication initiation factor; Validated	91.17
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	91.14
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	91.09
PHA00350		399	putative assembly protein	91.03
TIGR00959		428	ffh signal recognition particle protein. This mode	90.98
PF03118		66	RNA_pol_A_CTD: Bacterial RNA polymerase, alpha cha	90.95
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	90.94
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	90.61
PRK06871		325	DNA polymerase III subunit delta'; Validated	90.61
PRK08769		319	DNA polymerase III subunit delta'; Validated	90.6
PRK02362		737	ski2-like helicase; Provisional	90.54
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	90.45
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	90.45
PRK07471		365	DNA polymerase III subunit delta'; Validated	90.45
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	90.43
CHL00176		638	ftsH cell division protein; Validated	90.42
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	90.41
PRK08760		476	replicative DNA helicase; Provisional	90.36
cd01703		379	PolY_Pol_iota DNA Polymerase iota. Pol iota, also	90.28
PRK06904		472	replicative DNA helicase; Validated	90.27
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	90.24
PRK05748		448	replicative DNA helicase; Provisional	90.23
PRK00254		720	ski2-like helicase; Provisional	90.23
COG1201		814	Lhr Lhr-like helicases [General function predictio	90.18
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	90.15
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	90.15
PRK04328		249	hypothetical protein; Provisional	90.15
PRK01216		351	DNA polymerase IV; Validated	90.14
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	90.08
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	90.04
PRK08533		230	flagellar accessory protein FlaH; Reviewed	89.92
PRK03352		346	DNA polymerase IV; Validated	89.83
cd01700		344	PolY_Pol_V_umuC umuC subunit of DNA Polymerase V.	89.77
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	89.72
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	89.65
KOG1131		755	consensus RNA polymerase II transcription initiati	89.64
PRK07004		460	replicative DNA helicase; Provisional	89.62
PRK09165		497	replicative DNA helicase; Provisional	89.62
COG3743		133	Uncharacterized conserved protein [Function unknow	89.61
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	89.56
PRK03609		422	umuC DNA polymerase V subunit UmuC; Reviewed	89.55
cd00424		343	PolY Y-family of DNA polymerases. Y-family DNA pol	89.53
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	89.48
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	89.37
cd01394		218	radB RadB. The archaeal protein radB shares simila	89.34
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	89.02
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	89.02
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	89.01
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	88.96
PTZ00205		571	DNA polymerase kappa; Provisional	88.95
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	88.9
cd03115		173	SRP The signal recognition particle (SRP) mediates	88.85
PRK02406		343	DNA polymerase IV; Validated	88.8
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	88.73
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	88.72
PRK14133		347	DNA polymerase IV; Provisional	88.72
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	88.7
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	88.62
TIGR00767		415	rho transcription termination factor Rho. Members	88.51
PF12846		304	AAA_10: AAA-like domain	88.5
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	88.49
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	88.47
PRK08006		471	replicative DNA helicase; Provisional	88.46
PRK14087		450	dnaA chromosomal replication initiation protein; P	88.42
PRK06321		472	replicative DNA helicase; Provisional	88.3
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	88.29
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	88.25
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	88.23
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	88.2
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	88.12
PRK06964		342	DNA polymerase III subunit delta'; Validated	87.91
PRK08058		329	DNA polymerase III subunit delta'; Validated	87.86
PRK07399		314	DNA polymerase III subunit delta'; Validated	87.84
PRK03858		396	DNA polymerase IV; Validated	87.83
PRK13833		323	conjugal transfer protein TrbB; Provisional	87.75
PF14229		122	DUF4332: Domain of unknown function (DUF4332)	87.67
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	87.61
PHA03368		738	DNA packaging terminase subunit 1; Provisional	87.46
PRK10416		318	signal recognition particle-docking protein FtsY;	87.38
COG1198		730	PriA Primosomal protein N' (replication factor Y)	87.37
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	87.36
PRK06067		234	flagellar accessory protein FlaH; Validated	87.36
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	87.33
PRK05636		505	replicative DNA helicase; Provisional	87.19
PRK08840		464	replicative DNA helicase; Provisional	87.17
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	87.04
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	87.01
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	87.0
PRK03348		454	DNA polymerase IV; Provisional	86.94
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	86.86
PRK08939		306	primosomal protein DnaI; Reviewed	86.79
PRK02794		419	DNA polymerase IV; Provisional	86.69
COG3972		660	Superfamily I DNA and RNA helicases [General funct	86.57
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	86.44
PRK08903		227	DnaA regulatory inactivator Hda; Validated	86.44
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	86.37
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	86.35
PRK01810		407	DNA polymerase IV; Validated	86.25
PRK06893		229	DNA replication initiation factor; Validated	86.19
PRK03103		409	DNA polymerase IV; Reviewed	86.15
PRK04301		317	radA DNA repair and recombination protein RadA; Va	86.12
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	86.0
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	85.94
PRK08699		325	DNA polymerase III subunit delta'; Validated	85.92
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	85.74
cd01701		404	PolY_Rev1 DNA polymerase Rev1. Rev1 is a translesi	85.71
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	85.56
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	85.49
PRK05595		444	replicative DNA helicase; Provisional	85.49
PRK04195		482	replication factor C large subunit; Provisional	85.37
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	85.28
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	85.18
PRK13851		344	type IV secretion system protein VirB11; Provision	85.18
PRK09302		509	circadian clock protein KaiC; Reviewed	85.17
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	85.07
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	85.03
cd03586		334	PolY_Pol_IV_kappa DNA Polymerase IV/Kappa. Pol IV,	84.86
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	84.69
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	84.57
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	84.55
PF00004		132	AAA: ATPase family associated with various cellula	84.45
PRK10436		462	hypothetical protein; Provisional	84.41
cd04484		82	polC_OBF polC_OBF: A subfamily of OB folds corresp	84.4
PRK07773		886	replicative DNA helicase; Validated	84.38
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	84.29
PRK13766		773	Hef nuclease; Provisional	84.2
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	84.15
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	84.13
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	83.8
PRK09302		509	circadian clock protein KaiC; Reviewed	83.62
PRK07993		334	DNA polymerase III subunit delta'; Validated	83.51
PRK09519		790	recA DNA recombination protein RecA; Reviewed	83.37
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	83.33
PRK06090		319	DNA polymerase III subunit delta'; Validated	83.3
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	83.19
smart00483		334	POLXc DNA polymerase X family. includes vertebrate	83.14
COG0210		655	UvrD Superfamily I DNA and RNA helicases [DNA repl	83.12
cd01128		249	rho_factor Transcription termination factor rho is	83.09
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	83.06
PHA00729		226	NTP-binding motif containing protein	82.23
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	82.13
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	82.12
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	82.1

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

Probab=100.00  E-value=4e-94  Score=809.00  Aligned_cols=446  Identities=41%  Similarity=0.622  Sum_probs=400.5

Q ss_pred             ccCCcCCCCCHHHHHHHHhCCCCCHhHHhhcCCCcceeccc--ccccCCCCCeEEEEEEEEEeeccccCCCceEEEEEEe
Q 045263          209 KCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQN--AQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEVIVG  286 (742)
Q Consensus       209 ~~I~~LkGVG~k~~~~L~klGI~Tv~DLL~~fPrrYeDr~~--~i~~l~~Ge~vti~G~V~~~~~~~~~~~~~~l~v~v~  286 (742)
                      .|++.++||||+++++|++|||+|+.|||+|||++|+|++.  .+.++.+|+.||++|+|.+..... .+++..+++.+.
T Consensus        10 ~~l~~l~gig~~~a~~l~~Lgi~tv~DLL~~~P~~YeD~~~~~~i~~~~~g~~vti~g~V~~~~~~~-~~~~~~l~v~~~   88 (677)
T COG1200          10 VPLSTLKGIGPKTAEKLKKLGIHTVQDLLLYLPRRYEDRTLLPGIAEARPGEIVTIEGTVLSHEKFP-FGKRKLLKVTLS   88 (677)
T ss_pred             cchhhhcCcCHHHHHHHHHcCCCcHHHHHHhCccchhhccccCChhhcCCCceEEEEEEEEeeeccC-CCCCceEEEEEe
Confidence            37999999999999999999999999999999999999984  679999999999999999886554 566777888776


Q ss_pred             eeeccCCCCCCcceeeecCCCceeEEEEEeeeeecccccccc-hhHhhhccccCCcEEEEEEEEeecCCCceeEEeecee
Q 045263          287 CEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIP-FLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNI  365 (742)
Q Consensus       287 ~~~~~~~~~~~~~~~~~~~g~~~~i~l~~~~ff~~~~Ffn~p-fl~~~~~~l~~G~~v~v~GKv~~~~~~~~~~m~~~~~  365 (742)
                      +                ++|   .+.         ..|||++ |++   ++|++|+++.+||||++++  +.++|.||++
T Consensus        89 d----------------~~~---~l~---------l~fFn~~~~l~---~~~~~G~~v~v~Gk~~~~~--~~~~~~hpe~  135 (677)
T COG1200          89 D----------------GTG---VLT---------LVFFNFPAYLK---KKLKVGERVIVYGKVKRFK--GGLQITHPEY  135 (677)
T ss_pred             c----------------CcE---EEE---------EEEECccHHHH---hhCCCCCEEEEEEEEeecc--CceEEEcceE
Confidence            2                112   122         2577888 876   8999999999999999976  5689999999


Q ss_pred             eecCcchhhhhhccCCCccccCCCCCCCHHHHHHHHHHHHHhCC-CCCCCCCHhHHhhcCCCCHHHHHHhccCCCCcchH
Q 045263          366 DVLKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQALP-ANFDPVPKEITQEFGLLCLFDAYMGIHQPKHIDEA  444 (742)
Q Consensus       366 e~l~~~~~~~~~~~~~I~PIYp~t~GLs~~~lrk~I~~aL~~~~-~~~d~LP~~l~~k~~l~~~~~Al~~IH~P~~~~~~  444 (742)
                      .+..+...    ...+|.||||+|+|++++++|++|.+||+.+. ...|+||..++++|+++++.+|++.||+|++.+++
T Consensus       136 ~~~~~~~~----~~~~i~PvY~~t~gl~~~~lrk~i~~aL~~~~~~l~e~lp~~l~~k~~l~~~~~al~~lH~P~~~~~~  211 (677)
T COG1200         136 IVNDDGSE----LEERLTPVYPLTEGLKQKTLRKLIQQALEVLPSELEELLPEELLEKYGLPSLDEALRTLHFPKDEEDL  211 (677)
T ss_pred             EecCCCcc----cccceeeeeecccccCHHHHHHHHHHHHHhhhhhccccCCHHHHhhccCccHHHHHHhccCCCCHHHH
Confidence            87643321    24679999999999999999999999999886 57899999999999999999999999999999999


Q ss_pred             HHHHHhhchhHHHHHHHHHHHHHHhhcccchhhchhhhhccccccccccccCchHHHHHHHHhCCCCCCHHHHHHHHHHH
Q 045263          445 DLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEII  524 (742)
Q Consensus       445 ~~Ar~Rl~f~El~~~ql~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~lpf~Lt~~Q~~aI~~I~  524 (742)
                      ..+++|++|+|+|.+|+++++++.+.           ....+     ...+....+.++|++.|||+||..|++++.+|.
T Consensus       212 ~~~~rRL~f~Ell~~ql~l~~~r~~~-----------~~~~~-----~~~~~~~~l~~~~~~~LPF~LT~aQ~~vi~EI~  275 (677)
T COG1200         212 KRARRRLAFEELLALQLSLLLRRAKR-----------QKRSG-----IPLPANGELLAKFLAALPFKLTNAQKRVIKEIL  275 (677)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH-----------hhccC-----CCCCccHHHHHHHHHhCCCCccHHHHHHHHHHH
Confidence            99999999999999999998555421           11122     223345678999999999999999999999999


Q ss_pred             HhcCCCCCCceEEEccCCChHHHHHHHHHHHHHhcCCeEEEEcccHHHHHHHHHHHHHhhhhccCCCCCcEEEEEeCCCC
Q 045263          525 WDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTP  604 (742)
Q Consensus       525 ~~~~~~~~~~~LL~a~TGSGKT~val~ail~~l~~g~qvlilaPT~~La~Q~~~~l~~~l~~~~~~~~~i~V~ll~G~~~  604 (742)
                      .|+.++.||+||||||+|||||+||+++++.++.+|+|+++||||+.||+|||+.+.+++++++     ++|++++|+.+
T Consensus       276 ~Dl~~~~~M~RLlQGDVGSGKTvVA~laml~ai~~G~Q~ALMAPTEILA~QH~~~~~~~l~~~~-----i~V~lLtG~~k  350 (677)
T COG1200         276 ADLASPVPMNRLLQGDVGSGKTVVALLAMLAAIEAGYQAALMAPTEILAEQHYESLRKWLEPLG-----IRVALLTGSLK  350 (677)
T ss_pred             hhhcCchhhHHHhccCcCCCHHHHHHHHHHHHHHcCCeeEEeccHHHHHHHHHHHHHHHhhhcC-----CeEEEeecccc
Confidence            9999999999999999999999999999999999999999999999999999999999999998     99999999999


Q ss_pred             hHHHHHHHHHhhcCCccEEEechHHHhhccccCCccEEEEeCCccccccchhhhhhhhhccccccccccccCCCCCCCCC
Q 045263          605 VKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQ  684 (742)
Q Consensus       605 ~~er~~i~~~l~~G~~~IVVgT~~~l~~~v~~~~l~LVIIDEaHrfG~~qr~~l~~k~~~~~~~~~~~~~~~~~~~r~~~  684 (742)
                      .++|+.+++++.+|+++||||||+++++.+.|++++|||||||||||+.||..|.+|+                    . 
T Consensus       351 gk~r~~~l~~l~~G~~~ivVGTHALiQd~V~F~~LgLVIiDEQHRFGV~QR~~L~~KG--------------------~-  409 (677)
T COG1200         351 GKARKEILEQLASGEIDIVVGTHALIQDKVEFHNLGLVIIDEQHRFGVHQRLALREKG--------------------E-  409 (677)
T ss_pred             hhHHHHHHHHHhCCCCCEEEEcchhhhcceeecceeEEEEeccccccHHHHHHHHHhC--------------------C-
Confidence            9999999999999999999999999999999999999999999999999999999984                    1 


Q ss_pred             CCCCcEEEEcCCCCHHHHHHHHcCCCCeeeeccCCCCCCCcEEEEEcCCcc
Q 045263          685 HMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEK  735 (742)
Q Consensus       685 ~~~p~vL~mSATPiprtla~~l~gdl~~s~I~e~P~gr~~i~t~~~~~~~~  735 (742)
                       ..||+|.|||||||||+|++.|||||+|.|+|+|+||+||+|+++..+..
T Consensus       410 -~~Ph~LvMTATPIPRTLAlt~fgDldvS~IdElP~GRkpI~T~~i~~~~~  459 (677)
T COG1200         410 -QNPHVLVMTATPIPRTLALTAFGDLDVSIIDELPPGRKPITTVVIPHERR  459 (677)
T ss_pred             -CCCcEEEEeCCCchHHHHHHHhccccchhhccCCCCCCceEEEEeccccH
Confidence             16999999999999999999999999999999999999999999998665

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>cd04488 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE)	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1)	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases []	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PRK13480 3'-5' exoribonuclease YhaM; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PF04994 TfoX_C: TfoX C-terminal domain; InterPro: IPR007077 This domain is found in a number of bacterial proteins including the TfoX gene product of Haemophilus influenzae	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria []	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PHA00350 putative assembly protein	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PF03118 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha chain C terminal domain; InterPro: IPR011260 The core of the bacterial RNA polymerase (RNAP) consists of four subunits, two alpha, a beta and a beta', which are conserved from bacteria to mammals	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>cd01703 PolY_Pol_iota DNA Polymerase iota	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK01216 DNA polymerase IV; Validated	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK03352 DNA polymerase IV; Validated	Back alignment and domain information

>cd01700 PolY_Pol_V_umuC umuC subunit of DNA Polymerase V	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>COG3743 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>PRK03609 umuC DNA polymerase V subunit UmuC; Reviewed	Back alignment and domain information

>cd00424 PolY Y-family of DNA polymerases	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00205 DNA polymerase kappa; Provisional	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK02406 DNA polymerase IV; Validated	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK14133 DNA polymerase IV; Provisional	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06321 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK03858 DNA polymerase IV; Validated	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PF14229 DUF4332: Domain of unknown function (DUF4332)	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK03348 DNA polymerase IV; Provisional	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK02794 DNA polymerase IV; Provisional	Back alignment and domain information

>COG3972 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK01810 DNA polymerase IV; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK03103 DNA polymerase IV; Reviewed	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>cd01701 PolY_Rev1 DNA polymerase Rev1	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>cd03586 PolY_Pol_IV_kappa DNA Polymerase IV/Kappa	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC)	Back alignment and domain information

>PRK07773 replicative DNA helicase; Validated	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>smart00483 POLXc DNA polymerase X family	Back alignment and domain information

>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		742
1gm5_A		780	Structure Of Recg Bound To Three-Way Dna Junction L		3e-59
2eyq_A		1151	Crystal Structure Of Escherichia Coli Transcription		3e-28

>pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780

Back alignment and structure

Iteration: 1

Score = 226 bits (576), Expect = 3e-59, Method: Compositional matrix adjust. Identities = 175/526 (33%), Positives = 260/526 (49%), Gaps = 81/526 (15%) Query: 207 LDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQIDLDDGQYFIFIGEI 266 L I G+ +L+ G TLR LL FPR Y D + L+D + GE Sbjct: 113 LSTDIQYAKGVGPNRKKKLKKLGIETLRDLLEFFPRDYEDRRKI-FKLND----LLPGEK 167 Query: 267 ISSRGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLK-KFFRGTRFT 325 ++++G IV E T + +NI + +H+ K+F Sbjct: 168 VTTQGK-----------IVSVE------TKKFQNMNILTAVLSDGLVHVPLKWFNQDYLQ 210 Query: 326 SIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSLRAKGRPYPI 385 + +LK + GK V V+G V++ YE+ +N +V E + R PI Sbjct: 211 T--YLKQLTGKE-----VFVTGTVKSNAYTGQYEI--HNAEVTPKEGEYVRRI----LPI 257 Query: 386 YPSKGGLNASLLRDTIARALQALPANF-DPVPKEITQEFGLLCLFDAYMGIHQPKHIDEA 444 Y G++ +R + +L + + +P+ I ++ LL + DAY G+H PK Sbjct: 258 YRLTSGISQKQMRKIFEENIPSLCCSLKETLPERILEKRKLLGVKDAYYGMHFPKTFYHL 317 Query: 445 DLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKL 504 + AR+RL ++E F LQL + + + EK G + K +EG L ++ Sbjct: 318 EKARERLAYEELFVLQLA-----FQKIRKEREKHGGIPKK---------IEG--KLAEEF 361 Query: 505 LRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAA 564 +++LP+ LT++Q A EI D+ PMNRLLQGDVG GKTVVA LA ++ +G+Q A Sbjct: 362 IKSLPFKLTNAQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAGFQTA 421 Query: 565 FMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVI 624 FMVPT +LA QHY ++ K +ALL G+T + I+ L+ G I +VI Sbjct: 422 FMVPTSILAIQHYRRTVESF-----SKFNIHVALLIGATTPSEKEKIKSGLRNGQIDVVI 476 Query: 625 GTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQ 684 GTH+LI E V F L L I+DEQ RFGV QR M+ G MV++ Sbjct: 477 GTHALIQEDVHFKNLGLVIIDEQHRFGVKQREAL--------MNKG-KMVDT-------- 519 Query: 685 HMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYII 730 L MSATPIPR++ALA YGD+ +T I ++PPGR ++T ++ Sbjct: 520 ------LVMSATPIPRSMALAFYGDLDVTVIDEMPPGRKEVQTMLV 559

PyMOL of 1gm5

>pdb|2EYQ|A Chain A, Crystal Structure Of Escherichia Coli Transcription-Repair Coupling Factor Length = 1151

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		742
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	1e-143
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	3e-51
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
3b6e_A		216	Interferon-induced helicase C domain-containing P;	5e-08
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	8e-07
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	3e-06
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	1e-05
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	2e-05
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	3e-05
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	6e-05

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Length = 780	Back alignment and structure

 Score =  438 bits (1129), Expect = e-143
 Identities = 174/606 (28%), Positives = 265/606 (43%), Gaps = 96/606 (15%)

Query: 146 KSLLADQSCEAVVSNPMDAELRVDRFGLSEAWPSLYPALPNESSTSSEVGSLPSEASIEP 205
             LL ++  E  +   +D    +     +     +  +L       S       E S E 
Sbjct: 51  DPLLENKDLEEKLQAFLDYVKEIPNLPEARKRYRIQKSLEMIEKLRSWFLIDYLECSGEE 110

Query: 206 L-LDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQNAQ--IDLDDGQYFIF 262
           + L   I    G+      +L+  G  TLR LL  FPR Y D +      DL  G+    
Sbjct: 111 VDLSTDIQYAKGVGPNRKKKLKKLGIETLRDLLEFFPRDYEDRRKIFKLNDLLPGEKVTT 170

Query: 263 IGEIISS-----RGMKAGCSFSFLEVIVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKK 317
            G+I+S      + M           I+   ++D                   + L   K
Sbjct: 171 QGKIVSVETKKFQNMN----------ILTAVLSD------------GLVH---VPL---K 202

Query: 318 FFRGTRFTSIPFLKSIEGKHKVGEFVCVSGKVRAMRSNNHYEMREYNIDVLKDEDDLSLR 377
           +F         +L++   K   G+ V V+G V++      YE+  +N +V   E +    
Sbjct: 203 WFNQ------DYLQTYL-KQLTGKEVFVTGTVKSNAYTGQYEI--HNAEVTPKEGEYV-- 251

Query: 378 AKGRPYPIYPSKGGLNASLLRDTIARALQALPANF-DPVPKEITQEFGLLCLFDAYMGIH 436
              R  PIY    G++   +R      + +L  +  + +P+ I ++  LL + DAY G+H
Sbjct: 252 --RRILPIYRLTSGISQKQMRKIFEENIPSLCCSLKETLPERILEKRKLLGVKDAYYGMH 309

Query: 437 QPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEG 496
            PK     + AR+RL ++E F LQL                     +  + +      + 
Sbjct: 310 FPKTFYHLEKARERLAYEELFVLQLAFQKI----------------RKEREKHGGIPKKI 353

Query: 497 WSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEV 556
              L ++ +++LP+ LT++Q  A  EI  D+    PMNRLLQGDVG GKTVVA LA ++ 
Sbjct: 354 EGKLAEEFIKSLPFKLTNAQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDN 413

Query: 557 IGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQ 616
             +G+Q AFMVPT +LA QHY   ++             +ALL G+T   +   I+  L+
Sbjct: 414 YEAGFQTAFMVPTSILAIQHYRRTVESFSKFN-----IHVALLIGATTPSEKEKIKSGLR 468

Query: 617 TGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNS 676
            G I +VIGTH+LI E V F  L L I+DEQ RFGV QR    +K               
Sbjct: 469 NGQIDVVIGTHALIQEDVHFKNLGLVIIDEQHRFGVKQREALMNK--------------- 513

Query: 677 DGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNEKG 736
            G            L MSATPIPR++ALA YGD+ +T I ++PPGR  ++T ++  +   
Sbjct: 514 -GK-------MVDTLVMSATPIPRSMALAFYGDLDVTVIDEMPPGRKEVQTMLVPMDRV- 564

Query: 737 YENVYK 742
              VY+
Sbjct: 565 -NEVYE 569

PyMOL of 1gm5

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Length = 1151	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		742
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	100.0
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	99.96
3ly5_A		262	ATP-dependent RNA helicase DDX18; alpha-beta, stru	99.89
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	99.89
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	99.88
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	99.87
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	99.87
2pl3_A		236	Probable ATP-dependent RNA helicase DDX10; DEAD, s	99.87
3bor_A		237	Human initiation factor 4A-II; translation initiat	99.87
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	99.86
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	99.86
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	99.86
1wrb_A		253	DJVLGB; RNA helicase, DEAD BOX, VASA, structural g	99.86
3ber_A		249	Probable ATP-dependent RNA helicase DDX47; DEAD, A	99.86
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	99.85
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	99.85
3dkp_A		245	Probable ATP-dependent RNA helicase DDX52; DEAD, A	99.85
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	99.84
3fmo_B		300	ATP-dependent RNA helicase DDX19B; nuclear porin,	99.84
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	99.84
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	99.83
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	99.83
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	99.82
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	99.82
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	99.82
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	99.82
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	99.81
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	99.81
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	99.81
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	99.81
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	99.8
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	99.8
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	99.8
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	99.8
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	99.79
1rif_A		282	DAR protein, DNA helicase UVSW; bacteriophage, REC	99.79
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	99.79
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	99.79
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	99.78
4a4z_A		997	Antiviral helicase SKI2; hydrolase, ATPase, mRNA d	99.78
3b6e_A		216	Interferon-induced helicase C domain-containing P;	99.77
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	99.77
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	99.77
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	99.76
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	99.76
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	99.76
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	99.75
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	99.75
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	99.75
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	99.75
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	99.74
4gl2_A		699	Interferon-induced helicase C domain-containing P;	99.74
1gku_B		1054	Reverse gyrase, TOP-RG; topoisomerase, DNA superco	99.73
2fz4_A		237	DNA repair protein RAD25; RECA-like domain, DNA da	99.73
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	99.71
2ipc_A		997	Preprotein translocase SECA subunit; nucleotide bi	99.71
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	99.7
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	99.69
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	99.68
3h1t_A		590	Type I site-specific restriction-modification syst	99.65
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	99.65
2fsf_A		853	Preprotein translocase SECA subunit; ATPase, DNA-R	99.59
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	99.58
1tf5_A		844	Preprotein translocase SECA subunit; ATPase, helic	99.58
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	99.54
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	99.54
1nkt_A		922	Preprotein translocase SECA 1 subunit; preprotein	99.54
1yks_A		440	Genome polyprotein [contains: flavivirin protease	99.52
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	99.5
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	99.48
2w00_A		1038	HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri	99.48
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	99.45
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	99.42
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	99.4
3crv_A		551	XPD/RAD3 related DNA helicase; XPD helicase DNA re	99.4
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	99.32
2vl7_A		540	XPD; helicase, unknown function; 2.25A {Sulfolobus	99.29
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	99.28
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	99.24
3jux_A		822	Protein translocase subunit SECA; protein transloc	98.81
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	98.65
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	98.22
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	98.09
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	98.06
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	98.04
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	98.02
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	97.99
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	97.89
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	97.81
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	97.8
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	96.62
3lfu_A		647	DNA helicase II; SF1 helicase, ATP-binding, DNA da	96.6
2k50_A		115	Replication factor A related protein; uncharacteri	96.55
2o0j_A		385	Terminase, DNA packaging protein GP17; nucleotide-	96.5
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	96.45
3e0e_A		97	Replication protein A; structural genomics, PSI-2,	96.39
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	96.36
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	96.33
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	96.25
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	96.23
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	96.2
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	96.2
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	96.14
3cpe_A		592	Terminase, DNA packaging protein GP17; large termi	96.13
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	96.08
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	96.0
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	96.0
1uaa_A		673	REP helicase, protein (ATP-dependent DNA helicase	95.92
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	95.9
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	95.69
2chg_A		226	Replication factor C small subunit; DNA-binding pr	95.46
1pjr_A		724	PCRA; DNA repair, DNA replication, SOS response, h	95.44
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	95.43
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	95.35
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	95.35
3dm3_A		105	Replication factor A; probably plays AN essential	95.34
3u4q_A		1232	ATP-dependent helicase/nuclease subunit A; helicas	95.28
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	95.25
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	94.99
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	94.98
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	94.95
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	94.84
3pvs_A		447	Replication-associated recombination protein A; ma	94.78
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	94.71
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	94.69
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	94.57
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	94.51
3bqs_A		93	Uncharacterized protein; 10114F, NYSGXRC, PSI-2, s	94.47
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	94.37
3mab_A		93	Uncharacterized protein; NYSGXRC, PSI-2, structura	94.35
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	94.1
1z5z_A		271	Helicase of the SNF2/RAD54 family; hydrolase, reco	94.08
3e2i_A		219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	94.08
3vkw_A		446	Replicase large subunit; alpha/beta domain, helica	94.03
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	93.0
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	93.92
3hjh_A		483	Transcription-repair-coupling factor; MFD, mutatio	93.82
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	93.81
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	93.71
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	93.69
2chq_A		319	Replication factor C small subunit; DNA-binding pr	93.68
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	93.62
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	93.58
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	93.47
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	93.33
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	93.29
1w4r_A		195	Thymidine kinase; type II, human, cytosolic, phosp	93.17
1o7i_A		119	SSB, SSO2364, single stranded DNA binding protein;	93.17
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	93.12
2r6a_A		454	DNAB helicase, replicative helicase; replication,	93.06
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	93.06
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	92.78
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	92.71
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	92.71
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	92.62
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	92.62
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	92.53
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	92.47
2k75_A		106	Uncharacterized protein TA0387; closed beta barrel	92.44
1im4_A		221	DBH; DNA polymerase PALM, thumb, fingers, helix-ha	92.43
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	92.39
3bos_A		242	Putative DNA replication factor; P-loop containing	92.15
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	92.14
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	91.95
2l8b_A		189	Protein TRAI, DNA helicase I; RECD, hydrolase; NMR	91.94
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	91.92
1wcn_A		70	Transcription elongation protein NUSA; RNA-binding	91.54
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	91.52
3gfk_B		79	DNA-directed RNA polymerase subunit alpha; protein	91.36
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	91.36
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	91.33
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	91.29
2kbn_A		109	Conserved protein; nucleic acid binding protein, b	91.25
4dez_A		356	POL IV 1, DNA polymerase IV 1; Y-family, transfera	91.11
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	91.08
1jx4_A		352	DNA polymerase IV (family Y); protein-DNA complex,	91.0
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	90.93
3bq0_A		354	POL IV, DBH, DNA polymerase IV; Y-family, lesion b	90.91
2qgz_A		308	Helicase loader, putative primosome component; str	90.89
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	90.5
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	90.43
1z3e_B		73	DNA-directed RNA polymerase alpha chain; bacterial	90.36
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	90.29
3k4g_A		86	DNA-directed RNA polymerase subunit alpha; bacteri	90.29
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	90.25
3osn_A		420	DNA polymerase IOTA; hoogsteen base PAIR, protein-	89.93
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	89.87
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	89.56
4gl2_A		699	Interferon-induced helicase C domain-containing P;	89.43
1yks_A		440	Genome polyprotein [contains: flavivirin protease	89.39
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	89.23
4f4y_A		362	POL IV, DNA polymerase IV; Y-family polymerase, tr	88.93
1ci4_A		89	Protein (barrier-TO-autointegration factor (BAF) )	88.77
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	88.73
3pzp_A		517	DNA polymerase kappa; DNA nucleotidyltransferase,	88.57
3gqc_A		504	DNA repair protein REV1; protein-DNA complex, DNA	88.53
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	88.34
2aq4_A		434	DNA repair protein REV1; polymerase, PAD, N-digit,	88.27
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	88.27
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	88.18
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	88.01
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	87.94
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	87.88
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	87.65
2zts_A		251	Putative uncharacterized protein PH0186; KAIC like	87.41
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	87.23
1t94_A		459	Polymerase (DNA directed) kappa; replication, DNA	87.01
3kdf_D		132	Replication protein A 32 kDa subunit; wheat GERM c	86.91
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	86.52
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	86.45
1u94_A		356	RECA protein, recombinase A; homologous recombinat	86.38
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	86.3
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	86.17
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	85.65
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	85.61
3io5_A		333	Recombination and repair protein; storage dimer, i	85.59
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	85.44
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	85.38
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	85.2
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	85.11
1xp8_A		366	RECA protein, recombinase A; recombination, radior	84.67
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	84.61
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	84.45
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	84.22
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	83.93
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	83.71
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	83.56
2cvh_A		220	DNA repair and recombination protein RADB; filamen	83.47
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	82.93
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	82.92
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	82.8
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	82.65
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	82.42
3co5_A		143	Putative two-component system transcriptional RES	82.24
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	82.17
4ecq_A		435	DNA polymerase ETA; transferase-DNA complex; HET:	82.11
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	81.78
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	81.74
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	81.7
4gop_B		136	Putative uncharacterized protein; OB fold, ssDNA b	81.69
2xxa_A		433	Signal recognition particle protein; protein trans	81.59
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	81.58
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	81.21
3h1t_A		590	Type I site-specific restriction-modification syst	81.15
4b4t_I		437	26S protease regulatory subunit 4 homolog; hydrola	80.99
1b22_A		114	DNA repair protein RAD51; DNA binding, riken struc	80.62
1coo_A		98	RNA polymerase alpha subunit; transcription regula	80.4
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	80.29
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	80.09

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

Probab=100.00  E-value=5.8e-72  Score=664.84  Aligned_cols=447  Identities=35%  Similarity=0.535  Sum_probs=379.1

Q ss_pred             hhhccCCcCCCCCHHHHHHHHhCCCCCHhHHhhcCCCcceeccc--ccccCCCCCeEEEEEEEEEeeccccCCCceEEEE
Q 045263          206 LLDKCISCVPGLSKRLYHQLENCGFYTLRKLLHHFPRTYADLQN--AQIDLDDGQYFIFIGEIISSRGMKAGCSFSFLEV  283 (742)
Q Consensus       206 ~L~~~I~~LkGVG~k~~~~L~klGI~Tv~DLL~~fPrrYeDr~~--~i~~l~~Ge~vti~G~V~~~~~~~~~~~~~~l~v  283 (742)
                      .|++||+.||||||+++++|+++||+|+.|||+|||++|+|++.  ++.++.+|+.++|.|+|.+....+. +++.++++
T Consensus       112 ~~~~~~~~l~gvg~~~~~~l~~lgi~~~~dll~~~P~~y~d~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~-~~~~~~~~  190 (780)
T 1gm5_A          112 DLSTDIQYAKGVGPNRKKKLKKLGIETLRDLLEFFPRDYEDRRKIFKLNDLLPGEKVTTQGKIVSVETKKF-QNMNILTA  190 (780)
T ss_dssp             CSCCCSSSSSSCCHHHHHHHHTTTCCSSGGGTSCCCSEEECCSCCCCSSCCCSSCCCEEEECCCCCEEEEC-SSCEEEEE
T ss_pred             cccCCchhcCCCCHHHHHHHHHCCCCcHHHHHhhCCCceEeCCcCCcHHHcCCCCEEEEEEEEEEEEeecC-CCCeEEEE
Confidence            36789999999999999999999999999999999999999974  6899999999999999987643322 33456666


Q ss_pred             EEeeeeccCCCCCCcceeeecCCCceeEEEEEeeeeecccccccchhHhhhccccC--CcEEEEEEEEeecCCCceeEEe
Q 045263          284 IVGCEIADTETTSGDEVVNIDSGQKKKIYLHLKKFFRGTRFTSIPFLKSIEGKHKV--GEFVCVSGKVRAMRSNNHYEMR  361 (742)
Q Consensus       284 ~v~~~~~~~~~~~~~~~~~~~~g~~~~i~l~~~~ff~~~~Ffn~pfl~~~~~~l~~--G~~v~v~GKv~~~~~~~~~~m~  361 (742)
                      .+.                |++|.   +.         ..|||++|++   +.|++  |+.++|+|||+.+.+.+.++|.
T Consensus       191 ~~~----------------d~~~~---~~---------~~~f~~~~~~---~~~~~~~g~~~~~~G~~~~~~~~~~~~~~  239 (780)
T 1gm5_A          191 VLS----------------DGLVH---VP---------LKWFNQDYLQ---TYLKQLTGKEVFVTGTVKSNAYTGQYEIH  239 (780)
T ss_dssp             EEC----------------CSSCC---EE---------EEECSCCTTH---HHHHTTCSSCEEEEEEECSCCTTSSCCEE
T ss_pred             EEE----------------ECCce---EE---------EEEECcHHHH---hhCccCCCCEEEEEEEEEEccCCCcEEEE
Confidence            664                22332   22         2467888876   78899  9999999999884112357899


Q ss_pred             eceeeecCcchhhhhhccCCCccccCCCCCCCHHHHHHHHHHHHHhC-CCCCCCCCHhHHhhcCCCCHHHHHHhccCCCC
Q 045263          362 EYNIDVLKDEDDLSLRAKGRPYPIYPSKGGLNASLLRDTIARALQAL-PANFDPVPKEITQEFGLLCLFDAYMGIHQPKH  440 (742)
Q Consensus       362 ~~~~e~l~~~~~~~~~~~~~I~PIYp~t~GLs~~~lrk~I~~aL~~~-~~~~d~LP~~l~~k~~l~~~~~Al~~IH~P~~  440 (742)
                      ||++++.++. .     .++|+||||+|+||+++.|+++|.++|+.+ ....|+||++++++++|+++.+|+..||+|.+
T Consensus       240 ~p~~~~~~~~-~-----~~~~~pvY~~~~~l~~~~~~~~i~~~l~~~~~~~~e~lp~~~~~~~~l~~~~~al~~iH~P~~  313 (780)
T 1gm5_A          240 NAEVTPKEGE-Y-----VRRILPIYRLTSGISQKQMRKIFEENIPSLCCSLKETLPERILEKRKLLGVKDAYYGMHFPKT  313 (780)
T ss_dssp             EEEEECSCCS-S-----SSSCEEECCCBTTBCHHHHHHHHHHHHHHHHHCCCCCSCHHHHHHHCCCCSHHHHHHHHSCSS
T ss_pred             cCEEeecccc-c-----cCceeeEecCCCCCCHHHHHHHHHHHHHhhhccCCCcCCHHHHHHcCCCcHHHHHHhCCCCCC
Confidence            9998764321 1     356999999999999999999999999876 34679999999999999999999999999999


Q ss_pred             cchHHHHHHhhchhHHHHHHHHHHHHHHhhcccchhhchhhhhccccccccccccCchHHHHHHHHhCCCCCCHHHHHHH
Q 045263          441 IDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAI  520 (742)
Q Consensus       441 ~~~~~~Ar~Rl~f~El~~~ql~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~lpf~Lt~~Q~~aI  520 (742)
                      .+++..|++|++|+|+|.+|+.+...+..+           .....     ........+.+.+.+.+||+||++|++|+
T Consensus       314 ~~~~~~a~~rl~~eEl~~~ql~l~~~r~~~-----------~~~~~-----~~~~~~~~~~~~~~~~lpf~lt~~Q~~ai  377 (780)
T 1gm5_A          314 FYHLEKARERLAYEELFVLQLAFQKIRKER-----------EKHGG-----IPKKIEGKLAEEFIKSLPFKLTNAQKRAH  377 (780)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHCC-----CCCCCCTHHHHHHHHHSSSCCCHHHHHHH
T ss_pred             hHHHHHHHHHHhHHHHHHHHHHHHHHHHHH-----------HhccC-----CCCCCchHHHHHHHHhCCCCCCHHHHHHH
Confidence            999999999999999999999886444321           00111     11223457889999999999999999999


Q ss_pred             HHHHHhcCCCCCCceEEEccCCChHHHHHHHHHHHHHhcCCeEEEEcccHHHHHHHHHHHHHhhhhccCCCCCcEEEEEe
Q 045263          521 SEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKHKPKIALLT  600 (742)
Q Consensus       521 ~~I~~~~~~~~~~~~LL~a~TGSGKT~val~ail~~l~~g~qvlilaPT~~La~Q~~~~l~~~l~~~~~~~~~i~V~ll~  600 (742)
                      ++|.+++.++.+|+++++||||||||++|+++++..+.+|.|++||+||++||.|+++++.+++...+     +++++++
T Consensus       378 ~~I~~~l~~~~~~~~Ll~a~TGSGKTlvall~il~~l~~g~qvlvlaPtr~La~Q~~~~l~~~~~~~g-----i~v~~l~  452 (780)
T 1gm5_A          378 QEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVESFSKFN-----IHVALLI  452 (780)
T ss_dssp             HHHHHHHHSSSCCCCEEECCSSSSHHHHHHHHHHHHHHHTSCEEEECSCHHHHHHHHHHHHHHHTCSS-----CCEEECC
T ss_pred             HHHHhhccccCCCcEEEEcCCCCCHHHHHHHHHHHHHHcCCeEEEEeCcHHHHHHHHHHHHHHhhhcC-----ceEEEEe
Confidence            99999998888899999999999999999999999999999999999999999999999999998777     8999999


Q ss_pred             CCCChHHHHHHHHHhhcCCccEEEechHHHhhccccCCccEEEEeCCccccccchhhhhhhhhccccccccccccCCCCC
Q 045263          601 GSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGVVQRGRFNSKLYYTSMSSGMAMVNSDGSP  680 (742)
Q Consensus       601 G~~~~~er~~i~~~l~~G~~~IVVgT~~~l~~~v~~~~l~LVIIDEaHrfG~~qr~~l~~k~~~~~~~~~~~~~~~~~~~  680 (742)
                      |+.+.+++...+..+.+|+++|+||||+.+++.+.+.++++|||||+|+||+.++..+..+                   
T Consensus       453 G~~~~~~r~~~~~~l~~g~~~IvVgT~~ll~~~~~~~~l~lVVIDEaHr~g~~qr~~l~~~-------------------  513 (780)
T 1gm5_A          453 GATTPSEKEKIKSGLRNGQIDVVIGTHALIQEDVHFKNLGLVIIDEQHRFGVKQREALMNK-------------------  513 (780)
T ss_dssp             SSSCHHHHHHHHHHHHSSCCCEEEECTTHHHHCCCCSCCCEEEEESCCCC-----CCCCSS-------------------
T ss_pred             CCCCHHHHHHHHHHHhcCCCCEEEECHHHHhhhhhccCCceEEecccchhhHHHHHHHHHh-------------------
Confidence            9999999999999999999999999999999989999999999999999999988655432                   


Q ss_pred             CCCCCCCCcEEEEcCCCCHHHHHHHHcCCCCeeeeccCCCCCCCcEEEEEcCCc
Q 045263          681 KDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPPGRIPIKTYIIEGNE  734 (742)
Q Consensus       681 r~~~~~~p~vL~mSATPiprtla~~l~gdl~~s~I~e~P~gr~~i~t~~~~~~~  734 (742)
                          ...+++|+|||||+|+++++..+|+++++.++++|++|.+|.+.++..+.
T Consensus       514 ----~~~~~vL~mSATp~p~tl~~~~~g~~~~s~i~~~p~~r~~i~~~~~~~~~  563 (780)
T 1gm5_A          514 ----GKMVDTLVMSATPIPRSMALAFYGDLDVTVIDEMPPGRKEVQTMLVPMDR  563 (780)
T ss_dssp             ----SSCCCEEEEESSCCCHHHHHHHTCCSSCEEECCCCSSCCCCEECCCCSST
T ss_pred             ----CCCCCEEEEeCCCCHHHHHHHHhCCcceeeeeccCCCCcceEEEEeccch
Confidence                13578999999999999999999999999999999999999998876544

PyMOL of 1gm5

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens}	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens}	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens}	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19	Back alignment and structure

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A	Back alignment and structure

>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens}	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens}	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae}	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens}	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B*	Back alignment and structure

>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus}	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A*	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ...	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B*	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1*	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A*	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A*	Back alignment and structure

>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str}	Back alignment and structure

>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A*	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B*	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii}	Back alignment and structure

>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A*	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3mab_A Uncharacterized protein; NYSGXRC, PSI-2, structural genomics; 1.42A {Listeria monocytogenes} PDB: 3bqt_A	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19	Back alignment and structure

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}	Back alignment and structure

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A*	Back alignment and structure

>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2k75_A Uncharacterized protein TA0387; closed beta barrel, OB fold, structural genomics, PSI-2, protein structure initiative; NMR {Thermoplasma acidophilum}	Back alignment and structure

>1im4_A DBH; DNA polymerase PALM, thumb, fingers, helix-hairpin-helix, fidelity, processivity, transferase; 2.30A {Sulfolobus solfataricus} SCOP: e.8.1.7	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli}	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3gfk_B DNA-directed RNA polymerase subunit alpha; protein-protein complex, cytoplasm, redox-active center, stress response, transcription; 2.30A {Bacillus subtilis} SCOP: a.60.3.1	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2kbn_A Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A	Back alignment and structure

>4dez_A POL IV 1, DNA polymerase IV 1; Y-family, transferase; HET: DNA; 2.60A {Mycobacterium smegmatis}	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>1jx4_A DNA polymerase IV (family Y); protein-DNA complex, Y-family, transferase-D complex; HET: DNA MSE ADI; 1.70A {Sulfolobus solfataricus} SCOP: d.240.1.1 e.8.1.7 PDB: 1jxl_A* 1n48_A* 1n56_A* 1ryr_A* 1rys_A* 1s0m_A* 1s0n_A* 1s0o_A* 1s10_A* 1s97_A* 1s9f_A* 2ia6_A* 2ibk_A* 2r8g_A* 2r8h_A* 2r8i_A* 2rdj_A* 3fds_A* 3m9m_B* 3m9n_B* ...	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>3bq0_A POL IV, DBH, DNA polymerase IV; Y-family, lesion bypass; HET: DNA; 2.60A {Sulfolobus acidocaldarius} SCOP: d.240.1.1 e.8.1.7 PDB: 3bq1_A* 3bq2_A* 1k1q_A 1k1s_A	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>1z3e_B DNA-directed RNA polymerase alpha chain; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: a.60.3.1 PDB: 3ihq_B	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>3k4g_A DNA-directed RNA polymerase subunit alpha; bacterial transcription regulation, DNA-directed RNA polymer nucleotidyltransferase; HET: MLY; 2.05A {Escherichia coli k-12} SCOP: a.60.3.1 PDB: 3n4m_B* 1lb2_B* 3n97_B* 1xs9_D	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3osn_A DNA polymerase IOTA; hoogsteen base PAIR, protein-DNA complex, Y-family DNA polym translesion synthesis, nucleoside triphosphate; HET: DNA DOC 6OG TTP; 1.90A {Homo sapiens} PDB: 2dpj_A* 2fll_A* 2fln_A* 2flp_A* 3epg_A* 3epi_A* 2dpi_A* 3g6v_A* 3g6y_A* 3g6x_A* 3gv7_B* 3gv8_B* 3ngd_A* 3gv5_B* 3q8p_B* 3q8q_B* 3q8r_B* 3q8s_B* 4ebc_A* 4ebd_A* ...	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>4f4y_A POL IV, DNA polymerase IV; Y-family polymerase, transferase-DNA complex; HET: DNA DCP; 2.34A {Sulfolobus acidocaldarius} PDB: 3bq0_A* 3bq1_A* 3bq2_A* 4hyk_A* 1k1q_A 1k1s_A	Back alignment and structure

>1ci4_A Protein (barrier-TO-autointegration factor (BAF) ); DNA binding protein, retroviral integration, preintegration complex; 1.90A {Homo sapiens} SCOP: a.60.5.1 PDB: 1qck_A 2bzf_A 2ezx_A 2ezy_A 2ezz_A 2odg_A	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>3pzp_A DNA polymerase kappa; DNA nucleotidyltransferase, DNA binding nucleotide binding M binding, nucleus; HET: DNA TTD DTP; 3.34A {Homo sapiens}	Back alignment and structure

>3gqc_A DNA repair protein REV1; protein-DNA complex, DNA damage, DNA repair, DNA synthesis, binding, magnesium, metal-binding; HET: DNA DOC DCP; 2.50A {Homo sapiens}	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>2aq4_A DNA repair protein REV1; polymerase, PAD, N-digit, G-loop, transferase; HET: DNA DOC DCP; 2.32A {Saccharomyces cerevisiae} PDB: 3bjy_A* 3osp_A*	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>1t94_A Polymerase (DNA directed) kappa; replication, DNA repair, Y-family DNA polymerase, translesion DNA synthesis, lesion bypass; 2.40A {Homo sapiens} SCOP: d.240.1.1 e.8.1.7 PDB: 2oh2_A* 2w7o_A* 2w7p_A* 3hed_A* 3in5_A*	Back alignment and structure

>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_A 1quq_A 1l1o_B	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>4ecq_A DNA polymerase ETA; transferase-DNA complex; HET: DNA DTP; 1.50A {Homo sapiens} PDB: 3mr2_A* 3mr4_A* 3mr5_A* 3si8_A* 4dl2_A* 4dl3_A* 4dl4_A* 4dl5_A* 4dl6_A* 4dl7_A* 3mr3_A* 4ecr_A* 4ecs_A* 4ect_A* 4ecu_A* 4ecv_A* 4ecw_A* 4ecx_A* 4ecy_A* 4ecz_A* ...	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>4gop_B Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis}	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1	Back alignment and structure

>1coo_A RNA polymerase alpha subunit; transcription regulation, nucleotidyl transferase; NMR {Escherichia coli} SCOP: a.60.3.1 PDB: 2jzb_A	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		742
d1gm5a3		264	c.37.1.19 (A:286-549) RecG helicase domain {Thermo	2e-51
d2eyqa3		233	c.37.1.19 (A:546-778) Transcription-repair couplin	1e-32
d1gm5a2		180	b.40.4.9 (A:106-285) RecG "wedge" domain {Thermoto	3e-13
d1wp9a1		200	c.37.1.19 (A:1-200) putative ATP-dependent RNA hel	3e-10
d2bmfa2		305	c.37.1.14 (A:178-482) Dengue virus helicase {Dengu	5e-09
d1a1va1		136	c.37.1.14 (A:190-325) HCV helicase domain {Human h	4e-08
d2p6ra3		202	c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus	1e-06
d1gkub1		237	c.37.1.16 (B:1-250) Helicase-like "domain" of reve	2e-06
d1yksa1		140	c.37.1.14 (A:185-324) YFV helicase domain {Yellow	2e-05

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 264	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecG helicase domain
species: Thermotoga maritima [TaxId: 2336]

 Score =  178 bits (451), Expect = 2e-51
 Identities = 109/308 (35%), Positives = 153/308 (49%), Gaps = 44/308 (14%)

Query: 413 DPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLG 472
           + +P+ I ++  LL + DAY G+H PK     + AR+RL ++E F LQL           
Sbjct: 1   ETLPERILEKRKLLGVKDAYYGMHFPKTFYHLEKARERLAYEELFVLQLAFQKIR----- 55

Query: 473 TQFEKEGLLDKYRKPRLNAAYMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVP 532
                        + +      +    L ++ +++LP+ LT++Q  A  EI  D+    P
Sbjct: 56  -----------KEREKHGGIPKKIEGKLAEEFIKSLPFKLTNAQKRAHQEIRNDMISEKP 104

Query: 533 MNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELLATQHYEHLLKLLDNMEEDKH 592
           MNRLLQGDVG GKTVVA LA ++   +G+Q AFMVPT +LA QHY   ++          
Sbjct: 105 MNRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVESFSKFNIHVA 164

Query: 593 KPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGV 652
                    +T   +   I+  L+ G I +VIGTH+LI E V F  L L I+DEQ RFGV
Sbjct: 165 LLIG-----ATTPSEKEKIKSGLRNGQIDVVIGTHALIQEDVHFKNLGLVIIDEQHRFGV 219

Query: 653 VQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSL 712
            QR    +K                             L MSATPIPR++ALA YGD+ +
Sbjct: 220 KQREALMNK-----------------------GKMVDTLVMSATPIPRSMALAFYGDLDV 256

Query: 713 TQITDLPP 720
           T I ++PP
Sbjct: 257 TVIDEMPP 264

PyMOL of d1gm5a3

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 233	Back information, alignment and structure

>d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} Length = 180	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		742
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	100.0
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	100.0
d1gm5a2		180	RecG "wedge" domain {Thermotoga maritima [TaxId: 2	99.96
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.87
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	99.87
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	99.86
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.86
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	99.85
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.85
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	99.84
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	99.83
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	99.83
d1wrba1		238	putative ATP-dependent RNA helicase VlgB {Flatworm	99.82
d1oywa2		206	RecQ helicase domain {Escherichia coli [TaxId: 562	99.81
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.79
d1rifa_		282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	99.72
d1q0ua_		209	Probable DEAD box RNA helicase YqfR {Bacillus stea	99.72
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.71
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	99.64
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	99.59
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	99.48
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	99.3
d1z63a1		230	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	99.2
d1tf5a3		273	Translocation ATPase SecA, nucleotide-binding doma	98.54
d1nkta3		288	Translocation ATPase SecA, nucleotide-binding doma	98.4
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	98.39
d1t5la1		413	Nucleotide excision repair enzyme UvrB {Bacillus c	97.69
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	97.44
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	97.41
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	97.3
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	97.29
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	97.29
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	97.17
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	96.68
d1c4oa1		408	Nucleotide excision repair enzyme UvrB {Thermus th	96.49
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	96.13
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	96.12
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	96.09
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	95.94
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	95.87
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	95.85
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	95.43
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	95.38
d1vmaa2		213	GTPase domain of the signal recognition particle r	95.3
d2i1qa1		60	DNA repair protein Rad51, N-terminal domain {Archa	95.08
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	94.95
d2qy9a2		211	GTPase domain of the signal recognition particle r	94.92
d1pzna1		61	DNA repair protein Rad51, N-terminal domain {Archa	94.91
d1ls1a2		207	GTPase domain of the signal sequence recognition p	94.76
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	94.54
d2fmpa2		57	DNA polymerase beta {Human (Homo sapiens) [TaxId:	94.45
d1szpa1		64	DNA repair protein Rad51, N-terminal domain {Baker	94.31
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	94.1
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	94.05
d1okkd2		207	GTPase domain of the signal recognition particle r	93.88
d2bcqa2		57	DNA polymerase lambda {Human (Homo sapiens) [TaxId	93.86
d1jmsa3		60	Terminal deoxynucleotidyl transferase {Mouse (Mus	93.66
d1jx4a2		240	DinB homolog (DBH) {Archaeon Sulfolobus solfataric	93.43
d1z5za1		244	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	93.12
d1j8yf2		211	GTPase domain of the signal sequence recognition p	92.66
d1zeta2		273	DNA polymerase iota {Human (Homo sapiens) [TaxId:	92.64
d1im4a_		209	DinB homolog (DBH) {Archaeon Sulfolobus solfataric	92.61
d1doqa_		69	C-terminal domain of RNA polymerase alpha subunit	91.96
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	90.95
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	90.8
d1t94a2		333	DNA polymerase kappa {Human (Homo sapiens) [TaxId:	90.69
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	90.48
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	90.45
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	90.15
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	90.14
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	89.81
d1z3eb1		67	C-terminal domain of RNA polymerase alpha subunit	89.79
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	89.32
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	89.21
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	89.16
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	89.02
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	88.68
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	88.66
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	88.66
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	88.44
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	88.25
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	88.03
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	87.93
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	87.8
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	87.15
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	86.97
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	86.68
d1b22a_		70	DNA repair protein Rad51, N-terminal domain {Human	86.22
d1lb2b_		72	C-terminal domain of RNA polymerase alpha subunit	85.98
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	85.91
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	85.23
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	85.17
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	84.75
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	84.62
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	84.49
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	84.32
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	84.27
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	83.98
d1w36b1		485	Exodeoxyribonuclease V beta chain (RecB), N-termin	83.58
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	83.49
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	83.34
d1o7ia_		115	Archaeal ssDNA-binding protein {Archaeon Sulfolobu	83.32
d2p6ra2		198	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	83.24
d1z3ix1		346	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	83.22
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	82.9
d1ci4a_		89	Barrier-to-autointegration factor, BAF {Human (Hom	82.85
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	82.83
d2pi2a1		128	Replication protein A 32 KDa subunit (RPA32) fragm	82.79
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	81.86
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	81.82
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	81.67
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	81.41
d1byia_		224	Dethiobiotin synthetase {Escherichia coli [TaxId:	81.2
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	80.87
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	80.66
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	80.22
d1v1qa_		111	Primosomal replication protein N, PriB {Escherichi	80.08
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	80.04
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	80.04

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecG helicase domain
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=1.8e-60  Score=496.01  Aligned_cols=264  Identities=44%  Similarity=0.665  Sum_probs=237.2

Q ss_pred             CCCCHhHHhhcCCCCHHHHHHhccCCCCcchHHHHHHhhchhHHHHHHHHHHHHHHhhcccchhhchhhhhccccccccc
Q 045263          413 DPVPKEITQEFGLLCLFDAYMGIHQPKHIDEADLARKRLIFDEFFYLQLGRLYQMLEGLGTQFEKEGLLDKYRKPRLNAA  492 (742)
Q Consensus       413 d~LP~~l~~k~~l~~~~~Al~~IH~P~~~~~~~~Ar~Rl~f~El~~~ql~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  492 (742)
                      |+||++++++|+|+++.+|++.||+|++.++++.||+||+|||+|++|+.+...+...           ++...     .
T Consensus         1 E~LP~~il~k~~l~s~~~Al~~IH~P~~~~~l~~Ar~RL~fdEl~~~qL~l~~~k~~~-----------~~~~~-----~   64 (264)
T d1gm5a3           1 ETLPERILEKRKLLGVKDAYYGMHFPKTFYHLEKARERLAYEELFVLQLAFQKIRKER-----------EKHGG-----I   64 (264)
T ss_dssp             CCSCHHHHHHHCCCCSHHHHHHHHSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHCC-----C
T ss_pred             CCCCHHHHHHcCCCCHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh-----------hhccc-----c
Confidence            7899999999999999999999999999999999999999999999999886544311           11111     1


Q ss_pred             cccCchHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCCCCCceEEEccCCChHHHHHHHHHHHHHhcCCeEEEEcccHHH
Q 045263          493 YMEGWSSLTKKLLRALPYSLTSSQLSAISEIIWDLKQPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFMVPTELL  572 (742)
Q Consensus       493 ~~~~~~~l~~~~~~~lpf~Lt~~Q~~aI~~I~~~~~~~~~~~~LL~a~TGSGKT~val~ail~~l~~g~qvlilaPT~~L  572 (742)
                      ......++.+.|.+.+||+||+.|++|+++|.+++.++.+|++||+|+||||||.||+.+++.++.+|+|+++|+||+.|
T Consensus        65 ~~~~~~~l~~~f~~~LPFeLT~~Q~~ai~ei~~d~~~~~~m~rLL~GdvGSGKT~Va~~a~~~~~~~g~q~~~m~Pt~~L  144 (264)
T d1gm5a3          65 PKKIEGKLAEEFIKSLPFKLTNAQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAGFQTAFMVPTSIL  144 (264)
T ss_dssp             CCCCCTHHHHHHHHHSSSCCCHHHHHHHHHHHHHHHSSSCCCCEEECCSSSSHHHHHHHHHHHHHHHTSCEEEECSCHHH
T ss_pred             ccCCChHHHHHHHhhccccCCchHHHHHHHHHHHhhccCcceeeeeccccccccHHHHHHHHHHHhcccceeEEeehHhh
Confidence            22334678899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhhccCCCCCcEEEEEeCCCChHHHHHHHHHhhcCCccEEEechHHHhhccccCCccEEEEeCCccccc
Q 045263          573 ATQHYEHLLKLLDNMEEDKHKPKIALLTGSTPVKQSRMIRKDLQTGDITLVIGTHSLIAEKVEFSALRLAIVDEQQRFGV  652 (742)
Q Consensus       573 a~Q~~~~l~~~l~~~~~~~~~i~V~ll~G~~~~~er~~i~~~l~~G~~~IVVgT~~~l~~~v~~~~l~LVIIDEaHrfG~  652 (742)
                      |.||++++++++..++     +.+++++|+.+.++|..+|.++.+|+++||||||+++++.++|+++|||||||+|+||+
T Consensus       145 a~Qh~~~~~~~f~~~~-----~~v~~l~~~~~~~~r~~~~~~~~~g~~~iiIGThsl~~~~~~f~~LglviiDEqH~fgv  219 (264)
T d1gm5a3         145 AIQHYRRTVESFSKFN-----IHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTHALIQEDVHFKNLGLVIIDEQHRFGV  219 (264)
T ss_dssp             HHHHHHHHHHHHTCSS-----CCEEECCSSSCHHHHHHHHHHHHSSCCCEEEECTTHHHHCCCCSCCCEEEEESCCCC--
T ss_pred             hHHHHHHHHHhhhhcc-----ccceeeccccchHHHHHHHHHHHCCCCCEEEeehHHhcCCCCccccceeeeccccccch
Confidence            9999999999999888     89999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhhhhhhhccccccccccccCCCCCCCCCCCCCcEEEEcCCCCHHHHHHHHcCCCCeeeeccCCC
Q 045263          653 VQRGRFNSKLYYTSMSSGMAMVNSDGSPKDDQHMAPHVLAMSATPIPRTLALALYGDMSLTQITDLPP  720 (742)
Q Consensus       653 ~qr~~l~~k~~~~~~~~~~~~~~~~~~~r~~~~~~p~vL~mSATPiprtla~~l~gdl~~s~I~e~P~  720 (742)
                      +||..+..+.                       ..+|+|+|||||||||++++.||++|+|.|+++||
T Consensus       220 ~Qr~~l~~~~-----------------------~~~~~l~~SATPiprtl~~~~~g~~~~s~i~e~Pp  264 (264)
T d1gm5a3         220 KQREALMNKG-----------------------KMVDTLVMSATPIPRSMALAFYGDLDVTVIDEMPP  264 (264)
T ss_dssp             ---CCCCSSS-----------------------SCCCEEEEESSCCCHHHHHHHTCCSSCEEECCCCS
T ss_pred             hhHHHHHHhC-----------------------cCCCEEEEECCCCHHHHHHHHcCCCCeEeeCCCCC
Confidence            9998776541                       35799999999999999999999999999999997

PyMOL of d1gm5a3

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jx4a2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}	Back information, alignment and structure

>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1zeta2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1im4a_ e.8.1.7 (A:) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1doqa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1z3eb1 a.60.3.1 (B:245-311) C-terminal domain of RNA polymerase alpha subunit {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lb2b_ a.60.3.1 (B:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ci4a_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2pi2a1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure