Citrus Sinensis ID: 045342

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MDVYNKFISPQLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFRCL
cccccccccccccccccccHHHHHHHHHccccccHHccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccHHHHHHHHHHHccccccHHHHHcccccccccccccHHHHHHHHHHHHHccccHEHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHEHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
mdvynkfispqlidestKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVqnidgktaQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATactvpggniesgnpiflRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLhdrskwltipilasvpLTIHALLQLPLFVQMYQstygsdifrcl
mdvynkfispqlidesTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFRCL
MDVYNKFISPQLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFRCL
*****KFISPQLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFR**
*DVYNKFISPQLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLK**************************KWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFRCL
MDVYNKFISPQLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFRCL
MDVYNKFISPQLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFRCL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
ooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVYNKFISPQLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKWLTIPILASVPLTIHALLQLPLFVQMYQSTYGSDIFRCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.604 0.249 0.235 7e-05
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 83/174 (47%), Gaps = 27/174 (15%)

Query: 32  THLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKDFLENSEKWMKYTSN 91
           T ++  + + L+  +   K VH+  K+++ +            H++ + N+       +N
Sbjct: 380 TQIKNDVHIQLEQTKRTNKNVHNISKELRKL------------HREGINNA-------TN 420

Query: 92  SCMVVTALIATMMFATACTVPGGNIESGNPIFLRDKLFMVFAISYALGFIFTSTPLLVFV 151
           S  VV  L AT+ FA   TVPGG+   G+ + +    F +F I  AL    +   ++V +
Sbjct: 421 SVTVVAVLFATVAFAAIFTVPGGDNNDGSAVVVGRASFKIFFIFNALALFTSLAVVVVQI 480

Query: 152 SIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIVLHDRSKW 205
           ++   +   +   VE + K  ++ LAS+  S      ++F+A+  IV+  +++W
Sbjct: 481 TLVRGETKAEKRVVEVINK--LMWLASMCTS------VAFLASSYIVVGRKNEW 526

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.925 0.285 0.481 2e-49
297737987 1855 unnamed protein product [Vitis vinifera] 0.925 0.121 0.481 3e-49
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.925 0.132 0.481 3e-49
224136692 743 predicted protein [Populus trichocarpa] 0.901 0.294 0.469 1e-48
297740805 702 unnamed protein product [Vitis vinifera] 0.921 0.319 0.459 2e-47
359483665 762 PREDICTED: ankyrin repeat-containing pro 0.921 0.293 0.459 4e-47
388520487210 unknown [Lotus japonicus] 0.814 0.942 0.522 1e-45
224131182 543 predicted protein [Populus trichocarpa] 0.905 0.405 0.463 6e-45
225449663 757 PREDICTED: uncharacterized protein LOC10 0.925 0.297 0.474 7e-45
255565315233 hypothetical protein RCOM_0892190 [Ricin 0.876 0.914 0.468 7e-45
>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 156/237 (65%), Gaps = 12/237 (5%)

Query: 15  ESTKDNILHLAAKLALPTHLRIMLGVALKMQRE------VEKLVHHFLKKVQNIDGKTAQ 68
           +   +N+LHLA KLA    L+I  G A ++QRE      VEK++     +++N  G+T Q
Sbjct: 486 DEKNNNMLHLAGKLAPSNRLKIDSGAAFQLQRELHWFKEVEKIIQPSYTEMKNEQGRTPQ 545

Query: 69  DIFIEQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGGN-IESGNPIFLRDK 127
            +F E+HKD +   EKWMK T++SCMVV  LIAT+MFA A +VPGGN  ++G PIFL  K
Sbjct: 546 ILFTEEHKDLVREGEKWMKDTASSCMVVATLIATVMFAAAFSVPGGNDDDTGRPIFLTKK 605

Query: 128 LFMVFAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNM 187
            F+VFAIS AL    ++T +L+F+SI  ++YAE+D F+ESL  +LIIGLA+LFI S+  M
Sbjct: 606 SFLVFAISDALALFSSATSILIFLSILTSRYAEED-FLESLPNRLIIGLATLFI-SVATM 663

Query: 188 MISFVATFSIVLHDRSKWLTIP--ILASVPLTIHALLQLPLFVQMYQSTYGSD-IFR 241
           MI+F AT  IVL     W+  P  ++A VP+T+  LL+ PLF+ M    Y S  IFR
Sbjct: 664 MIAFCATLFIVLGPELVWVANPMALVACVPVTLFPLLKFPLFIDMISHRYRSSIIFR 720

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136692|ref|XP_002322392.1| predicted protein [Populus trichocarpa] gi|222869388|gb|EEF06519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297740805|emb|CBI30987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483665|ref|XP_003632996.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|388520487|gb|AFK48305.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224131182|ref|XP_002328475.1| predicted protein [Populus trichocarpa] gi|222838190|gb|EEE76555.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225449663|ref|XP_002263810.1| PREDICTED: uncharacterized protein LOC100260956 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565315|ref|XP_002523649.1| hypothetical protein RCOM_0892190 [Ricinus communis] gi|223537101|gb|EEF38735.1| hypothetical protein RCOM_0892190 [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.901 0.363 0.393 1.8e-34
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.905 0.634 0.351 2.5e-33
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.934 0.339 0.362 6.3e-33
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.897 0.379 0.351 2.3e-29
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.925 0.36 0.325 5e-27
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.670 0.268 0.265 4.3e-05
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.588 0.242 0.302 4.7e-05
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.654 0.292 0.258 0.00017
TAIR|locus:2157548 480 AT5G54700 "AT5G54700" [Arabido 0.518 0.262 0.262 0.00027
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 378 (138.1 bits), Expect = 1.8e-34, P = 1.8e-34
 Identities = 91/231 (39%), Positives = 133/231 (57%)

Query:    19 DNILHLAAKLALPTHLRIMLGVALKMQRE------VEKLVHHFLKKVQNIDGKTAQDIFI 72
             +NILH+A +L+ P  L  + G ALKMQRE      VE LV       +N D KT + IF 
Sbjct:   367 NNILHIAGRLSTPDQLSKISGAALKMQRESQWFKEVESLVSEREVVQKNKDNKTPRQIFE 426

Query:    73 EQHKDFLENSEKWMKYTSNSCMVVTALIATMMFATACTVPGG-NIESGNPIFLRDKLFMV 131
               H+   +  E+WMKYT+ +C  V ALIAT+ F    TVPGG +  SG+P+ L D  F  
Sbjct:   427 HYHEHLRKEGEEWMKYTATACSFVAALIATVTFQAIFTVPGGIDGTSGSPLILNDLHFRA 486

Query:   132 FAISYALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISF 191
             F  +  L F  +   +L+F+SI  ++Y+  D+ V SL +K+I+G + LFIS I +M+++F
Sbjct:   487 FIFTDTLAFFASCISVLIFLSILTSRYSFDDFIV-SLPRKMILGQSILFIS-IASMLVAF 544

Query:   192 VATFSIVLHDRSKWLTIPI--LASVPLTIHALLQLPLFVQMYQSTYGSDIF 240
             + + S  +  +   L  P+  LAS P  +  +LQ PL  +M  STYG  +F
Sbjct:   545 ITSLSASMRHKPA-LVYPLKPLASFPSLLFLMLQYPLLKEMISSTYGKRLF 594
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157548 AT5G54700 "AT5G54700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
pfam13962114 pfam13962, PGG, Domain of unknown function 2e-16
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score = 72.5 bits (179), Expect = 2e-16
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 16/123 (13%)

Query: 83  EKWMKYTSNSCMVVTALIATMMFATACTVPGGNIES------GNPIFLRDK-LFMVFAIS 135
            +W++ T NS +VV  LIAT+ FA   T PGG  +       G PI       F  F +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 136 YALGFIFTSTPLLVFVSIQIAQYAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATF 195
             + F+ +   +++ + I          F   L  +L+  L  L++ S++++M++F A  
Sbjct: 61  NTIAFVASLVAVILLLYIV-------PSFSRRL-PRLLALLTLLWL-SLLSLMVAFAAGS 111

Query: 196 SIV 198
             V
Sbjct: 112 YRV 114

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
PF13962113 PGG: Domain of unknown function 99.94
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.21
PHA02741169 hypothetical protein; Provisional 97.07
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 96.83
PHA02736154 Viral ankyrin protein; Provisional 96.47
PHA02946446 ankyin-like protein; Provisional 96.3
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 96.18
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 96.14
PHA02946 446 ankyin-like protein; Provisional 95.98
PHA02736154 Viral ankyrin protein; Provisional 95.75
PHA02743166 Viral ankyrin protein; Provisional 95.75
KOG4412226 consensus 26S proteasome regulatory complex, subun 95.71
PHA02859209 ankyrin repeat protein; Provisional 95.56
KOG0508615 consensus Ankyrin repeat protein [General function 95.56
PHA03095471 ankyrin-like protein; Provisional 95.54
KOG0510 929 consensus Ankyrin repeat protein [General function 95.31
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 95.02
PHA02798489 ankyrin-like protein; Provisional 95.02
PHA03100480 ankyrin repeat protein; Provisional 94.94
PHA02795437 ankyrin-like protein; Provisional 94.93
PHA02741169 hypothetical protein; Provisional 94.82
PHA02989494 ankyrin repeat protein; Provisional 94.71
KOG0510 929 consensus Ankyrin repeat protein [General function 94.7
PF1360630 Ank_3: Ankyrin repeat 94.4
PLN03192823 Voltage-dependent potassium channel; Provisional 94.24
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 94.18
PHA03095471 ankyrin-like protein; Provisional 94.02
PLN03192823 Voltage-dependent potassium channel; Provisional 93.99
PHA02874434 ankyrin repeat protein; Provisional 93.98
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 93.96
KOG0512228 consensus Fetal globin-inducing factor (contains a 93.9
PHA02878477 ankyrin repeat protein; Provisional 93.83
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 93.67
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 93.54
PHA02875413 ankyrin repeat protein; Provisional 93.52
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 93.5
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 93.49
PHA02730 672 ankyrin-like protein; Provisional 93.3
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 93.16
PHA02798 489 ankyrin-like protein; Provisional 93.13
PHA02874434 ankyrin repeat protein; Provisional 92.88
TIGR00870 743 trp transient-receptor-potential calcium channel p 92.84
PHA02716764 CPXV016; CPX019; EVM010; Provisional 92.53
PHA02791284 ankyrin-like protein; Provisional 92.35
PHA02791284 ankyrin-like protein; Provisional 92.33
KOG4412226 consensus 26S proteasome regulatory complex, subun 92.25
PHA02743166 Viral ankyrin protein; Provisional 91.85
PHA02878477 ankyrin repeat protein; Provisional 91.83
PHA02876 682 ankyrin repeat protein; Provisional 91.82
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 91.73
PHA02876682 ankyrin repeat protein; Provisional 91.57
PHA02859209 ankyrin repeat protein; Provisional 91.51
PHA02884300 ankyrin repeat protein; Provisional 91.48
KOG0508 615 consensus Ankyrin repeat protein [General function 91.4
KOG0522 560 consensus Ankyrin repeat protein [General function 91.39
PHA02792631 ankyrin-like protein; Provisional 91.33
PHA02917661 ankyrin-like protein; Provisional 91.17
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 91.08
PHA02875413 ankyrin repeat protein; Provisional 90.42
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 90.15
PHA02917 661 ankyrin-like protein; Provisional 90.09
PHA02730672 ankyrin-like protein; Provisional 89.09
PHA03100 480 ankyrin repeat protein; Provisional 88.9
PHA02989 494 ankyrin repeat protein; Provisional 88.8
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 88.54
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 88.09
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 88.02
KOG0514452 consensus Ankyrin repeat protein [General function 87.5
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 86.31
PHA02884300 ankyrin repeat protein; Provisional 85.65
KOG0514452 consensus Ankyrin repeat protein [General function 85.15
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 84.87
>PF13962 PGG: Domain of unknown function Back     alignment and domain information 
Probab=99.94  E-value=9.2e-27  Score=184.96  Aligned_cols=108  Identities=34%  Similarity=0.623  Sum_probs=96.5

Q ss_pred             HHHHhhhhchhHHHHHHHHHHHhhhhccCCCCCCC----CCcccccCCc-hhhhHHHHhHHHHHHhHHHHHHHHHHHhhh
Q 045342           83 EKWMKYTSNSCMVVTALIATMMFATACTVPGGNIE----SGNPIFLRDK-LFMVFAISYALGFIFTSTPLLVFVSIQIAQ  157 (243)
Q Consensus        83 ~~~~k~~~~s~~vVA~LIaTvtFaaaft~PGG~~~----~G~~~l~~~~-~F~~F~i~d~iA~~~S~~av~~fl~il~s~  157 (243)
                      |||++|++|+++|||+|||||||||++|+|||+++    .|+|++.+++ .|++|+++|++||++|+++++++++-+   
T Consensus         1 ~~~~~~~~~~llVvAtLIATvtF~A~~tpPGG~~~~~~~~G~~il~~~~~~f~~F~~~nt~af~~S~~~i~~l~~~~---   77 (113)
T PF13962_consen    1 KKWLEDTRNSLLVVATLIATVTFQAAFTPPGGYWQDDDDAGTPILAKKPSAFKAFLISNTIAFFSSLAAIFLLISGL---   77 (113)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCccccccCCCCchhccccchhhhHHHHHHHHHHHHHHHHHHHHHHh---
Confidence            58999999999999999999999999999999943    6999999888 999999999999999999998876311   


Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH
Q 045342          158 YAEKDYFVESLQKKLIIGLASLFISSIVNMMISFVATFSIV  198 (243)
Q Consensus       158 ~~~~d~f~~~l~~kl~~gl~~l~~sSi~~m~vAF~ag~~~v  198 (243)
                         ++ +.+..++++..+..++++ |+.+|++||++|+|+|
T Consensus        78 ---~~-~~~~~~~~~~~~~~~~~~-a~~~~~~Af~~g~~~v  113 (113)
T PF13962_consen   78 ---DD-FRRFLRRYLLIASVLMWI-ALISMMVAFAAGIYLV  113 (113)
T ss_pred             ---hh-HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHhccC
Confidence               33 566777788899999999 9999999999999976

>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 97.39
4gpm_A169 Engineered protein OR264; de novo protein, structu 97.31
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 97.09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 97.07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 97.05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 97.02
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 96.97
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 96.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 96.89
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 96.88
3v31_A167 Ankyrin repeat family A protein 2; structural geno 96.85
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 96.81
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 96.8
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 96.78
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 96.77
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 96.76
2rfa_A232 Transient receptor potential cation channel subfa 96.73
3jxi_A260 Vanilloid receptor-related osmotically activated p 96.73
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 96.72
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 96.71
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 96.67
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 96.65
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 96.65
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 96.64
3v30_A172 DNA-binding protein rfxank; structural genomics co 96.63
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 96.62
1awc_B153 Protein (GA binding protein beta 1); complex (tran 96.6
2etb_A256 Transient receptor potential cation channel subfam 96.59
3deo_A183 Signal recognition particle 43 kDa protein; chloro 96.56
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 96.55
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 96.52
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 96.5
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 96.46
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 96.44
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 96.32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 96.28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 96.26
1sw6_A327 Regulatory protein SWI6; transcription regulation, 96.26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 96.21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 96.21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 96.2
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 96.19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 96.18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 96.18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 96.15
4gpm_A169 Engineered protein OR264; de novo protein, structu 96.12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 96.11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 96.1
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 96.06
2pnn_A273 Transient receptor potential cation channel subfa 96.04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 96.04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 96.04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 95.97
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 95.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 95.86
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 95.82
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 95.8
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 95.79
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 95.76
3jxi_A260 Vanilloid receptor-related osmotically activated p 95.72
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 95.69
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 95.65
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 95.64
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 95.64
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 95.61
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 95.6
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 95.6
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 95.52
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 95.5
3hra_A201 Ankyrin repeat family protein; structural protein; 95.47
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 95.45
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 95.4
2etb_A256 Transient receptor potential cation channel subfam 95.37
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 95.36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 95.34
3v30_A172 DNA-binding protein rfxank; structural genomics co 95.33
2rfa_A232 Transient receptor potential cation channel subfa 95.33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 95.29
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 95.28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 95.26
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 95.21
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 95.18
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 95.17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 95.17
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 95.15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 95.11
2pnn_A273 Transient receptor potential cation channel subfa 95.07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 95.07
3hra_A201 Ankyrin repeat family protein; structural protein; 95.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 94.9
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 94.81
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 94.78
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 94.74
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 94.71
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 94.59
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 94.54
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 94.51
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 94.38
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 94.22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 94.06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 93.74
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 93.71
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 93.71
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 93.1
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 92.98
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 92.96
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 91.94
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 91.65
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 91.32
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 90.83
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 88.29
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 87.55
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
Probab=97.39  E-value=0.00011  Score=52.64  Aligned_cols=59  Identities=19%  Similarity=0.232  Sum_probs=40.4

Q ss_pred             hhhhhhhcc----ccccCCCCCchhhhhhhccCCcchhhhhhHHhhcchhhhhhhccccccccCCCCCChHHHHHhh
Q 045342            2 DVYNKFISP----QLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQ   74 (243)
Q Consensus         2 ~~~~~~~~~----~~~D~~G~NT~LHLAa~~~~~~~~~~~~~~aL~m~~eV~~~vp~~~~~~~N~~g~Tp~dif~~~   74 (243)
                      ++.+.|+..    +.+|++| +||||.|++.++.+...      +.    ++.   ....+.+|++|+||.++..+.
T Consensus        16 ~~v~~Ll~~g~~~n~~d~~g-~t~L~~A~~~~~~~~v~------~L----l~~---ga~~~~~d~~g~t~l~~A~~~   78 (93)
T 1n0q_A           16 EVVKLLLEAGADVNAKDKNG-RTPLHLAARNGHLEVVK------LL----LEA---GADVNAKDKNGRTPLHLAARN   78 (93)
T ss_dssp             HHHHHHHHTTCCTTCCCTTS-CCHHHHHHHTTCHHHHH------HH----HHT---TCCTTCCCTTSCCHHHHHHHT
T ss_pred             HHHHHHHHcCCCCcccCCCC-CCHHHHHHHcCCHHHHH------HH----HHc---CCCCCccCCCCCCHHHHHHHc
Confidence            345556653    7899999 99999999988754321      11    111   123577899999999887654
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 97.52
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 97.51
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 97.36
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 97.35
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 97.32
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 97.16
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 97.16
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 97.1
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 97.08
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 97.08
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 96.98
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 96.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 96.72
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 96.71
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 96.69
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 96.62
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 96.56
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 96.46
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 96.41
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 96.4
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 96.4
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 96.27
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 96.23
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 96.08
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 96.08
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 96.02
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 95.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 95.69
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 95.03
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 94.29
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 94.09
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 94.03
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 93.0
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 92.46
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 91.65
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 87.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 85.1
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 80.18
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myosin phosphatase targeting subunit 1, MYPT1
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=97.52  E-value=1.4e-05  Score=65.85  Aligned_cols=67  Identities=24%  Similarity=0.193  Sum_probs=45.5

Q ss_pred             hhhhhhhcc----ccccCCCCCchhhhhhhccCCcchhhhhhHHhhcchhhhhhhccccccccCCCCCChHHHHHhhhHH
Q 045342            2 DVYNKFISP----QLIDESTKDNILHLAAKLALPTHLRIMLGVALKMQREVEKLVHHFLKKVQNIDGKTAQDIFIEQHKD   77 (243)
Q Consensus         2 ~~~~~~~~~----~~~D~~G~NT~LHLAa~~~~~~~~~~~~~~aL~m~~eV~~~vp~~~~~~~N~~g~Tp~dif~~~h~~   77 (243)
                      ++.+.|+..    +.+|++| +||||+|++.++.+...      +.++..       ...+.+|++|+||.++..++..+
T Consensus       213 ~~~~~Ll~~g~din~~~~~g-~TpL~~A~~~g~~~iv~------lLl~~G-------adv~~~d~~G~TaL~~A~e~~~~  278 (291)
T d1s70b_         213 EVLKLLIQARYDVNIKDYDG-WTPLHAAAHWGKEEACR------ILVENL-------CDMEAVNKVGQTAFDVADEDILG  278 (291)
T ss_dssp             HHHHHHHTTTCCTTCCCTTC-CCHHHHHHHTTCHHHHH------HHHHTT-------CCTTCCCTTSCCTTTSCCSGGGH
T ss_pred             hhhcccccceecccccccCC-CCHHHHHHHcCCHHHHH------HHHHCC-------CCCCCcCCCCCCHHHHHHHHHHH
Confidence            345566654    6789999 99999999998765321      112111       13578899999999998776555


Q ss_pred             HHHHH
Q 045342           78 FLENS   82 (243)
Q Consensus        78 l~~~~   82 (243)
                      ++++-
T Consensus       279 ~L~~~  283 (291)
T d1s70b_         279 YLEEL  283 (291)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            55443
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure