Citrus Sinensis ID: 045456


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MPSATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKEKNLSVTINKGEKISDIFEGICLVWEMTCKETEERSSQRGKAERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCNSELRR
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHcccccHHHHHHHHHccccccccEEEEccccEEEEccccEEEEEEEEEEcccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHcHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHccEEEEEEcccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHccHHccEEEEccccccccEEEEEccccEEEEEEccEEEEEEEEEEcccccccccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccEEEcccccccHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHccccEEEEEEcEEcccHHHcc
MPSATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLgglftnhssQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKLkvskttkekNLSVtinkgekisDIFEGICLVWEMTCKEteerssqrgkaERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGhfggdsdrggawgstnldhpatfdkiamdpsmkqasiDDLDRFVKRRNFYRRVGKVWKrgyllfgppgtgksSLIAAMANYLKFNIYdmeltsvycnselrr
MPSATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASleklkvskttkeknlsvtinkgekisdIFEGICLVWEMTCKEteerssqrgkaervielsfpkkyMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYrrvgkvwkrgyllfgppgtgkSSLIAAMANYLKFNIYDMELTSVYCNSELRR
MPSATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKEKNLSVTINKGEKISDIFEGICLVWEMTCKETEERSSQRGKAERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCNSELRR
******VLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKLKVSKT***KNLSVTINKGEKISDIFEGICLVWEMTCK*************RVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKI*********SIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCN*****
**SATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITAS******************INKGEKISDIFEGICLVWEMTC***********KAERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVY*******
********STYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKEKNLSVTINKGEKISDIFEGICLVWEMTC*************ERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCNSELRR
*PSATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKEKNLSVTINKGEKISDIFEGICLVWEMTCKETEERSSQRGKAERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKEKNLSVTINKGEKISDIFEGICLVWEMTCKETEERSSQRGKAERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCNSELRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query288 2.2.26 [Sep-21-2011]
P32839 456 Mitochondrial chaperone B yes no 0.232 0.146 0.402 6e-09
Q54DY9 458 Probable mitochondrial ch no no 0.229 0.144 0.393 6e-08
Q54HY8 421 Probable mitochondrial ch no no 0.25 0.171 0.375 1e-07
Q7ZV60 420 Mitochondrial chaperone B yes no 0.232 0.159 0.373 1e-07
Q9P6Q3 449 Probable mitochondrial ch yes no 0.281 0.180 0.313 3e-07
Q7ZTL7 419 Mitochondrial chaperone B N/A no 0.211 0.145 0.360 2e-06
Q9CZP5 418 Mitochondrial chaperone B yes no 0.343 0.236 0.3 2e-06
Q2SF13 619 ATP-dependent zinc metall yes no 0.232 0.108 0.382 6e-06
Q5E9H5 419 Mitochondrial chaperone B yes no 0.222 0.152 0.343 8e-06
Q9Y276 419 Mitochondrial chaperone B yes no 0.222 0.152 0.343 9e-06
>sp|P32839|BCS1_YEAST Mitochondrial chaperone BCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCS1 PE=1 SV=2 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (65%)

Query: 212 IAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFN 271
           + +D  +K+  +DD+  F+K   +Y   G  ++RGYLL+GPPG+GK+S I A+A  L +N
Sbjct: 228 VILDSGIKEGILDDVYDFMKNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQALAGELDYN 287

Query: 272 IYDMELT 278
           I  + L+
Sbjct: 288 ICILNLS 294




Essential for the expression of the Rieske iron-sulfur protein.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|Q54DY9|BCS1B_DICDI Probable mitochondrial chaperone BCS1-B OS=Dictyostelium discoideum GN=bcsl1b PE=3 SV=1 Back     alignment and function description
>sp|Q54HY8|BCS1A_DICDI Probable mitochondrial chaperone BCS1-A OS=Dictyostelium discoideum GN=bcs1la PE=3 SV=1 Back     alignment and function description
>sp|Q7ZV60|BCS1_DANRE Mitochondrial chaperone BCS1 OS=Danio rerio GN=bcs1l PE=2 SV=2 Back     alignment and function description
>sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZTL7|BCS1_XENLA Mitochondrial chaperone BCS1 OS=Xenopus laevis GN=bcs1l PE=2 SV=1 Back     alignment and function description
>sp|Q9CZP5|BCS1_MOUSE Mitochondrial chaperone BCS1 OS=Mus musculus GN=Bcs1l PE=1 SV=1 Back     alignment and function description
>sp|Q2SF13|FTSH_HAHCH ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 Back     alignment and function description
>sp|Q5E9H5|BCS1_BOVIN Mitochondrial chaperone BCS1 OS=Bos taurus GN=BCS1L PE=2 SV=1 Back     alignment and function description
>sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens GN=BCS1L PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
359473565 516 PREDICTED: ATP-dependent zinc metallopro 0.993 0.554 0.625 1e-105
147766990 492 hypothetical protein VITISV_030608 [Viti 0.993 0.581 0.621 1e-104
255547776 503 ATP binding protein, putative [Ricinus c 0.989 0.566 0.627 1e-104
359473572 543 PREDICTED: peroxisomal biogenesis factor 0.996 0.528 0.602 1e-100
297738373 623 unnamed protein product [Vitis vinifera] 0.913 0.422 0.614 5e-97
359473721 486 PREDICTED: mitochondrial chaperone BCS1- 0.961 0.569 0.595 1e-95
359473719 482 PREDICTED: mitochondrial chaperone BCS1- 0.961 0.574 0.595 2e-95
147782591 513 hypothetical protein VITISV_031444 [Viti 0.961 0.539 0.595 2e-95
297738388 479 unnamed protein product [Vitis vinifera] 0.927 0.557 0.584 6e-94
147865124 476 hypothetical protein VITISV_036161 [Viti 0.934 0.565 0.597 6e-93
>gi|359473565|ref|XP_002265580.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/296 (62%), Positives = 235/296 (79%), Gaps = 10/296 (3%)

Query: 1   MPSATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMT 60
           MPS  SVLSTYT FAASAMLVRTV++EV+T+ +Q+IP+QL+  ++SKLGGL  +HSS+M 
Sbjct: 7   MPSTASVLSTYTTFAASAMLVRTVVSEVETMANQLIPQQLREKIVSKLGGLLGSHSSEMV 66

Query: 61  LIIDEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKEKNLSVTINKGEKISDIFEG 120
           L+I E+NG S+NQ+Y+ASELYL TKIT S+ +L VSK  +EKNLSVT++KGE + D+FEG
Sbjct: 67  LVIQEFNGLSVNQIYQASELYLRTKITPSVGRLNVSKGLREKNLSVTVSKGEMVVDVFEG 126

Query: 121 ICLVWEMTCKETEERS--------SQRGKAERVIELSFPKKYMERILNIYLPYVMEKSNA 172
           I L W++ C ET++ S        +     +R IEL F KKY E +L+ YLPYV+E+S A
Sbjct: 127 IELRWQLICAETQKPSFDYDSGSMATEKSEQRSIELIFHKKYKEVVLSTYLPYVIERSRA 186

Query: 173 IKEQNKVVKLYAVGHFGGDSDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKR 232
           IKE+NKVVKL ++G+F  D D  G WGS NL HP TFD +AMDP++K+  I DLDRFV+R
Sbjct: 187 IKEENKVVKLCSLGNFSEDYD--GPWGSINLSHPCTFDTLAMDPTLKKELIADLDRFVRR 244

Query: 233 RNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCNSELRR 288
           R FY++VGK WKRGYLL+GPPGTGKSSLIAAMANYLKFNIYD+ELTS++ NS+LRR
Sbjct: 245 REFYQKVGKAWKRGYLLYGPPGTGKSSLIAAMANYLKFNIYDLELTSLWNNSDLRR 300




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147766990|emb|CAN69873.1| hypothetical protein VITISV_030608 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547776|ref|XP_002514945.1| ATP binding protein, putative [Ricinus communis] gi|223545996|gb|EEF47499.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359473572|ref|XP_002265232.2| PREDICTED: peroxisomal biogenesis factor 6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738373|emb|CBI27574.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473721|ref|XP_003631352.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473719|ref|XP_003631351.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147782591|emb|CAN70582.1| hypothetical protein VITISV_031444 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738388|emb|CBI27589.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865124|emb|CAN79835.1| hypothetical protein VITISV_036161 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
TAIR|locus:1005716649 495 AT2G18193 [Arabidopsis thalian 0.954 0.555 0.456 8.5e-65
TAIR|locus:2077997 576 BCS1 "cytochrome BC1 synthesis 0.961 0.480 0.433 4.8e-62
TAIR|locus:2053109 494 AT2G18190 [Arabidopsis thalian 0.951 0.554 0.447 1e-61
TAIR|locus:2078007 451 AT3G50940 [Arabidopsis thalian 0.954 0.609 0.425 4.3e-61
TAIR|locus:2175956 533 AT5G17740 [Arabidopsis thalian 0.951 0.514 0.406 2e-56
TAIR|locus:2175946 470 AT5G17730 [Arabidopsis thalian 0.947 0.580 0.402 6.8e-56
TAIR|locus:2175986 505 AT5G17760 [Arabidopsis thalian 0.944 0.538 0.403 2.3e-55
TAIR|locus:2174502 520 AT5G57480 [Arabidopsis thalian 0.902 0.5 0.399 1.1e-48
TAIR|locus:2175976 392 AT5G17750 [Arabidopsis thalian 0.739 0.543 0.407 4.7e-48
TAIR|locus:505006520 506 AT4G25835 [Arabidopsis thalian 0.899 0.511 0.401 2.6e-47
TAIR|locus:1005716649 AT2G18193 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 660 (237.4 bits), Expect = 8.5e-65, P = 8.5e-65
 Identities = 132/289 (45%), Positives = 193/289 (66%)

Query:     3 SATSVLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLI 62
             S +S+ S Y +     ML R+++++        +P++L++   S L   FT  S  +T+I
Sbjct:    10 SPSSLFSAYASLTGFLMLFRSMLHD-------FVPEKLRSYFSSLLDRFFTPKSKYLTVI 62

Query:    63 IDEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKEKNLSVTINKGEKISDIFEGIC 122
             IDE  G + NQ+++A+E+YL +KI    E+L+V K  K+K+ +++I +GE+I D FE   
Sbjct:    63 IDENFGLNRNQVFDAAEMYLRSKIGPETERLRVGKIPKQKHFTISIERGEEILDTFEESE 122

Query:   123 LVWEMTCKETEERSSQRGKAERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVKL 182
             + W     E E+      K +R  EL+F KK  +++LN YL +V+ +S  IK   +VVKL
Sbjct:   123 VKWSYVQSENEKGD----KVKRYYELTFEKKLRDKVLNSYLTHVVAESEEIKRNLRVVKL 178

Query:   183 YAVGHFGGDSD---RGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRV 239
             Y+   +  D D    GG WG  NL+HP+TFD +AMDP+ K+  IDDL+RF+KR+ FY+RV
Sbjct:   179 YSRDVYASDDDDGMAGGNWGCINLEHPSTFDTLAMDPNAKKKIIDDLERFLKRKEFYKRV 238

Query:   240 GKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCNSELRR 288
             GK WKRGYLL+GPPGTGKSSLIAAMANYLKF+++D+EL+S+Y N EL+R
Sbjct:   239 GKAWKRGYLLYGPPGTGKSSLIAAMANYLKFDVFDLELSSIYDNGELKR 287




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2077997 BCS1 "cytochrome BC1 synthesis" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053109 AT2G18190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078007 AT3G50940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175956 AT5G17740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175946 AT5G17730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175986 AT5G17760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174502 AT5G57480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175976 AT5G17750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006520 AT4G25835 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
pfam14363100 pfam14363, AAA_assoc, Domain associated at C-termi 2e-32
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-06
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-05
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 3e-05
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 8e-05
smart00382 148 smart00382, AAA, ATPases associated with a variety 5e-04
PRK08939 306 PRK08939, PRK08939, primosomal protein DnaI; Revie 5e-04
COG1484 254 COG1484, DnaC, DNA replication protein [DNA replic 7e-04
PRK06851 367 PRK06851, PRK06851, hypothetical protein; Provisio 0.001
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 0.001
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 0.002
PRK08116 268 PRK08116, PRK08116, hypothetical protein; Validate 0.002
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 0.002
pfam13207114 pfam13207, AAA_17, AAA domain 0.003
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 0.004
>gnl|CDD|222710 pfam14363, AAA_assoc, Domain associated at C-terminal with AAA Back     alignment and domain information
 Score =  114 bits (289), Expect = 2e-32
 Identities = 44/100 (44%), Positives = 68/100 (68%), Gaps = 3/100 (3%)

Query: 35  IIPKQLQTMMLSKLGGLFTNH-SSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEKL 93
           ++P +L+  + S L  LF +  S  +T++IDEY+GFS NQLY+A+E YLSTKI+ S  +L
Sbjct: 1   LLPHELREYLSSLLRRLFGSRFSPYLTIVIDEYDGFSRNQLYDAAEAYLSTKISPSARRL 60

Query: 94  KVSKTTKEKN--LSVTINKGEKISDIFEGICLVWEMTCKE 131
           K SK  K KN  L ++++ GE+++D+FEG+ + W     E
Sbjct: 61  KASKAKKSKNSSLVLSLDDGEEVTDVFEGVKVWWTSVVTE 100


This domain is found in association with the AAA family, pfam00004. Length = 100

>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|236353 PRK08939, PRK08939, primosomal protein DnaI; Reviewed Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235878 PRK06851, PRK06851, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
KOG0743 457 consensus AAA+-type ATPase [Posttranslational modi 100.0
PF1436398 AAA_assoc: Domain associated at C-terminal with AA 99.97
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.76
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.66
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 99.63
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.61
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.6
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.6
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.53
KOG0726 440 consensus 26S proteasome regulatory complex, ATPas 99.52
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.52
KOG0728 404 consensus 26S proteasome regulatory complex, ATPas 99.51
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 99.5
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.49
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.49
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.48
KOG0729 435 consensus 26S proteasome regulatory complex, ATPas 99.46
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.46
KOG0652 424 consensus 26S proteasome regulatory complex, ATPas 99.45
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.41
CHL00195 489 ycf46 Ycf46; Provisional 99.4
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.39
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.39
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.38
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.37
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.37
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.36
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.32
KOG0651 388 consensus 26S proteasome regulatory complex, ATPas 99.31
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.3
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.3
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.26
CHL00176 638 ftsH cell division protein; Validated 99.23
PRK04195 482 replication factor C large subunit; Provisional 99.15
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.05
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.05
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.01
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 98.96
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.95
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 98.93
PLN03025 319 replication factor C subunit; Provisional 98.93
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 98.92
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.91
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.89
PHA02544 316 44 clamp loader, small subunit; Provisional 98.88
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.85
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.84
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.84
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.84
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.83
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.82
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.82
CHL00206 2281 ycf2 Ycf2; Provisional 98.81
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.8
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.8
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.79
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.79
CHL00181 287 cbbX CbbX; Provisional 98.79
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.78
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.78
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.78
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 98.77
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.77
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 98.77
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 98.73
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.73
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.72
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.71
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.71
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.71
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 98.71
PRK12402 337 replication factor C small subunit 2; Reviewed 98.7
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.7
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.69
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.69
PRK13342 413 recombination factor protein RarA; Reviewed 98.68
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.68
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.68
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.68
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.67
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.67
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 98.66
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.64
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.64
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.63
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.62
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 98.61
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.6
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.59
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.59
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 98.59
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.58
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.58
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.58
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.57
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.57
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.56
PRK00440 319 rfc replication factor C small subunit; Reviewed 98.54
PRK07952244 DNA replication protein DnaC; Validated 98.53
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.51
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.48
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.48
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.48
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.45
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 98.44
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 98.42
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 98.41
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.39
PRK13341 725 recombination factor protein RarA/unknown domain f 98.38
PRK08939 306 primosomal protein DnaI; Reviewed 98.35
PRK08903 227 DnaA regulatory inactivator Hda; Validated 98.34
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.34
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 98.34
KOG2028 554 consensus ATPase related to the helicase subunit o 98.33
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.32
PF08740187 BCS1_N: BCS1 N terminal; InterPro: IPR014851 AAA A 98.31
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.3
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 98.28
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.26
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.25
COG2607 287 Predicted ATPase (AAA+ superfamily) [General funct 98.25
PRK15455 644 PrkA family serine protein kinase; Provisional 98.24
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.24
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.23
PRK12377248 putative replication protein; Provisional 98.21
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.2
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.19
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.17
PHA02244 383 ATPase-like protein 98.16
PRK08116 268 hypothetical protein; Validated 98.14
PRK06893 229 DNA replication initiation factor; Validated 98.14
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.13
PRK07471 365 DNA polymerase III subunit delta'; Validated 98.13
COG0714 329 MoxR-like ATPases [General function prediction onl 98.13
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.12
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.1
COG1484 254 DnaC DNA replication protein [DNA replication, rec 98.07
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.07
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.04
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.03
PRK10865 857 protein disaggregation chaperone; Provisional 98.03
PRK06620 214 hypothetical protein; Validated 98.03
PHA02624 647 large T antigen; Provisional 98.02
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 98.02
PRK08084 235 DNA replication initiation factor; Provisional 97.98
PRK09112 351 DNA polymerase III subunit delta'; Validated 97.98
CHL00095 821 clpC Clp protease ATP binding subunit 97.97
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.97
PRK05564 313 DNA polymerase III subunit delta'; Validated 97.96
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 97.93
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.9
KOG1942 456 consensus DNA helicase, TBP-interacting protein [R 97.89
COG0606 490 Predicted ATPase with chaperone activity [Posttran 97.88
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.88
PRK06921 266 hypothetical protein; Provisional 97.86
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 97.85
PRK05642 234 DNA replication initiation factor; Validated 97.83
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.83
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 97.82
PRK08181 269 transposase; Validated 97.82
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 97.81
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.8
PRK06835329 DNA replication protein DnaC; Validated 97.8
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 97.78
PRK14088 440 dnaA chromosomal replication initiation protein; P 97.75
CHL00095 821 clpC Clp protease ATP binding subunit 97.74
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.73
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.72
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.7
PRK13765 637 ATP-dependent protease Lon; Provisional 97.69
PRK07399 314 DNA polymerase III subunit delta'; Validated 97.67
COG1855 604 ATPase (PilT family) [General function prediction 97.67
PRK10865 857 protein disaggregation chaperone; Provisional 97.67
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.63
KOG0990 360 consensus Replication factor C, subunit RFC5 [Repl 97.62
TIGR01817 534 nifA Nif-specific regulatory protein. This model r 97.62
PHA00729 226 NTP-binding motif containing protein 97.61
PRK12422 445 chromosomal replication initiation protein; Provis 97.6
PRK15424 538 propionate catabolism operon regulatory protein Pr 97.59
KOG0736 953 consensus Peroxisome assembly factor 2 containing 97.59
PRK08727 233 hypothetical protein; Validated 97.58
PRK06526 254 transposase; Provisional 97.55
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.54
PRK08058 329 DNA polymerase III subunit delta'; Validated 97.52
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.52
PRK09087 226 hypothetical protein; Validated 97.52
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 97.52
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.51
PHA02774 613 E1; Provisional 97.51
PRK09183 259 transposase/IS protein; Provisional 97.5
PRK11608 326 pspF phage shock protein operon transcriptional ac 97.49
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 97.48
PRK13531 498 regulatory ATPase RavA; Provisional 97.48
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 97.47
PRK06547 172 hypothetical protein; Provisional 97.45
PF1324576 AAA_19: Part of AAA domain 97.45
PF13191 185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.44
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.41
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 97.4
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 97.4
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 97.4
PRK15429 686 formate hydrogenlyase transcriptional activator Fh 97.38
PLN02200 234 adenylate kinase family protein 97.37
PRK14087 450 dnaA chromosomal replication initiation protein; P 97.37
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 97.36
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.35
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.35
PTZ00112 1164 origin recognition complex 1 protein; Provisional 97.35
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.33
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.29
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 97.27
PRK14086 617 dnaA chromosomal replication initiation protein; P 97.26
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 97.26
PLN02199 303 shikimate kinase 97.24
PRK05022 509 anaerobic nitric oxide reductase transcription reg 97.22
PF13173128 AAA_14: AAA domain 97.22
PF12774 231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.21
PRK06696 223 uridine kinase; Validated 97.2
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.11
PLN02674 244 adenylate kinase 97.1
cd01394 218 radB RadB. The archaeal protein radB shares simila 97.07
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.06
TIGR02782 299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 97.05
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 97.03
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 97.02
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.02
TIGR00064 272 ftsY signal recognition particle-docking protein F 97.01
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.01
COG1221 403 PspF Transcriptional regulators containing an AAA- 96.98
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 96.98
PLN02459 261 probable adenylate kinase 96.95
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.95
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 96.95
PRK13764 602 ATPase; Provisional 96.94
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.94
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 96.94
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.94
PRK06067 234 flagellar accessory protein FlaH; Validated 96.93
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 96.93
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.92
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.92
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 96.91
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.9
PRK05973 237 replicative DNA helicase; Provisional 96.86
PLN02165 334 adenylate isopentenyltransferase 96.84
PRK10416 318 signal recognition particle-docking protein FtsY; 96.83
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.82
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 96.8
PRK13833 323 conjugal transfer protein TrbB; Provisional 96.8
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 96.8
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.8
PF00519 432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 96.79
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 96.77
PRK08533 230 flagellar accessory protein FlaH; Reviewed 96.77
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.77
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.76
PTZ00202 550 tuzin; Provisional 96.74
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.71
PRK04220 301 2-phosphoglycerate kinase; Provisional 96.71
TIGR02533 486 type_II_gspE general secretory pathway protein E. 96.68
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 96.68
COG0529 197 CysC Adenylylsulfate kinase and related kinases [I 96.68
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.67
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 96.65
KOG2170 344 consensus ATPase of the AAA+ superfamily [General 96.65
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 96.64
PRK10867 433 signal recognition particle protein; Provisional 96.63
PRK10436 462 hypothetical protein; Provisional 96.63
PRK12337 475 2-phosphoglycerate kinase; Provisional 96.62
PRK08699 325 DNA polymerase III subunit delta'; Validated 96.61
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 96.61
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.6
TIGR03880 224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.6
PRK05707 328 DNA polymerase III subunit delta'; Validated 96.59
PRK03846 198 adenylylsulfate kinase; Provisional 96.59
PRK04328 249 hypothetical protein; Provisional 96.57
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.57
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 96.55
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 96.54
COG4619 223 ABC-type uncharacterized transport system, ATPase 96.54
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.54
PRK13894 319 conjugal transfer ATPase TrbB; Provisional 96.53
TIGR02236 310 recomb_radA DNA repair and recombination protein R 96.52
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 96.52
TIGR00455 184 apsK adenylylsulfate kinase (apsK). Important resi 96.52
PF04851 184 ResIII: Type III restriction enzyme, res subunit; 96.51
PRK11823 446 DNA repair protein RadA; Provisional 96.51
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 96.51
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 96.49
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 96.43
PRK14974 336 cell division protein FtsY; Provisional 96.43
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.41
KOG2680 454 consensus DNA helicase TIP49, TBP-interacting prot 96.41
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.41
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 96.4
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 96.4
PRK06964 342 DNA polymerase III subunit delta'; Validated 96.39
cd00983 325 recA RecA is a bacterial enzyme which has roles in 96.39
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 96.39
PRK04301 317 radA DNA repair and recombination protein RadA; Va 96.38
PRK07667 193 uridine kinase; Provisional 96.37
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 96.36
PRK10536 262 hypothetical protein; Provisional 96.35
PLN02840 421 tRNA dimethylallyltransferase 96.33
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 96.33
PRK08099 399 bifunctional DNA-binding transcriptional repressor 96.31
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 96.3
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.29
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.27
smart00350 509 MCM minichromosome maintenance proteins. 96.25
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.25
PF06431 417 Polyoma_lg_T_C: Polyomavirus large T antigen C-ter 96.23
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 96.22
PRK04132 846 replication factor C small subunit; Provisional 96.21
KOG2035 351 consensus Replication factor C, subunit RFC3 [Cell 96.21
PRK13900 332 type IV secretion system ATPase VirB11; Provisiona 96.21
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 96.2
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.17
PF1355562 AAA_29: P-loop containing region of AAA domain 96.16
TIGR00959 428 ffh signal recognition particle protein. This mode 96.15
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 96.12
PRK06851 367 hypothetical protein; Provisional 96.12
PRK11860 661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 96.11
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 96.09
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.09
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 96.07
PRK06851 367 hypothetical protein; Provisional 96.04
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 96.04
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.03
COG2204 464 AtoC Response regulator containing CheY-like recei 96.02
PRK09376 416 rho transcription termination factor Rho; Provisio 96.02
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 96.0
PRK08769 319 DNA polymerase III subunit delta'; Validated 96.0
PRK12608 380 transcription termination factor Rho; Provisional 95.98
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 95.97
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 95.94
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 95.93
PRK13851 344 type IV secretion system protein VirB11; Provision 95.93
TIGR02688 449 conserved hypothetical protein TIGR02688. Members 95.91
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 95.91
PF12780 268 AAA_8: P-loop containing dynein motor region D4; I 95.9
TIGR02788 308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.89
cd01128 249 rho_factor Transcription termination factor rho is 95.86
PRK09302 509 circadian clock protein KaiC; Reviewed 95.86
COG4178 604 ABC-type uncharacterized transport system, permeas 95.85
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 95.85
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 95.85
PRK10646153 ADP-binding protein; Provisional 95.85
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 95.84
PLN02748 468 tRNA dimethylallyltransferase 95.84
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 95.83
PRK09354 349 recA recombinase A; Provisional 95.83
PRK05439 311 pantothenate kinase; Provisional 95.82
COG0593 408 DnaA ATPase involved in DNA replication initiation 95.82
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 95.81
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 95.81
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 95.8
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 95.79
KOG0060 659 consensus Long-chain acyl-CoA transporter, ABC sup 95.78
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 95.76
COG2074 299 2-phosphoglycerate kinase [Carbohydrate transport 95.74
PTZ00035 337 Rad51 protein; Provisional 95.72
COG3604 550 FhlA Transcriptional regulator containing GAF, AAA 95.71
COG4525 259 TauB ABC-type taurine transport system, ATPase com 95.71
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 95.7
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 95.69
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 95.69
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 95.69
cd03269 210 ABC_putative_ATPase This subfamily is involved in 95.69
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 95.68
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 95.66
PRK09862 506 putative ATP-dependent protease; Provisional 95.66
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 95.65
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 95.65
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 95.65
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 95.64
cd03247 178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.63
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 95.63
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.63
cd02034116 CooC The accessory protein CooC, which contains a 95.63
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 95.61
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 95.61
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 95.6
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 95.6
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.58
TIGR02858 270 spore_III_AA stage III sporulation protein AA. Mem 95.58
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 95.56
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 95.56
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 95.54
TIGR02238 313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.53
PRK06871 325 DNA polymerase III subunit delta'; Validated 95.53
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 95.53
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 95.51
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 95.51
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 95.49
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 95.49
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 95.49
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 95.48
PLN02796 347 D-glycerate 3-kinase 95.48
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 95.48
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.47
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 95.46
cd04155 173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 95.46
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 95.46
cd03246 173 ABCC_Protease_Secretion This family represents the 95.45
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 95.44
PF13476 202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 95.44
TIGR01166 190 cbiO cobalt transport protein ATP-binding subunit. 95.42
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential componen 95.42
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 95.4
PLN03187 344 meiotic recombination protein DMC1 homolog; Provis 95.39
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.39
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 95.39
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 95.39
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.38
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 95.38
cd03234 226 ABCG_White The White subfamily represents ABC tran 95.37
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.37
PRK07993 334 DNA polymerase III subunit delta'; Validated 95.37
PRK09435 332 membrane ATPase/protein kinase; Provisional 95.36
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 95.36
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 95.34
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.33
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 95.32
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 95.31
cd03229 178 ABC_Class3 This class is comprised of all BPD (Bin 95.31
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 95.29
cd03215 182 ABC_Carb_Monos_II This family represents domain II 95.29
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 95.28
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 95.28
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 95.28
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 95.27
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 95.27
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-asso 95.27
COG0802149 Predicted ATPase or kinase [General function predi 95.27
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 95.26
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 95.26
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 95.26
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 95.25
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 95.24
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.24
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 95.23
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 95.23
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 95.22
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 95.22
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 95.21
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 95.21
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 95.21
COG3854 308 SpoIIIAA ncharacterized protein conserved in bacte 95.21
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 95.2
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 95.2
cd03214 180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.2
cd03300 232 ABC_PotA_N PotA is an ABC-type transporter and the 95.19
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.19
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 95.18
PF13481 193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.18
cd03230 173 ABC_DR_subfamily_A This family of ATP-binding prot 95.18
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 95.18
TIGR00767 415 rho transcription termination factor Rho. Members 95.16
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 95.16
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 95.16
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 95.15
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.15
PRK09302 509 circadian clock protein KaiC; Reviewed 95.15
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 95.15
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 95.14
TIGR03819 340 heli_sec_ATPase helicase/secretion neighborhood AT 95.13
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 95.13
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.13
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 95.13
PRK10875 615 recD exonuclease V subunit alpha; Provisional 95.13
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 95.11
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 95.11
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 95.11
PRK06090 319 DNA polymerase III subunit delta'; Validated 95.11
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 95.1
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 95.1
PLN02348 395 phosphoribulokinase 95.1
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 95.09
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 95.08
TIGR00073 207 hypB hydrogenase accessory protein HypB. HypB is i 95.08
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 95.08
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 95.08
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 95.08
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 95.07
COG4136 213 ABC-type uncharacterized transport system, ATPase 95.07
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 95.07
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 95.06
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.06
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 95.06
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 95.05
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 95.04
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 95.03
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 95.03
COG4240 300 Predicted kinase [General function prediction only 95.03
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 95.02
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 95.01
PRK10908 222 cell division protein FtsE; Provisional 95.01
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.01
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 94.99
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=6.7e-65  Score=477.04  Aligned_cols=276  Identities=42%  Similarity=0.698  Sum_probs=260.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhchHHHHHHHHHHHhhhhcCCCCCeEEEEecCCCCCcChHHHHHHHHhhhccCCCcCc
Q 045456           13 AFAASAMLVRTVINEVQTLTSQIIPKQLQTMMLSKLGGLFTNHSSQMTLIIDEYNGFSINQLYEASELYLSTKITASLEK   92 (288)
Q Consensus        13 ~~~~~~~S~~a~~~~~r~~~~~~~P~~l~~~~~~~~~~l~~~~~~~~ti~i~e~~~~~~N~ly~a~~~YL~~~~~~~~~r   92 (288)
                      ++|+.+||.+|++|++|+|+++++|.+++.|+.+++++|++.++++.++.|.|++|+.+||+|.|+|+||++++++.++|
T Consensus         2 ~~~~~~~s~~~~~~~~~~~~~~~~p~~~~~y~~~~~~~l~g~~s~~~~~~~~e~~g~~~n~~~~aie~yl~~k~~~~~~r   81 (457)
T KOG0743|consen    2 SVFTAYASLLGSLMFIKSMLQDIIPPSINPYFISALRGLFGVFSSYALIRIGEQDGVFRNQLYVAIEVYLSSKSSAIAKR   81 (457)
T ss_pred             CccchhHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHhhccCcccEEEEeehhccchHHHHHHHHHHhhhccchhhhhh
Confidence            46889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEeecCCCCceEEecCCCCeEEeccCCeeEEEEEeeeccccccc-cCCCcceEEEEEeccchhhHHHHhhhhHHHHHHH
Q 045456           93 LKVSKTTKEKNLSVTINKGEKISDIFEGICLVWEMTCKETEERSS-QRGKAERVIELSFPKKYMERILNIYLPYVMEKSN  171 (288)
Q Consensus        93 L~~~~~~~~~~~~l~~~~ge~v~D~F~Gv~~~W~~~~~~~~~~~~-~~~~~~r~~eL~f~~~~r~~vl~syl~~Il~~~~  171 (288)
                      ++.+.+.+++++++.++++++|.|+|+||+++|.+++..++.+.+ .+..+.|+|+|+|++++|+.|+++||+||.++++
T Consensus        82 l~~~~~~~s~~~~l~~~~~~~i~d~f~gv~~~w~~~~~~~~~~~~~~~~~~~r~~~L~f~k~~~e~V~~syl~~v~~~~k  161 (457)
T KOG0743|consen   82 LTQNLSKNSKSLVLGLDDNEEISDEFEGVPVKWRHFVDYNEKWIFVEREREKRYFELTFHKKPRELVTLSYLPYVVSKAK  161 (457)
T ss_pred             hhhhhccccccceEEecCCcEEEEEEeceEEEEEEEEEecCcccccccCCcceEEEEEecCccHHHhHHhHHHHHHHHHH
Confidence            999999999999999999999999999999999999887666532 2356889999999999999999999999999999


Q ss_pred             HHHhccceeEEEEecCCCCC-CCCCCCCCccCCCCCCCccccccChhhhHHHHHHHHHHhhcHHHHHHhCCcccceeEEE
Q 045456          172 AIKEQNKVVKLYAVGHFGGD-SDRGGAWGSTNLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLF  250 (288)
Q Consensus       172 ~i~~~~~~~kl~~~~~~~~~-~~~~~~w~~~~~~~p~~~~~l~~~~~~k~~i~~~l~~~~~~~~~~~~~g~~~~rg~LL~  250 (288)
                      +|.++++.++||++++.... ...++.|+++.+.||++|++|+++++.|++|.+|+..|++++++|++.|++|+||||||
T Consensus       162 ~I~~~~r~~kl~t~~~~~~~~~~~~~~W~~v~f~HpstF~TlaMd~~~K~~I~~Dl~~F~k~k~~YkrvGkawKRGYLLY  241 (457)
T KOG0743|consen  162 EILEENRELKLYTNSGKTVIYTAKGGEWRSVGFPHPSTFETLAMDPDLKERIIDDLDDFIKGKDFYKRVGKAWKRGYLLY  241 (457)
T ss_pred             HHHHHHHHHHHhhcCCCcccccccCCcceecCCCCCCCccccccChhHHHHHHHHHHHHHhcchHHHhcCcchhccceee
Confidence            99999999999999864332 12578999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCChHHHHHHHHHHhCCcEEEEecCCCCCcccccC
Q 045456          251 GPPGTGKSSLIAAMANYLKFNIYDMELTSVYCNSELRR  288 (288)
Q Consensus       251 GPpGtGKTsla~aiA~~l~~~i~~l~~~~~~~~~~l~~  288 (288)
                      |||||||||++.|||++|+++||+++++++.+++|||+
T Consensus       242 GPPGTGKSS~IaAmAn~L~ydIydLeLt~v~~n~dLr~  279 (457)
T KOG0743|consen  242 GPPGTGKSSFIAAMANYLNYDIYDLELTEVKLDSDLRH  279 (457)
T ss_pred             CCCCCCHHHHHHHHHhhcCCceEEeeeccccCcHHHHH
Confidence            99999999999999999999999999999999999985



>PF14363 AAA_assoc: Domain associated at C-terminal with AAA Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF08740 BCS1_N: BCS1 N terminal; InterPro: IPR014851 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF06431 Polyoma_lg_T_C: Polyomavirus large T antigen C-terminus; InterPro: IPR010932 The group of polyomaviruses is formed by the homonymous murine virus (Py) as well as other representative members such as the simian virus 40 (SV40) and the human BK and JC viruses [] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 7e-05
3vfd_A 389 Human Spastin Aaa Domain Length = 389 4e-04
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure

Iteration: 1

Score = 44.3 bits (103), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 25/36 (69%) Query: 234 NFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLK 269 + Y ++G RG LL+GPPGTGK+ L+ A+AN K Sbjct: 196 DLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTK 231
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-06
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-06
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 2e-06
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 7e-06
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 7e-06
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 7e-06
2qgz_A 308 Helicase loader, putative primosome component; str 2e-05
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-05
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-04
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 9e-05
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 1e-04
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 3e-04
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 3e-04
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 3e-04
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 5e-04
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-04
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 8e-04
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 8e-04
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 56.8 bits (136), Expect = 3e-09
 Identities = 47/283 (16%), Positives = 91/283 (32%), Gaps = 55/283 (19%)

Query: 7   VLSTYTAFAASAMLVRTVINEVQTLTSQIIPKQLQT---MMLSKLGGLFTNHSSQMTLII 63
              T T     ++L++ +    Q L     P+++ T     LS +     +  +      
Sbjct: 294 HSMTLTPDEVKSLLLKYLDCRPQDL-----PREVLTTNPRRLSIIAESIRDGLAT----W 344

Query: 64  DEYNGFSINQLYEASELYLSTKITASLEKLKVSKTTKE--KNLSVTINKGEKISDIFEGI 121
           D +   + ++L        +T I +SL  L+     ++    LSV       I  I   +
Sbjct: 345 DNWKHVNCDKL--------TTIIESSLNVLE-PAEYRKMFDRLSV-FPPSAHIPTIL--L 392

Query: 122 CLVWEMTCKETEERSSQRGKAERVIELSFPKKYMERILNIYLPYVMEKSNAIKEQNKVVK 181
            L+W    K        +     ++E   PK+    I +IYL   ++  N       +V 
Sbjct: 393 SLIWFDVIKSDVMVVVNKLHKYSLVEKQ-PKESTISIPSIYLELKVKLENEYALHRSIVD 451

Query: 182 LYAVGHFGGDSDRGGAWGSTNLD---------HPATFDKIAMDPSMKQASIDDLDRFVKR 232
            Y +      +          LD         H    +        +   +D   RF+++
Sbjct: 452 HYNI----PKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLD--FRFLEQ 505

Query: 233 RNFYRRVGKVWK-RGYLLFGPPGTGKSSLIAAMANYLKFNIYD 274
           +   R     W   G +L         + +  +  Y  + I D
Sbjct: 506 K--IRHDSTAWNASGSIL---------NTLQQLKFYKPY-ICD 536


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.77
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.77
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.77
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.77
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.76
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.75
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.55
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.5
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.48
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.46
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.44
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.43
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.42
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.41
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.4
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.38
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.37
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.37
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.32
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.31
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.31
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.31
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.3
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.24
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.22
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.19
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.17
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.12
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.1
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.03
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.02
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.99
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.98
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.95
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.91
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 98.89
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.82
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.82
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 98.81
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.78
3pvs_A 447 Replication-associated recombination protein A; ma 98.73
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.73
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.72
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.68
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.68
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 98.67
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.67
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.67
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.66
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.64
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 98.64
2r44_A 331 Uncharacterized protein; putative ATPase, structur 98.63
3co5_A143 Putative two-component system transcriptional RES 98.61
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.6
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.59
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 98.59
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.57
3bos_A 242 Putative DNA replication factor; P-loop containing 98.54
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.54
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.51
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.49
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 98.47
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.46
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 98.44
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.4
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.4
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.39
2qgz_A 308 Helicase loader, putative primosome component; str 98.38
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.38
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.35
1tue_A 212 Replication protein E1; helicase, replication, E1E 98.35
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.34
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.32
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.28
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.27
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.27
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 98.26
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.2
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 98.18
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.18
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.14
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.13
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.05
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.98
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 97.97
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.92
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.91
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 97.84
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.84
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 97.73
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 97.69
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.66
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.63
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.62
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.62
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.58
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.56
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.51
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 97.5
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.48
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 97.46
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 97.44
2fna_A 357 Conserved hypothetical protein; structural genomic 97.43
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 97.4
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.4
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.39
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.38
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.33
2cvh_A 220 DNA repair and recombination protein RADB; filamen 97.28
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.25
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.2
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 97.16
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.12
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 97.1
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.09
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.04
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.03
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.99
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.96
4a74_A 231 DNA repair and recombination protein RADA; hydrola 96.94
2z43_A 324 DNA repair and recombination protein RADA; archaea 96.93
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.9
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.88
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 96.84
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.83
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.78
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.77
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.77
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 96.73
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.73
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.72
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 96.71
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.7
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 96.7
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.69
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.67
2og2_A 359 Putative signal recognition particle receptor; nuc 96.67
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 96.66
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.62
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 96.6
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 96.58
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 96.55
1xp8_A 366 RECA protein, recombinase A; recombination, radior 96.54
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 96.53
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.48
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.47
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 96.47
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.46
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.46
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.46
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 96.44
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.43
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.43
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.39
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.39
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.35
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 96.34
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 96.32
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.28
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.27
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.26
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 96.22
1p9r_A 418 General secretion pathway protein E; bacterial typ 96.21
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 96.2
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.18
3io5_A 333 Recombination and repair protein; storage dimer, i 96.17
2eyu_A 261 Twitching motility protein PILT; pilus retraction 96.16
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 96.14
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.12
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.02
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 96.01
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.99
2ewv_A 372 Twitching motility protein PILT; pilus retraction 95.95
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 95.91
3kta_A 182 Chromosome segregation protein SMC; structural mai 95.88
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.86
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 95.85
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.84
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 95.83
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 95.82
2xxa_A 433 Signal recognition particle protein; protein trans 95.8
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.8
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 95.79
2ged_A 193 SR-beta, signal recognition particle receptor beta 95.78
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.75
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.74
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.73
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.71
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 95.7
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.69
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.63
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.61
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 95.61
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 95.61
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 95.61
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 95.58
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 95.58
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 95.58
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 95.57
3tqf_A 181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 95.55
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.52
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.51
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 95.51
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.49
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 95.48
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 95.46
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 95.42
1b0u_A 262 Histidine permease; ABC transporter, transport pro 95.4
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 95.38
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.38
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 95.33
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 95.33
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.32
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 95.32
1g6h_A 257 High-affinity branched-chain amino acid transport 95.32
1sgw_A 214 Putative ABC transporter; structural genomics, P p 95.31
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 95.29
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 95.29
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 95.28
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 95.27
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 95.26
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 95.26
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 95.26
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 95.25
1ji0_A 240 ABC transporter; ATP binding protein, structural g 95.22
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 95.21
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 95.2
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 95.19
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.17
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 95.17
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 95.17
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.16
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.14
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 95.13
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 95.13
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 95.12
2ghi_A 260 Transport protein; multidrug resistance protein, M 95.11
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 95.1
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.04
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 95.03
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 95.0
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 94.98
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 94.98
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 94.93
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 94.91
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 94.86
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.85
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 94.85
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 94.85
3ice_A 422 Transcription termination factor RHO; transcriptio 94.83
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 94.82
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 94.79
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 94.78
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 94.72
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 94.57
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 94.52
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 94.51
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 94.45
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.44
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 94.4
2oil_A 193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 94.34
3con_A 190 GTPase NRAS; structural genomics consortium, SGC, 94.29
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.27
2a9k_A 187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 94.26
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 94.23
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.19
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 94.17
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 94.16
2hf9_A 226 Probable hydrogenase nickel incorporation protein 94.14
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 94.1
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 94.1
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 94.08
2gf9_A 189 RAS-related protein RAB-3D; G-protein, structural 94.07
3kkq_A 183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.03
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 94.01
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 93.99
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 93.99
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 93.99
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 93.98
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 93.94
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 93.9
3c5c_A 187 RAS-like protein 12; GDP, GTPase, structural genom 93.88
3ihw_A 184 Centg3; RAS, centaurin, GTPase, structural genomic 93.88
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 93.87
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 93.87
2fg5_A 192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 93.85
3dz8_A 191 RAS-related protein RAB-3B; GDP, GTPase, structura 93.85
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 93.84
1z06_A 189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 93.82
1zd9_A 188 ADP-ribosylation factor-like 10B; transport protei 93.79
2a5j_A 191 RAS-related protein RAB-2B; GTPase, signal transdu 93.77
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 93.77
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 93.7
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 93.69
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 93.67
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 93.61
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 93.6
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 93.57
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 93.55
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 93.51
1knx_A 312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 93.51
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 93.46
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.43
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 93.42
1moz_A 183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 93.36
1t6n_A 220 Probable ATP-dependent RNA helicase; RECA-like fol 93.36
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 93.36
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 93.36
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 93.3
1fzq_A 181 ADP-ribosylation factor-like protein 3; protein-GD 93.26
1zj6_A 187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 93.25
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 93.22
3f8t_A 506 Predicted ATPase involved in replication control, 93.19
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 93.14
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.12
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 93.11
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 93.11
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 93.1
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 93.1
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 93.07
2gxq_A 207 Heat resistant RNA dependent ATPase; RNA helicase, 93.07
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 93.05
2h17_A 181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 93.05
3l0o_A 427 Transcription termination factor RHO; helicase, RH 92.99
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 92.96
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 92.95
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 92.84
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 92.83
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 92.8
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 92.78
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 92.77
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 92.77
2il1_A 192 RAB12; G-protein, GDP, GTPase, predicted, structur 92.69
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 92.59
3b6e_A 216 Interferon-induced helicase C domain-containing P; 92.5
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 92.49
1g5t_A 196 COB(I)alamin adenosyltransferase; P-loop protein, 92.48
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 92.46
2h57_A 190 ADP-ribosylation factor-like protein 6; GTP, GTPas 92.44
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 92.41
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 92.35
3llu_A 196 RAS-related GTP-binding protein C; structural geno 92.33
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 92.29
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 92.28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 92.16
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 92.14
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 92.12
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 92.11
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 92.1
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 92.07
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 92.04
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 92.03
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 92.02
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 92.0
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 91.95
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 91.94
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 91.91
2x77_A 189 ADP-ribosylation factor; GTP-binding protein, smal 91.88
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.83
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 91.82
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 91.81
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 91.79
1vec_A 206 ATP-dependent RNA helicase P54; DEAD-box protein, 91.76
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 91.73
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 91.69
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 91.62
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 91.58
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 91.56
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 91.51
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 91.45
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 91.29
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 91.28
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 91.27
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 91.24
3bor_A 237 Human initiation factor 4A-II; translation initiat 91.19
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 91.17
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 91.17
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 91.16
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 91.12
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 91.04
1w4r_A 195 Thymidine kinase; type II, human, cytosolic, phosp 91.04
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 91.03
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 91.01
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 91.01
1e69_A 322 Chromosome segregation SMC protein; structural mai 90.95
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 90.87
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 90.77
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 90.7
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 90.53
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 89.94
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 90.42
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 90.38
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 90.27
3bfv_A 271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 90.25
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 90.19
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 90.09
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 90.07
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 89.99
3cio_A 299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 89.99
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 89.93
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 89.81
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 89.76
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 89.75
3end_A 307 Light-independent protochlorophyllide reductase ir 89.68
3h1t_A 590 Type I site-specific restriction-modification syst 89.67
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 89.54
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 89.5
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 89.4
2oxc_A 230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 89.22
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 89.13
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 89.12
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 88.98
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 88.93
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 88.93
3ber_A 249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 88.9
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 88.85
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 88.84
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 88.81
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 88.7
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 88.68
1rif_A 282 DAR protein, DNA helicase UVSW; bacteriophage, REC 88.66
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 88.6
3la6_A 286 Tyrosine-protein kinase WZC; P-loop protein, nucle 88.31
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 88.12
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 88.04
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 87.95
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 87.94
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 87.85
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 87.82
1ytm_A 532 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 87.61
2olr_A 540 Phosphoenolpyruvate carboxykinase; carbon dioxide, 87.45
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 87.32
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 87.31
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 87.19
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 87.1
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 87.03
3ly5_A 262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 86.89
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 86.87
2j9r_A 214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 86.86
1j3b_A 529 ATP-dependent phosphoenolpyruvate carboxykinase; a 86.84
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 86.83
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 86.79
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 86.77
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 86.76
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 86.7
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 86.63
1ii2_A 524 Phosphoenolpyruvate carboxykinase; phosphate bindi 86.5
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 86.22
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 86.1
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 86.06
3fe2_A 242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 86.02
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 85.96
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 85.93
2ph1_A 262 Nucleotide-binding protein; alpha-beta protein, st 85.88
3bs4_A 260 Uncharacterized protein PH0321; structural genomic 85.71
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 85.62
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 85.33
3fmo_B 300 ATP-dependent RNA helicase DDX19B; nuclear porin, 85.13
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 85.07
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 85.05
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 84.93
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 84.79
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 84.59
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 84.46
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 84.3
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 84.08
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 83.96
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 83.89
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 83.81
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 83.08
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 83.05
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 82.98
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 82.98
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 82.88
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 82.87
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 82.66
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 81.7
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 81.41
3iuy_A 228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 81.28
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 80.78
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 80.34
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.77  E-value=4.4e-19  Score=168.09  Aligned_cols=82  Identities=21%  Similarity=0.321  Sum_probs=77.7

Q ss_pred             CCCCCCCccccccChhhhHHHHHHHHHHhhcHHHHHHhCCcccceeEEEcCCCCChHHHHHHHHHHhCCcEEEEecCCCC
Q 045456          202 NLDHPATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVY  281 (288)
Q Consensus       202 ~~~~p~~~~~l~~~~~~k~~i~~~l~~~~~~~~~~~~~g~~~~rg~LL~GPpGtGKTsla~aiA~~l~~~i~~l~~~~~~  281 (288)
                      ...+..+|+||+|.+++|++|.+.+..++.+++.|+++|+++++|+|||||||||||++|+|+|++++.+|+.++++++.
T Consensus       140 ~~~p~v~~~dIgGl~~~k~~l~e~v~~Pl~~pe~f~~~gi~~prGvLL~GPPGTGKTllAkAiA~e~~~~f~~v~~s~l~  219 (405)
T 4b4t_J          140 EKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELV  219 (405)
T ss_dssp             ECSCSCCGGGSCSCHHHHHHHHHHTHHHHHCHHHHHHHTCCCCCCEEEESCSSSSHHHHHHHHHHHHTCEEEEEEGGGGS
T ss_pred             cCCCCCCHHHhCCHHHHHHHHHHHHHHHHhCHHHHHhCCCCCCCceEEeCCCCCCHHHHHHHHHHhhCCCceEEEhHHhh
Confidence            34456799999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             Cc
Q 045456          282 CN  283 (288)
Q Consensus       282 ~~  283 (288)
                      ++
T Consensus       220 sk  221 (405)
T 4b4t_J          220 QK  221 (405)
T ss_dssp             CS
T ss_pred             cc
Confidence            75



>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 9e-09
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 1e-08
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 2e-08
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 3e-08
d1svma_ 362 c.37.1.20 (A:) Papillomavirus large T antigen heli 4e-07
d1sxja2 253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 5e-06
d2fnaa2 283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 4e-05
d1ofha_ 309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-05
d1d2na_ 246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-04
d1w5sa2 287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 3e-04
d1lw7a2 192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.001
d1ixsb2 239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 0.001
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 0.003
d1gvnb_ 273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 0.003
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 0.004
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 52.7 bits (125), Expect = 9e-09
 Identities = 16/76 (21%), Positives = 33/76 (43%)

Query: 208 TFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANY 267
            +D +           + ++  ++    ++ +G    RG LL+GPPGTGK+ +  A+AN 
Sbjct: 2   GYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANE 61

Query: 268 LKFNIYDMELTSVYCN 283
                + +    +   
Sbjct: 62  TGAFFFLINGPEIMSK 77


>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.7
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.67
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.67
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.64
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 99.53
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 99.52
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 99.48
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.29
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 99.18
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.17
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 99.14
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 99.14
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 99.06
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 99.02
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.99
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 98.99
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.98
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.94
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 98.74
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.73
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.63
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 98.59
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 98.39
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.25
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.2
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.14
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 97.98
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.84
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.83
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.75
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 97.71
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 97.67
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 97.54
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 97.48
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.38
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 97.25
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 97.2
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.15
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 97.09
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 97.07
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 96.96
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.82
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 96.82
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 96.61
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 96.61
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.49
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.47
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 96.4
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.23
d2awna2 232 Maltose transport protein MalK, N-terminal domain 95.81
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.81
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.8
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 95.78
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 95.71
d1ko7a2 169 HPr kinase HprK C-terminal domain {Staphylococcus 95.7
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.68
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.64
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.63
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 95.63
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 95.52
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.46
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 95.37
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 95.35
d1g2912 240 Maltose transport protein MalK, N-terminal domain 95.27
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.2
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 95.19
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.19
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.19
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 95.1
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 95.1
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.99
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 94.94
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 94.92
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.85
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 94.81
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 94.73
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.71
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 94.67
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 94.54
d1fzqa_ 176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.43
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 94.42
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.26
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 94.24
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 94.17
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.05
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.97
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 93.84
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 93.51
d1xpua3 289 Transcription termination factor Rho, ATPase domai 93.51
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 93.5
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.49
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 93.39
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.36
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 93.32
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 93.28
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.07
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.89
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 92.73
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.48
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 92.31
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 92.29
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 90.78
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 90.39
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 90.11
d2eyqa3 233 Transcription-repair coupling factor, TRCF {Escher 89.68
d1s2ma1 206 Putative ATP-dependent RNA helicase DHH1 {Baker's 89.5
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 89.23
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 89.12
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 88.69
d2g9na1 218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 88.18
d1t6na_ 207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 86.72
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 86.61
d1gm5a3 264 RecG helicase domain {Thermotoga maritima [TaxId: 86.21
d1qdea_ 212 Initiation factor 4a {Baker's yeast (Saccharomyces 86.16
d1veca_ 206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 85.77
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 85.35
d1hv8a1 208 Putative DEAD box RNA helicase {Archaeon Methanoco 85.09
d2j0sa1 222 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.35
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 84.15
d1q0ua_ 209 Probable DEAD box RNA helicase YqfR {Bacillus stea 84.13
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 84.0
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 83.66
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 82.52
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 82.02
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 81.23
d1wrba1 238 putative ATP-dependent RNA helicase VlgB {Flatworm 80.68
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 80.48
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 80.44
d1rifa_ 282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 80.43
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 80.23
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.70  E-value=6.2e-18  Score=149.38  Aligned_cols=77  Identities=21%  Similarity=0.348  Sum_probs=73.1

Q ss_pred             CCccccccChhhhHHHHHHHHHHhhcHHHHHHhCCcccceeEEEcCCCCChHHHHHHHHHHhCCcEEEEecCCCCCc
Q 045456          207 ATFDKIAMDPSMKQASIDDLDRFVKRRNFYRRVGKVWKRGYLLFGPPGTGKSSLIAAMANYLKFNIYDMELTSVYCN  283 (288)
Q Consensus       207 ~~~~~l~~~~~~k~~i~~~l~~~~~~~~~~~~~g~~~~rg~LL~GPpGtGKTsla~aiA~~l~~~i~~l~~~~~~~~  283 (288)
                      .+|+||+|.+++|++|.+.+..++.+++.|++.|+++++|+|||||||||||++++++|++++.+++.++.+++.+.
T Consensus         1 ~~~~dv~G~~~~k~~l~~~i~~~l~~~~~~~~~g~~~~~giLL~GppGtGKT~l~~ala~~~~~~~~~i~~~~l~~~   77 (258)
T d1e32a2           1 VGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSK   77 (258)
T ss_dssp             CCGGGCCSCSHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCTTSSHHHHHHHHHHHTTCEEEEECHHHHTTS
T ss_pred             CChhhhccHHHHHHHHHHHHHHHhcCHHHHHhCCCCCCceeEEecCCCCCchHHHHHHHHHhCCeEEEEEchhhccc
Confidence            37999999999999999999999999999999999999999999999999999999999999999999998876654



>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure