Citrus Sinensis ID: 045282
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| 449532246 | 102 | PREDICTED: uncharacterized protein LOC10 | 0.753 | 0.960 | 0.397 | 7e-13 | |
| 357451233 | 123 | hypothetical protein MTR_2g063010 [Medic | 0.892 | 0.943 | 0.401 | 1e-12 | |
| 356534649 | 121 | PREDICTED: uncharacterized protein LOC10 | 0.892 | 0.958 | 0.347 | 1e-12 | |
| 356537423 | 121 | PREDICTED: uncharacterized protein LOC10 | 0.892 | 0.958 | 0.336 | 1e-12 | |
| 226498470 | 145 | LGC1 precursor [Zea mays] gi|195610960|g | 0.753 | 0.675 | 0.41 | 4e-12 | |
| 308044199 | 145 | uncharacterized protein LOC100501726 pre | 0.753 | 0.675 | 0.41 | 5e-12 | |
| 449437170 | 121 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.991 | 0.316 | 5e-12 | |
| 224080576 | 145 | predicted protein [Populus trichocarpa] | 0.861 | 0.772 | 0.361 | 8e-12 | |
| 388521591 | 124 | unknown [Lotus japonicus] | 0.946 | 0.991 | 0.377 | 2e-11 | |
| 357142390 | 134 | PREDICTED: uncharacterized protein LOC10 | 0.715 | 0.694 | 0.425 | 2e-11 |
| >gi|449532246|ref|XP_004173093.1| PREDICTED: uncharacterized protein LOC101230172, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 78.6 bits (192), Expect = 7e-13, Method: Compositional matrix adjust.
Identities = 39/98 (39%), Positives = 57/98 (58%)
Query: 30 CPPETLDISQKETGNIVQGKKEFAVEVFNWCKCAQRNVTLDCDGFQTVEKPDPVQMSISG 89
C + ISQ TG+IVQGK+ + + N C C Q ++ LDC+GF TV+ DP +++SG
Sbjct: 4 CVLNDIAISQTTTGSIVQGKQVWKATITNNCICGQSSLKLDCNGFNTVQAVDPSILAVSG 63
Query: 90 FQCILLQGRDIIPFSRVHFKYAFDDEFPFYVFSSAPIC 127
C++ G+ I + + F YA D+ FPF SS C
Sbjct: 64 SVCLVNGGQPIFQSTPISFTYASDNAFPFKPLSSQISC 101
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357451233|ref|XP_003595893.1| hypothetical protein MTR_2g063010 [Medicago truncatula] gi|355484941|gb|AES66144.1| hypothetical protein MTR_2g063010 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356534649|ref|XP_003535865.1| PREDICTED: uncharacterized protein LOC100818721 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356537423|ref|XP_003537227.1| PREDICTED: uncharacterized protein LOC100803432 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|226498470|ref|NP_001147392.1| LGC1 precursor [Zea mays] gi|195610960|gb|ACG27310.1| LGC1 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|308044199|ref|NP_001183325.1| uncharacterized protein LOC100501726 precursor [Zea mays] gi|238010784|gb|ACR36427.1| unknown [Zea mays] gi|413918147|gb|AFW58079.1| LGC1 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|449437170|ref|XP_004136365.1| PREDICTED: uncharacterized protein LOC101211234 [Cucumis sativus] gi|449525405|ref|XP_004169708.1| PREDICTED: uncharacterized protein LOC101223676 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224080576|ref|XP_002306168.1| predicted protein [Populus trichocarpa] gi|222849132|gb|EEE86679.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388521591|gb|AFK48857.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|357142390|ref|XP_003572556.1| PREDICTED: uncharacterized protein LOC100828807 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| TAIR|locus:2116612 | 124 | AT4G32110 [Arabidopsis thalian | 0.938 | 0.983 | 0.335 | 4.4e-13 | |
| TAIR|locus:505006542 | 124 | AT4G32105 [Arabidopsis thalian | 0.946 | 0.991 | 0.341 | 5e-12 | |
| TAIR|locus:2116707 | 122 | AT4G32100 [Arabidopsis thalian | 0.930 | 0.991 | 0.314 | 3.6e-09 | |
| TAIR|locus:2116702 | 124 | AT4G32090 [Arabidopsis thalian | 0.769 | 0.806 | 0.276 | 4.2e-08 |
| TAIR|locus:2116612 AT4G32110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 172 (65.6 bits), Expect = 4.4e-13, P = 4.4e-13
Identities = 43/128 (33%), Positives = 62/128 (48%)
Query: 1 MAVLVQKILYATLFLALISETMSQPEQGPCPPETLDISQKETGNIVQGKKEFAVEVFNWC 60
MA K+L LFLA +++ G C +L + Q +TG +VQ K E+ V V N C
Sbjct: 1 MASNACKLLCLVLFLAFVNQGY-----GDCSLNSLSVKQSKTGKLVQNKPEWEVRVTNPC 55
Query: 61 K-CAQRNVTLDCDGFQTVEKPDPVQMSISGFQCILLQGRDIIPFSRVHFKYAFDDEFPFY 119
C +N L C GF +V D + SG C++ G+ I+P + FKY +D F
Sbjct: 56 NNCKFQNTELLCVGFNSVTPIDTSLLLKSGDACLVNAGKFIVPHVDIVFKYVWDTSFDLK 115
Query: 120 VFSSAPIC 127
V +C
Sbjct: 116 VIDGVMVC 123
|
|
| TAIR|locus:505006542 AT4G32105 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116707 AT4G32100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116702 AT4G32090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_IV001418 | hypothetical protein (145 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| PF09478 | 80 | CBM49: Carbohydrate binding domain CBM49; InterPro | 97.1 | |
| PLN02171 | 629 | endoglucanase | 92.74 |
| >PF09478 CBM49: Carbohydrate binding domain CBM49; InterPro: IPR019028 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity | Back alignment and domain information |
|---|
Probab=97.10 E-value=0.0044 Score=41.92 Aligned_cols=73 Identities=16% Similarity=0.172 Sum_probs=56.1
Q ss_pred ceEEEeeecCccCC---eeeEEEEEeeccccccceEEEecCCccc-cccCCCcceeEeCCeeEEeCC-cccCCCCeEEEE
Q 045282 35 LDISQKETGNIVQG---KKEFAVEVFNWCKCAQRNVTLDCDGFQT-VEKPDPVQMSISGFQCILLQG-RDIIPFSRVHFK 109 (130)
Q Consensus 35 i~V~Q~~tg~~v~G---~pe~~VtI~N~C~C~~~~V~l~C~gF~S-~~~VDP~ifr~~~~~CLVn~G-~pi~~g~~v~F~ 109 (130)
|+|.|..+..+..| ..+|.|+|+|.+.=+++++++.-+.+.+ .= .+-+..++..-+=+- .+|.+|++.+|-
T Consensus 1 i~i~q~~~~sW~~~g~~y~qy~v~I~N~~~~~I~~~~i~~~~l~~~iW----~l~~~~~~~y~lPs~~~~i~pg~s~~FG 76 (80)
T PF09478_consen 1 ITITQTLVNSWTENGQTYTQYDVTITNNGSKPIKSLKISIDNLYGSIW----GLDKVSGNTYTLPSYQPTIKPGQSFTFG 76 (80)
T ss_pred CEEEEEEEeEEEeCCEEEEEEEEEEEECCCCeEEEEEEEECccchhhe----eEEeccCCEEECCccccccCCCCEEEEE
Confidence 68899999888775 3579999999999999999999987651 11 222334577777454 399999999999
Q ss_pred Ec
Q 045282 110 YA 111 (130)
Q Consensus 110 YA 111 (130)
|-
T Consensus 77 YI 78 (80)
T PF09478_consen 77 YI 78 (80)
T ss_pred EE
Confidence 84
|
A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This domain is found at the C-terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose []. ; GO: 0030246 carbohydrate binding, 0005576 extracellular region |
| >PLN02171 endoglucanase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00