Citrus Sinensis ID: 045516
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 675 | ||||||
| 359472731 | 664 | PREDICTED: uncharacterized protein LOC10 | 0.810 | 0.823 | 0.480 | 1e-101 | |
| 297737935 | 691 | unnamed protein product [Vitis vinifera] | 0.32 | 0.312 | 0.691 | 4e-86 | |
| 940288 | 611 | protein localized in the nucleoli of pea | 0.423 | 0.468 | 0.583 | 9e-80 | |
| 356538573 | 748 | PREDICTED: uncharacterized protein LOC10 | 0.388 | 0.350 | 0.580 | 4e-78 | |
| 356544468 | 744 | PREDICTED: uncharacterized protein LOC10 | 0.385 | 0.349 | 0.594 | 5e-76 | |
| 357473911 | 623 | RNA-binding protein [Medicago truncatula | 0.32 | 0.346 | 0.608 | 3e-74 | |
| 357473909 | 635 | RNA-binding protein [Medicago truncatula | 0.32 | 0.340 | 0.608 | 3e-74 | |
| 118486193 | 590 | unknown [Populus trichocarpa] | 0.322 | 0.369 | 0.592 | 1e-73 | |
| 1279563 | 635 | nuM1 [Medicago sativa] | 0.318 | 0.338 | 0.606 | 2e-73 | |
| 224096554 | 548 | predicted protein [Populus trichocarpa] | 0.322 | 0.397 | 0.592 | 3e-73 |
| >gi|359472731|ref|XP_002277195.2| PREDICTED: uncharacterized protein LOC100262769 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 375 bits (962), Expect = e-101, Method: Compositional matrix adjust.
Identities = 299/622 (48%), Positives = 380/622 (61%), Gaps = 75/622 (12%)
Query: 1 VDAAPVVATPTKSAKKGGKREAEDAIEKLVSAKKQKGNDGVAQAVKKAKVEAKTQKKNKN 60
VDA PVV P+K KKG KR+AED++EK+VSAKKQK ++GV Q V+K KVE K Q+K +
Sbjct: 12 VDATPVVTPPSKPTKKG-KRQAEDSVEKVVSAKKQKKDNGVEQVVQKQKVEVKKQQKVET 70
Query: 61 DETSSSSSEED----SSDSEEEQKVKAVVTNKGGKAAKPPVKESSSEEEDSSSDEEPPKK 116
+ + SSDS+EE K + KG AKPP K + E
Sbjct: 71 KKKKKEETSSSEDLTSSDSDEEPKA-TTASKKGAIPAKPPAKATVEES------------ 117
Query: 117 QPVAAKNGAVAATAKKSKPDSSSSDSSDDDSDEDEVPTSIKKLPVAAAKNG----PSAPQ 172
SS +SS D+ + +V KK P++A+KNG P A
Sbjct: 118 --------------------SSDEESSSDEEPDSKVAVPSKKKPISASKNGTAAGPVAAA 157
Query: 173 KKKDDSSDSSDEESDESSDEDDKSTKAIPQPKKLPAST--AKKGTVAATKKSTGSSDDDS 230
KK DSS S + +S +E ++ K QPKKLPA+ AK G+V A KK SSD
Sbjct: 158 KKVSDSSSSDSSDDSDSDEEIKEANKVSSQPKKLPATAKAAKNGSVVAPKKKEESSDSSD 217
Query: 231 SSSEDSSESEEDNGAPAKVTSEAKKLP--AVKNVPAPAAKKKTESSDSSDEESEDSSDED 288
S S E E+ +KV S+AKKLP + KNVP A KK S S + +S++
Sbjct: 218 SDSSSDEEDEKA----SKVASQAKKLPPSSQKNVPVAAPKKAESSDSSDESDSDEEEPAA 273
Query: 289 EEPTHVTKATPVKKLSAVVTKNKVESSSSSDESESEEEKPPAKMDVDSSSEEESSDEEPQ 348
+ K V + S +SS+E E ++KP K D + SDEEPQ
Sbjct: 274 AKNVAAAKNVIAAAPKKKVQSSDSSSETSSEEEEEPQKKPAPKEDSSEDDSSDESDEEPQ 333
Query: 349 KKKDVKPNTKALKKESSSDEEDSDDEDEGEEEEASKTPKKNVTDVKMVDAE--------- 399
KKK LK++SS ++ ++ +EEE SKTPKKN TDV+MVDAE
Sbjct: 334 KKK--------LKEDSSEEDSSEEES---DEEEPSKTPKKNGTDVEMVDAETPAKQTDSK 382
Query: 400 SGKKAAQTPFTPQ--SGGSKTLFVGNLPFSVEQADVQNFFSEVAEVVDVRLSSDADGRFK 457
SGKKA +TP TPQ S GSKTLFVGNL FSV++ DV++FF + EVVDVR SSDADGRFK
Sbjct: 383 SGKKAPKTPATPQVESTGSKTLFVGNLSFSVQKEDVEHFFKDAGEVVDVRFSSDADGRFK 442
Query: 458 GYGHVEFASVEDAHKAIELNGQMLGNRAIRLDFARERGAYTPYSGGNESNSFQKGGRGQA 517
G+GHVEFA+ E A KA+++NG+ L RA+RLD ARERGAYTPYSG ESNSFQKGG
Sbjct: 443 GFGHVEFATPEAAQKALKMNGKDLLGRAVRLDLARERGAYTPYSG-KESNSFQKGG--SQ 499
Query: 518 AHTIFIKGFDSSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSF 577
A TIF++GFD S EDQVR++LEE+FGSCG+I+RIS+PKDY++GSVKGIAY+DFTD DSF
Sbjct: 500 AQTIFVRGFDKSGDEDQVRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSF 559
Query: 578 NKALEMSGTEIGGYSLVVDEAK 599
NKALE++GTE+GGY+L V+EAK
Sbjct: 560 NKALELNGTELGGYTLNVEEAK 581
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297737935|emb|CBI27136.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|940288|gb|AAA74208.1| protein localized in the nucleoli of pea nuclei; ORF; putative [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|356538573|ref|XP_003537777.1| PREDICTED: uncharacterized protein LOC100786132 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356544468|ref|XP_003540672.1| PREDICTED: uncharacterized protein LOC100779929 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357473911|ref|XP_003607240.1| RNA-binding protein [Medicago truncatula] gi|355508295|gb|AES89437.1| RNA-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357473909|ref|XP_003607239.1| RNA-binding protein [Medicago truncatula] gi|355508294|gb|AES89436.1| RNA-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|118486193|gb|ABK94939.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|1279563|emb|CAA61298.1| nuM1 [Medicago sativa] | Back alignment and taxonomy information |
|---|
| >gi|224096554|ref|XP_002310655.1| predicted protein [Populus trichocarpa] gi|222853558|gb|EEE91105.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 675 | ||||||
| TAIR|locus:2028451 | 557 | NUC-L1 "nucleolin like 1" [Ara | 0.358 | 0.434 | 0.494 | 7.6e-70 | |
| TAIR|locus:2086884 | 636 | NUC-L2 "nucleolin like 2" [Ara | 0.305 | 0.323 | 0.516 | 4.3e-66 | |
| POMBASE|SPAC140.02 | 500 | gar2 "nucleolar protein requir | 0.282 | 0.382 | 0.315 | 1.3e-17 | |
| ASPGD|ASPL0000076731 | 524 | AN4865 [Emericella nidulans (t | 0.296 | 0.381 | 0.320 | 3.9e-17 | |
| UNIPROTKB|F1P336 | 689 | NCL "Nucleolin" [Gallus gallus | 0.274 | 0.268 | 0.333 | 2.4e-15 | |
| UNIPROTKB|F1NU40 | 691 | NCL "Nucleolin" [Gallus gallus | 0.274 | 0.267 | 0.333 | 2.4e-15 | |
| UNIPROTKB|P15771 | 694 | NCL "Nucleolin" [Gallus gallus | 0.274 | 0.266 | 0.333 | 2.4e-15 | |
| UNIPROTKB|G4MY43 | 486 | MGG_01268 "Nuclear localizatio | 0.148 | 0.205 | 0.485 | 8.3e-15 | |
| TAIR|locus:2160437 | 567 | AT5G41690 [Arabidopsis thalian | 0.269 | 0.320 | 0.323 | 3.9e-14 | |
| POMBASE|SPBC4F6.14 | 674 | SPBC4F6.14 "RNA-binding protei | 0.262 | 0.262 | 0.327 | 4.1e-14 |
| TAIR|locus:2028451 NUC-L1 "nucleolin like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 586 (211.3 bits), Expect = 7.6e-70, Sum P(4) = 7.6e-70
Identities = 129/261 (49%), Positives = 170/261 (65%)
Query: 348 QKKKDVKPNTKALKKXXXXXXXXXXXXXXXXXXXXXKTPKKNVTDVKMVDAE-SGKKAAQ 406
+K K +TKA KK +TPKK +DV+MVDAE S K +
Sbjct: 230 EKPAQKKADTKASKKSSSDESSESEEDESEDEE---ETPKKKSSDVEMVDAEKSSAKQPK 286
Query: 407 TPFTPQSGGSKTLFVGNLPFSVEQADVQNFFSEVAEVVDVRLSSDAD-GRFKGYGHVEFA 465
TP TP +GGSKTLF NL F++E+ADV+NFF E EVVDVR S++ D G F+G+GHVEFA
Sbjct: 287 TPSTPAAGGSKTLFAANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEFA 346
Query: 466 SVEDAHKAIELNGQMLGNRAIRLDFARERG------AYTPYSGGNESNSFQKGGRGQAAH 519
S E+A KA+E +G+ L R IRLD A+ERG A+TP SG +F+ GG G
Sbjct: 347 SSEEAQKALEFHGRPLLGREIRLDIAQERGERGERPAFTPQSG-----NFRSGGDGGDEK 401
Query: 520 TIFIKGFDSSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNK 579
IF+KGFD+S+ ED ++ +L EHF SCGEI +SVP D DTG+ KGIAYL+F++ K
Sbjct: 402 KIFVKGFDASLSEDDIKNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFSEGKE--K 459
Query: 580 ALEMSGTEIGG-YSLVVDEAK 599
ALE++G+++GG + LVVDE +
Sbjct: 460 ALELNGSDMGGGFYLVVDEPR 480
|
|
| TAIR|locus:2086884 NUC-L2 "nucleolin like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC140.02 gar2 "nucleolar protein required for rRNA processing" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000076731 AN4865 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P336 NCL "Nucleolin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NU40 NCL "Nucleolin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P15771 NCL "Nucleolin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MY43 MGG_01268 "Nuclear localization sequence binding protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160437 AT5G41690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC4F6.14 SPBC4F6.14 "RNA-binding protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_VII000277 | hypothetical protein (548 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 675 | |||
| cd12451 | 79 | cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu | 1e-30 | |
| cd12450 | 77 | cd12450, RRM1_NUCLs, RNA recognition motif 1 found | 6e-29 | |
| cd00590 | 72 | cd00590, RRM_SF, RNA recognition motif (RRM) super | 1e-19 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 7e-19 | |
| smart00360 | 73 | smart00360, RRM, RNA recognition motif | 8e-19 | |
| pfam00076 | 70 | pfam00076, RRM_1, RNA recognition motif | 1e-18 | |
| cd12399 | 78 | cd12399, RRM_HP0827_like, RNA recognition motif in | 8e-18 | |
| cd12448 | 73 | cd12448, RRM2_gar2, RNA recognition motif 2 in yea | 9e-18 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 2e-16 | |
| cd12401 | 76 | cd12401, RRM_eIF4H, RNA recognition motif in eukar | 5e-16 | |
| cd12398 | 75 | cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot | 8e-16 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 9e-16 | |
| cd12402 | 77 | cd12402, RRM_eIF4B, RNA recognition motif in eukar | 1e-15 | |
| cd12283 | 73 | cd12283, RRM1_RBM39_like, RNA recognition motif 1 | 1e-15 | |
| cd12254 | 73 | cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit | 2e-15 | |
| smart00360 | 73 | smart00360, RRM, RNA recognition motif | 4e-15 | |
| cd12395 | 73 | cd12395, RRM2_RBM34, RNA recognition motif 2 in RN | 3e-14 | |
| cd12391 | 72 | cd12391, RRM1_SART3, RNA recognition motif 1 in sq | 3e-14 | |
| cd12414 | 76 | cd12414, RRM2_RBM28_like, RNA recognition motif 2 | 7e-14 | |
| pfam14259 | 69 | pfam14259, RRM_6, RNA recognition motif (a | 4e-13 | |
| cd12272 | 72 | cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar | 6e-13 | |
| COG0724 | 306 | COG0724, COG0724, RNA-binding proteins (RRM domain | 6e-13 | |
| cd12306 | 73 | cd12306, RRM_II_PABPs, RNA recognition motif in ty | 7e-13 | |
| cd12387 | 72 | cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 | 9e-13 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 2e-12 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-12 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 4e-12 | |
| cd12378 | 80 | cd12378, RRM1_I_PABPs, RNA recognition motif 1 in | 7e-12 | |
| cd12225 | 77 | cd12225, RRM1_2_CID8_like, RNA recognition motif 1 | 7e-12 | |
| cd12400 | 74 | cd12400, RRM_Nop6, RNA recognition motif in Saccha | 8e-12 | |
| cd12353 | 75 | cd12353, RRM2_TIA1_like, RNA recognition motif 2 i | 3e-11 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 4e-11 | |
| cd12447 | 76 | cd12447, RRM1_gar2, RNA recognition motif 1 in yea | 4e-11 | |
| cd12674 | 79 | cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye | 4e-11 | |
| cd00590 | 72 | cd00590, RRM_SF, RNA recognition motif (RRM) super | 7e-11 | |
| pfam00076 | 70 | pfam00076, RRM_1, RNA recognition motif | 7e-11 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 7e-11 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 1e-10 | |
| cd12395 | 73 | cd12395, RRM2_RBM34, RNA recognition motif 2 in RN | 1e-10 | |
| cd12297 | 78 | cd12297, RRM2_Prp24, RNA recognition motif 2 in fu | 1e-10 | |
| cd12413 | 79 | cd12413, RRM1_RBM28_like, RNA recognition motif 1 | 1e-10 | |
| PTZ00146 | 293 | PTZ00146, PTZ00146, fibrillarin; Provisional | 1e-10 | |
| cd12450 | 77 | cd12450, RRM1_NUCLs, RNA recognition motif 1 found | 2e-10 | |
| cd12284 | 73 | cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 | 2e-10 | |
| cd12320 | 76 | cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot | 2e-10 | |
| cd12354 | 73 | cd12354, RRM3_TIA1_like, RNA recognition motif 2 i | 2e-10 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 3e-10 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 4e-10 | |
| cd12412 | 80 | cd12412, RRM_DAZL_BOULE, RNA recognition motif in | 4e-10 | |
| cd12671 | 75 | cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i | 5e-10 | |
| cd12508 | 80 | cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif | 7e-10 | |
| cd12230 | 82 | cd12230, RRM1_U2AF65, RNA recognition motif 1 foun | 1e-09 | |
| cd12411 | 89 | cd12411, RRM_ist3_like, RNA recognition motif in i | 1e-09 | |
| cd12298 | 78 | cd12298, RRM3_Prp24, RNA recognition motif 3 in fu | 1e-09 | |
| cd12307 | 74 | cd12307, RRM_NIFK_like, RNA recognition motif in n | 2e-09 | |
| cd12514 | 73 | cd12514, RRM4_RBM12_like, RNA recognition motif 4 | 2e-09 | |
| cd12389 | 77 | cd12389, RRM2_RAVER, RNA recognition motif 2 in ri | 3e-09 | |
| cd12344 | 81 | cd12344, RRM1_SECp43_like, RNA recognition motif 1 | 4e-09 | |
| cd12511 | 73 | cd12511, RRM2_RBM12_like, RNA recognition motif 2 | 4e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-09 | |
| pfam14259 | 69 | pfam14259, RRM_6, RNA recognition motif (a | 7e-09 | |
| cd12382 | 80 | cd12382, RRM_RBMX_like, RNA recognition motif in h | 7e-09 | |
| cd12392 | 81 | cd12392, RRM2_SART3, RNA recognition motif 2 in sq | 7e-09 | |
| cd12390 | 92 | cd12390, RRM3_RAVER, RNA recognition motif 3 in ri | 8e-09 | |
| cd12225 | 77 | cd12225, RRM1_2_CID8_like, RNA recognition motif 1 | 9e-09 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 1e-08 | |
| cd12298 | 78 | cd12298, RRM3_Prp24, RNA recognition motif 3 in fu | 1e-08 | |
| cd12260 | 85 | cd12260, RRM2_SREK1, RNA recognition motif 2 in sp | 1e-08 | |
| cd12363 | 78 | cd12363, RRM_TRA2, RNA recognition motif in transf | 1e-08 | |
| cd12309 | 79 | cd12309, RRM2_Spen, RNA recognition motif 2 in the | 1e-08 | |
| cd12418 | 75 | cd12418, RRM_Aly_REF_like, RNA recognition motif i | 1e-08 | |
| cd12391 | 72 | cd12391, RRM1_SART3, RNA recognition motif 1 in sq | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-08 | |
| cd12271 | 72 | cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar | 2e-08 | |
| cd12361 | 77 | cd12361, RRM1_2_CELF1-6_like, RNA recognition moti | 3e-08 | |
| cd12619 | 75 | cd12619, RRM2_PUB1, RNA recognition motif 2 in yea | 3e-08 | |
| cd12407 | 76 | cd12407, RRM_FOX1_like, RNA recognition motif in v | 3e-08 | |
| cd12335 | 83 | cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp | 3e-08 | |
| cd12415 | 82 | cd12415, RRM3_RBM28_like, RNA recognition motif 3 | 4e-08 | |
| cd12746 | 78 | cd12746, RRM2_RBM12B, RNA recognition motif 2 in R | 5e-08 | |
| cd12332 | 71 | cd12332, RRM1_p54nrb_like, RNA recognition motif 1 | 5e-08 | |
| cd12459 | 80 | cd12459, RRM1_CID8_like, RNA recognition motif 1 i | 5e-08 | |
| cd12345 | 80 | cd12345, RRM2_SECp43_like, RNA recognition motif 2 | 5e-08 | |
| cd12346 | 72 | cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti | 5e-08 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 6e-08 | |
| cd12400 | 74 | cd12400, RRM_Nop6, RNA recognition motif in Saccha | 8e-08 | |
| PTZ00146 | 293 | PTZ00146, PTZ00146, fibrillarin; Provisional | 8e-08 | |
| cd12448 | 73 | cd12448, RRM2_gar2, RNA recognition motif 2 in yea | 9e-08 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 9e-08 | |
| cd12316 | 74 | cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot | 9e-08 | |
| cd12306 | 73 | cd12306, RRM_II_PABPs, RNA recognition motif in ty | 1e-07 | |
| cd12240 | 78 | cd12240, RRM_NCBP2, RNA recognition motif found in | 1e-07 | |
| cd12315 | 77 | cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 | 1e-07 | |
| cd12397 | 73 | cd12397, RRM2_Nop13p_fungi, RNA recognition motif | 1e-07 | |
| cd12650 | 78 | cd12650, RRM1_Hu, RNA recognition motif 1 in the H | 1e-07 | |
| PLN03134 | 144 | PLN03134, PLN03134, glycine-rich RNA-binding prote | 1e-07 | |
| cd12399 | 78 | cd12399, RRM_HP0827_like, RNA recognition motif in | 2e-07 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 2e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-07 | |
| PLN03134 | 144 | PLN03134, PLN03134, glycine-rich RNA-binding prote | 2e-07 | |
| cd12404 | 77 | cd12404, RRM2_NCL, RNA recognition motif 2 in vert | 2e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-07 | |
| cd12385 | 76 | cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 | 2e-07 | |
| cd12386 | 74 | cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 | 2e-07 | |
| cd12379 | 77 | cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou | 2e-07 | |
| cd12291 | 72 | cd12291, RRM1_La, RNA recognition motif 1 in La au | 2e-07 | |
| cd12283 | 73 | cd12283, RRM1_RBM39_like, RNA recognition motif 1 | 3e-07 | |
| cd12310 | 72 | cd12310, RRM3_Spen, RNA recognition motif 3 in the | 3e-07 | |
| cd12384 | 76 | cd12384, RRM_RBM24_RBM38_like, RNA recognition mot | 3e-07 | |
| cd12377 | 78 | cd12377, RRM3_Hu, RNA recognition motif 3 in the H | 3e-07 | |
| cd12506 | 75 | cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition m | 3e-07 | |
| cd12649 | 81 | cd12649, RRM1_SXL, RNA recognition motif 1 in Dros | 3e-07 | |
| cd12239 | 82 | cd12239, RRM2_RBM40_like, RNA recognition motif 2 | 3e-07 | |
| cd12618 | 80 | cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc | 3e-07 | |
| cd12336 | 75 | cd12336, RRM_RBM7_like, RNA recognition motif in R | 3e-07 | |
| cd12454 | 80 | cd12454, RRM2_RIM4_like, RNA recognition motif 2 i | 5e-07 | |
| cd12459 | 80 | cd12459, RRM1_CID8_like, RNA recognition motif 1 i | 6e-07 | |
| cd12564 | 76 | cd12564, RRM1_RBM19, RNA recognition motif 1 in RN | 6e-07 | |
| cd12237 | 93 | cd12237, RRM_snRNP35, RNA recognition motif found | 6e-07 | |
| cd12318 | 82 | cd12318, RRM5_RBM19_like, RNA recognition motif 5 | 6e-07 | |
| cd12324 | 88 | cd12324, RRM_RBM8, RNA recognition motif in RNA-bi | 6e-07 | |
| cd12337 | 70 | cd12337, RRM1_SRSF4_like, RNA recognition motif 1 | 6e-07 | |
| TIGR01661 | 352 | TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f | 6e-07 | |
| cd12550 | 76 | cd12550, RRM_II_PABPN1, RNA recognition motif in t | 7e-07 | |
| cd12375 | 77 | cd12375, RRM1_Hu_like, RNA recognition motif 1 in | 8e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-07 | |
| cd12570 | 76 | cd12570, RRM5_MRD1, RNA recognition motif 5 in yea | 9e-07 | |
| cd12622 | 74 | cd12622, RRM3_PUB1, RNA recognition motif 3 in yea | 9e-07 | |
| cd12229 | 81 | cd12229, RRM_G3BP, RNA recognition motif (RRM) in | 1e-06 | |
| cd12393 | 78 | cd12393, RRM_ZCRB1, RNA recognition motif in Zinc | 1e-06 | |
| cd12408 | 77 | cd12408, RRM_eIF3G_like, RNA recognition motif in | 1e-06 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 1e-06 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 2e-06 | |
| cd12408 | 77 | cd12408, RRM_eIF3G_like, RNA recognition motif in | 2e-06 | |
| cd12617 | 80 | cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc | 2e-06 | |
| cd12334 | 74 | cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp | 2e-06 | |
| TIGR01659 | 346 | TIGR01659, sex-lethal, sex-lethal family splicing | 2e-06 | |
| cd12566 | 79 | cd12566, RRM2_MRD1, RNA recognition motif 2 in yea | 2e-06 | |
| cd12409 | 84 | cd12409, RRM1_RRT5, RNA recognition motif 1 in yea | 2e-06 | |
| cd12365 | 73 | cd12365, RRM_RNPS1, RNA recognition motif in RNA-b | 2e-06 | |
| PTZ00146 | 293 | PTZ00146, PTZ00146, fibrillarin; Provisional | 3e-06 | |
| cd12284 | 73 | cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 | 3e-06 | |
| cd12502 | 72 | cd12502, RRM2_RMB19, RNA recognition motif 2 in RN | 3e-06 | |
| pfam13893 | 56 | pfam13893, RRM_5, RNA recognition motif | 3e-06 | |
| cd12555 | 87 | cd12555, RRM2_RBM15, RNA recognition motif 2 in ve | 3e-06 | |
| cd12355 | 80 | cd12355, RRM_RBM18, RNA recognition motif in eukar | 3e-06 | |
| cd12505 | 75 | cd12505, RRM2_GRSF1, RNA recognition motif 2 in G- | 3e-06 | |
| cd12381 | 79 | cd12381, RRM4_I_PABPs, RNA recognition motif 4 in | 3e-06 | |
| cd12362 | 73 | cd12362, RRM3_CELF1-6, RNA recognition motif 3 in | 3e-06 | |
| cd12405 | 72 | cd12405, RRM3_NCL, RNA recognition motif 3 in vert | 3e-06 | |
| cd12272 | 72 | cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar | 4e-06 | |
| cd12513 | 81 | cd12513, RRM3_RBM12B, RNA recognition motif 3 in R | 4e-06 | |
| cd12537 | 85 | cd12537, RRM1_RBM23, RNA recognition motif 1 in ve | 4e-06 | |
| cd12453 | 86 | cd12453, RRM1_RIM4_like, RNA recognition motif 1 i | 4e-06 | |
| cd12446 | 84 | cd12446, RRM_RBM25, RNA recognition motif in eukar | 4e-06 | |
| cd12251 | 72 | cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 | 4e-06 | |
| cd12561 | 81 | cd12561, RRM1_RBM5_like, RNA recognition motif 1 i | 4e-06 | |
| cd12290 | 80 | cd12290, RRM1_LARP7, RNA recognition motif 1 in La | 4e-06 | |
| cd12347 | 73 | cd12347, RRM_PPIE, RNA recognition motif in cyclop | 4e-06 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 5e-06 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 5e-06 | |
| cd12226 | 78 | cd12226, RRM_NOL8, RNA recognition motif in nucleo | 5e-06 | |
| cd12236 | 91 | cd12236, RRM_snRNP70, RNA recognition motif in U1 | 5e-06 | |
| cd12312 | 84 | cd12312, RRM_SRSF10_SRSF12, RNA recognition motif | 5e-06 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 5e-06 | |
| cd12271 | 72 | cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar | 6e-06 | |
| PRK08581 | 619 | PRK08581, PRK08581, N-acetylmuramoyl-L-alanine ami | 6e-06 | |
| cd12551 | 77 | cd12551, RRM_II_PABPN1L, RNA recognition motif in | 6e-06 | |
| cd12413 | 79 | cd12413, RRM1_RBM28_like, RNA recognition motif 1 | 7e-06 | |
| cd12403 | 75 | cd12403, RRM1_NCL, RNA recognition motif 1 in vert | 8e-06 | |
| cd12571 | 79 | cd12571, RRM6_RBM19, RNA recognition motif 6 in RN | 8e-06 | |
| cd12227 | 77 | cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in | 8e-06 | |
| cd12673 | 81 | cd12673, RRM_BOULE, RNA recognition motif in prote | 8e-06 | |
| cd12347 | 73 | cd12347, RRM_PPIE, RNA recognition motif in cyclop | 9e-06 | |
| cd12383 | 83 | cd12383, RRM_RBM42, RNA recognition motif in RNA-b | 1e-05 | |
| cd12249 | 78 | cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 | 1e-05 | |
| cd12339 | 71 | cd12339, RRM2_SRSF1_4_like, RNA recognition motif | 1e-05 | |
| cd12380 | 80 | cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou | 1e-05 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 1e-05 | |
| cd12747 | 75 | cd12747, RRM2_RBM12, RNA recognition motif 2 in RN | 1e-05 | |
| cd12552 | 77 | cd12552, RRM_Nop15p, RNA recognition motif in yeas | 1e-05 | |
| cd12242 | 73 | cd12242, RRM_SLIRP, RNA recognition motif found in | 1e-05 | |
| cd12769 | 81 | cd12769, RRM1_HuR, RNA recognition motif 1 in vert | 1e-05 | |
| cd12417 | 74 | cd12417, RRM_SAFB_like, RNA recognition motif in t | 1e-05 | |
| cd12260 | 85 | cd12260, RRM2_SREK1, RNA recognition motif 2 in sp | 2e-05 | |
| PRK08581 | 619 | PRK08581, PRK08581, N-acetylmuramoyl-L-alanine ami | 2e-05 | |
| cd12380 | 80 | cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou | 2e-05 | |
| cd12599 | 72 | cd12599, RRM1_SF2_plant_like, RNA recognition moti | 2e-05 | |
| cd12503 | 77 | cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition m | 2e-05 | |
| cd12321 | 77 | cd12321, RRM1_TDP43, RNA recognition motif 1 in TA | 2e-05 | |
| cd12596 | 70 | cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve | 2e-05 | |
| cd12313 | 84 | cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti | 2e-05 | |
| cd12346 | 72 | cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti | 3e-05 | |
| cd12397 | 73 | cd12397, RRM2_Nop13p_fungi, RNA recognition motif | 3e-05 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 3e-05 | |
| cd12680 | 75 | cd12680, RRM_THOC4, RNA recognition motif in THO c | 3e-05 | |
| cd12565 | 76 | cd12565, RRM1_MRD1, RNA recognition motif 1 in yea | 3e-05 | |
| cd12370 | 76 | cd12370, RRM1_PUF60, RNA recognition motif 1 in (U | 3e-05 | |
| cd12504 | 77 | cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 | 3e-05 | |
| pfam07172 | 91 | pfam07172, GRP, Glycine rich protein family | 3e-05 | |
| cd12672 | 82 | cd12672, RRM_DAZL, RNA recognition motif in verteb | 3e-05 | |
| PRK14949 | 944 | PRK14949, PRK14949, DNA polymerase III subunits ga | 3e-05 | |
| cd12586 | 71 | cd12586, RRM1_PSP1, RNA recognition motif 1 in ver | 4e-05 | |
| cd12371 | 77 | cd12371, RRM2_PUF60, RNA recognition motif 2 in (U | 4e-05 | |
| cd12463 | 80 | cd12463, RRM_G3BP1, RNA recognition motif found in | 4e-05 | |
| cd12241 | 77 | cd12241, RRM_SF3B14, RNA recognition motif found i | 4e-05 | |
| cd12341 | 68 | cd12341, RRM_hnRNPC_like, RNA recognition motif in | 4e-05 | |
| cd12485 | 78 | cd12485, RRM1_RBM47, RNA recognition motif 1 found | 4e-05 | |
| cd12659 | 76 | cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v | 5e-05 | |
| cd12611 | 81 | cd12611, RRM1_NGR1_NAM8_like, RNA recognition moti | 5e-05 | |
| cd12771 | 83 | cd12771, RRM1_HuB, RNA recognition motif 1 in vert | 5e-05 | |
| cd12585 | 75 | cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h | 5e-05 | |
| cd12447 | 76 | cd12447, RRM1_gar2, RNA recognition motif 1 in yea | 6e-05 | |
| cd12415 | 82 | cd12415, RRM3_RBM28_like, RNA recognition motif 3 | 6e-05 | |
| cd12404 | 77 | cd12404, RRM2_NCL, RNA recognition motif 2 in vert | 6e-05 | |
| cd12536 | 85 | cd12536, RRM1_RBM39, RNA recognition motif 1 in ve | 6e-05 | |
| cd12735 | 75 | cd12735, RRM3_hnRNPH3, RNA recognition motif 3 in | 6e-05 | |
| PRK06958 | 182 | PRK06958, PRK06958, single-stranded DNA-binding pr | 6e-05 | |
| cd12381 | 79 | cd12381, RRM4_I_PABPs, RNA recognition motif 4 in | 7e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 7e-05 | |
| cd12670 | 79 | cd12670, RRM2_Nop12p_like, RNA recognition motif 2 | 7e-05 | |
| cd12556 | 85 | cd12556, RRM2_RBM15B, RNA recognition motif 2 in p | 7e-05 | |
| PTZ00441 | 576 | PTZ00441, PTZ00441, sporozoite surface protein 2 ( | 8e-05 | |
| cd12614 | 74 | cd12614, RRM1_PUB1, RNA recognition motif 1 in yea | 8e-05 | |
| cd12451 | 79 | cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu | 9e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-05 | |
| cd12267 | 77 | cd12267, RRM_YRA1_MLO3, RNA recognition motif in y | 9e-05 | |
| cd12748 | 76 | cd12748, RRM4_RBM12B, RNA recognition motif 4 in R | 9e-05 | |
| cd12327 | 80 | cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D | 9e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 1e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-04 | |
| cd12365 | 73 | cd12365, RRM_RNPS1, RNA recognition motif in RNA-b | 1e-04 | |
| cd12460 | 82 | cd12460, RRM2_CID8_like, RNA recognition motif 2 i | 1e-04 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 1e-04 | |
| cd12275 | 71 | cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti | 1e-04 | |
| cd12613 | 80 | cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti | 1e-04 | |
| cd12253 | 79 | cd12253, RRM_PIN4_like, RNA recognition motif in y | 1e-04 | |
| cd12575 | 74 | cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 | 1e-04 | |
| cd12770 | 83 | cd12770, RRM1_HuD, RNA recognition motif 1 in vert | 1e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 2e-04 | |
| cd12316 | 74 | cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot | 2e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-04 | |
| PRK08581 | 619 | PRK08581, PRK08581, N-acetylmuramoyl-L-alanine ami | 2e-04 | |
| cd12593 | 75 | cd12593, RRM_RBM11, RNA recognition motif in verte | 2e-04 | |
| cd12231 | 77 | cd12231, RRM2_U2AF65, RNA recognition motif 2 foun | 2e-04 | |
| cd12660 | 76 | cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve | 2e-04 | |
| cd12756 | 74 | cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h | 2e-04 | |
| cd12675 | 83 | cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye | 2e-04 | |
| cd12414 | 76 | cd12414, RRM2_RBM28_like, RNA recognition motif 2 | 3e-04 | |
| PRK08581 | 619 | PRK08581, PRK08581, N-acetylmuramoyl-L-alanine ami | 3e-04 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 3e-04 | |
| cd12426 | 79 | cd12426, RRM4_PTBPH3, RNA recognition motif 4 in p | 3e-04 | |
| cd12233 | 70 | cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m | 3e-04 | |
| cd12330 | 75 | cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye | 3e-04 | |
| pfam05268 | 261 | pfam05268, GP38, Phage tail fibre adhesin Gp38 | 3e-04 | |
| cd12574 | 82 | cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D | 3e-04 | |
| cd12392 | 81 | cd12392, RRM2_SART3, RNA recognition motif 2 in sq | 4e-04 | |
| cd12566 | 79 | cd12566, RRM2_MRD1, RNA recognition motif 2 in yea | 4e-04 | |
| cd12313 | 84 | cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti | 4e-04 | |
| cd12734 | 76 | cd12734, RRM3_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti | 4e-04 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 4e-04 | |
| cd12394 | 91 | cd12394, RRM1_RBM34, RNA recognition motif 1 in RN | 4e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 4e-04 | |
| cd12323 | 74 | cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- | 4e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-04 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 5e-04 | |
| cd12350 | 74 | cd12350, RRM3_SHARP, RNA recognition motif 3 in SM | 5e-04 | |
| cd12244 | 79 | cd12244, RRM2_MSSP, RNA recognition motif 2 in the | 5e-04 | |
| cd12567 | 79 | cd12567, RRM3_RBM19, RNA recognition motif 3 in RN | 5e-04 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 5e-04 | |
| cd12441 | 73 | cd12441, RRM_Nup53_like, RNA recognition motif in | 5e-04 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 6e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 6e-04 | |
| cd12449 | 80 | cd12449, RRM_CIRBP_RBM3, RNA recognition motif in | 6e-04 | |
| cd12338 | 72 | cd12338, RRM1_SRSF1_like, RNA recognition motif 1 | 6e-04 | |
| cd12366 | 81 | cd12366, RRM1_RBM45, RNA recognition motif 1 in RN | 6e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 7e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 7e-04 | |
| cd12730 | 79 | cd12730, RRM1_GRSF1, RNA recognition motif 1 in G- | 7e-04 | |
| cd12228 | 84 | cd12228, RRM_ENOX, RNA recognition motif (RRM) in | 7e-04 | |
| cd12536 | 85 | cd12536, RRM1_RBM39, RNA recognition motif 1 in ve | 8e-04 | |
| TIGR04260 | 119 | TIGR04260, Cyano_gly_rpt, rSAM-associated Gly-rich | 8e-04 | |
| cd12245 | 79 | cd12245, RRM_scw1_like, RNA recognition motif in y | 8e-04 | |
| cd12484 | 78 | cd12484, RRM1_RBM46, RNA recognition motif 1 found | 8e-04 | |
| cd12251 | 72 | cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 | 9e-04 | |
| cd12398 | 75 | cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot | 0.001 | |
| PTZ00146 | 293 | PTZ00146, PTZ00146, fibrillarin; Provisional | 0.001 | |
| cd12382 | 80 | cd12382, RRM_RBMX_like, RNA recognition motif in h | 0.001 | |
| cd12449 | 80 | cd12449, RRM_CIRBP_RBM3, RNA recognition motif in | 0.001 | |
| cd12475 | 88 | cd12475, RRM2_RBMS3, RNA recognition motif 2 found | 0.001 | |
| cd12319 | 84 | cd12319, RRM4_MRD1, RNA recognition motif 4 in yea | 0.001 | |
| cd12325 | 72 | cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition | 0.001 | |
| cd12325 | 72 | cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition | 0.001 | |
| cd12340 | 67 | cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in | 0.001 | |
| cd12250 | 82 | cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 | 0.001 | |
| COG1512 | 271 | COG1512, COG1512, Beta-propeller domains of methan | 0.001 | |
| COG1512 | 271 | COG1512, COG1512, Beta-propeller domains of methan | 0.001 | |
| cd12257 | 72 | cd12257, RRM1_RBM26_like, RNA recognition motif 1 | 0.001 | |
| cd12584 | 80 | cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in | 0.001 | |
| cd12352 | 72 | cd12352, RRM1_TIA1_like, RNA recognition motif 1 i | 0.001 | |
| cd12396 | 85 | cd12396, RRM1_Nop13p_fungi, RNA recognition motif | 0.001 | |
| cd12322 | 71 | cd12322, RRM2_TDP43, RNA recognition motif 2 in TA | 0.001 | |
| cd12633 | 80 | cd12633, RRM1_FCA, RNA recognition motif 1 in plan | 0.001 | |
| cd12658 | 76 | cd12658, RRM1_MYEF2, RNA recognition motif 1 in ve | 0.001 | |
| cd12401 | 76 | cd12401, RRM_eIF4H, RNA recognition motif in eukar | 0.002 | |
| cd12411 | 89 | cd12411, RRM_ist3_like, RNA recognition motif in i | 0.002 | |
| cd12237 | 93 | cd12237, RRM_snRNP35, RNA recognition motif found | 0.002 | |
| cd12318 | 82 | cd12318, RRM5_RBM19_like, RNA recognition motif 5 | 0.002 | |
| cd12330 | 75 | cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye | 0.002 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.002 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.002 | |
| cd12758 | 76 | cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h | 0.002 | |
| cd12276 | 71 | cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti | 0.002 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.002 | |
| cd12452 | 88 | cd12452, RRM_ARP_like, RNA recognition motif in ye | 0.002 | |
| cd12592 | 75 | cd12592, RRM_RBM7, RNA recognition motif in verteb | 0.002 | |
| pfam05505 | 717 | pfam05505, Ebola_NP, Ebola nucleoprotein | 0.002 | |
| cd12464 | 83 | cd12464, RRM_G3BP2, RNA recognition motif in ras G | 0.002 | |
| cd12651 | 79 | cd12651, RRM2_SXL, RNA recognition motif 2 in Dros | 0.002 | |
| cd12595 | 70 | cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve | 0.002 | |
| cd12657 | 76 | cd12657, RRM1_hnRNPM, RNA recognition motif 1 in v | 0.002 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.003 | |
| cd12242 | 73 | cd12242, RRM_SLIRP, RNA recognition motif found in | 0.003 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.003 | |
| cd12486 | 78 | cd12486, RRM1_ACF, RNA recognition motif 1 found i | 0.003 | |
| cd12772 | 84 | cd12772, RRM1_HuC, RNA recognition motif 1 in vert | 0.003 | |
| cd12360 | 78 | cd12360, RRM_cwf2, RNA recognition motif in yeast | 0.003 | |
| cd12224 | 74 | cd12224, RRM_RBM22, RNA recognition motif (RRM) fo | 0.003 | |
| pfam03753 | 993 | pfam03753, HHV6-IE, Human herpesvirus 6 immediate | 0.003 | |
| cd12296 | 71 | cd12296, RRM1_Prp24, RNA recognition motif 1 in fu | 0.003 | |
| cd12384 | 76 | cd12384, RRM_RBM24_RBM38_like, RNA recognition mot | 0.004 | |
| cd12537 | 85 | cd12537, RRM1_RBM23, RNA recognition motif 1 in ve | 0.004 | |
| cd12446 | 84 | cd12446, RRM_RBM25, RNA recognition motif in eukar | 0.004 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 0.004 | |
| cd12233 | 70 | cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m | 0.004 | |
| cd12366 | 81 | cd12366, RRM1_RBM45, RNA recognition motif 1 in RN | 0.004 | |
| cd12667 | 92 | cd12667, RRM3_RAVER1, RNA recognition motif 3 in v | 0.004 | |
| cd12652 | 79 | cd12652, RRM2_Hu, RNA recognition motif 2 in the H | 0.004 | |
| cd12600 | 72 | cd12600, RRM2_SRSF4_like, RNA recognition motif 2 | 0.004 | |
| cd12273 | 71 | cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve | 0.004 | |
| cd12512 | 101 | cd12512, RRM3_RBM12, RNA recognition motif 3 in RN | 0.004 | |
| cd12757 | 75 | cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in | 0.004 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 0.004 | |
| cd12576 | 75 | cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- | 0.004 | |
| cd12612 | 82 | cd12612, RRM2_SECp43, RNA recognition motif 2 in t | 0.004 |
| >gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
Score = 114 bits (287), Expect = 1e-30
Identities = 49/79 (62%), Positives = 63/79 (79%)
Query: 520 TIFIKGFDSSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNK 579
TIF+KGFDSS+GED +R SL EHF SCGEITR+S+P D +TG+ KG AY++F D K
Sbjct: 1 TIFVKGFDSSLGEDDIRRSLTEHFSSCGEITRVSIPTDRETGASKGFAYIEFKSVDGVEK 60
Query: 580 ALEMSGTEIGGYSLVVDEA 598
ALE+ G+++GG +LVVDEA
Sbjct: 61 ALELDGSDLGGGNLVVDEA 79
|
This subfamily corresponds to the RRM2 of a group of plant nucleolin-like proteins, including nucleolin 1 (also termed protein nucleolin like 1) and nucleolin 2 (also termed protein nucleolin like 2, or protein parallel like 1). They play roles in the regulation of ribosome synthesis and in the growth and development of plants. Like yeast nucleolin, nucleolin-like proteins possess two RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). . Length = 79 |
| >gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
| >gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|214636 smart00360, RRM, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214636 smart00360, RRM, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a | Back alignment and domain information |
|---|
| >gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
| >gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE | Back alignment and domain information |
|---|
| >gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240952 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family | Back alignment and domain information |
|---|
| >gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding protein RBM12, RBM12B and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240955 cd12511, RRM2_RBM12_like, RNA recognition motif 2 in RNA-binding protein RBM12, RBM12B and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a | Back alignment and domain information |
|---|
| >gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family | Back alignment and domain information |
|---|
| >gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA | Back alignment and domain information |
|---|
| >gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241190 cd12746, RRM2_RBM12B, RNA recognition motif 2 in RNA-binding protein 12B (RBM12B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family | Back alignment and domain information |
|---|
| >gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|240950 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) | Back alignment and domain information |
|---|
| >gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240949 cd12505, RRM2_GRSF1, RNA recognition motif 2 in G-rich sequence factor 1 (GRSF-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240957 cd12513, RRM3_RBM12B, RNA recognition motif 3 in RNA-binding protein 12B (RBM12B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) | Back alignment and domain information |
|---|
| >gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236304 PRK08581, PRK08581, N-acetylmuramoyl-L-alanine amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) | Back alignment and domain information |
|---|
| >gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE | Back alignment and domain information |
|---|
| >gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241191 cd12747, RRM2_RBM12, RNA recognition motif 2 in RNA-binding protein 12 (RBM12) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) | Back alignment and domain information |
|---|
| >gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family | Back alignment and domain information |
|---|
| >gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236304 PRK08581, PRK08581, N-acetylmuramoyl-L-alanine amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240947 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) | Back alignment and domain information |
|---|
| >gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240948 cd12504, RRM2_hnRNPH_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family | Back alignment and domain information |
|---|
| >gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family | Back alignment and domain information |
|---|
| >gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237863 PRK14949, PRK14949, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) | Back alignment and domain information |
|---|
| >gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) | Back alignment and domain information |
|---|
| >gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) | Back alignment and domain information |
|---|
| >gnl|CDD|241055 cd12611, RRM1_NGR1_NAM8_like, RNA recognition motif 1 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) | Back alignment and domain information |
|---|
| >gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) | Back alignment and domain information |
|---|
| >gnl|CDD|241179 cd12735, RRM3_hnRNPH3, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein H3 (hnRNP H3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate | Back alignment and domain information |
|---|
| >gnl|CDD|240420 PTZ00441, PTZ00441, sporozoite surface protein 2 (SSP2); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241192 cd12748, RRM4_RBM12B, RNA recognition motif 4 in RNA-binding protein 12B (RBM12B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240906 cd12460, RRM2_CID8_like, RNA recognition motif 2 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236304 PRK08581, PRK08581, N-acetylmuramoyl-L-alanine amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) | Back alignment and domain information |
|---|
| >gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) | Back alignment and domain information |
|---|
| >gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236304 PRK08581, PRK08581, N-acetylmuramoyl-L-alanine amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|240872 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) | Back alignment and domain information |
|---|
| >gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|147458 pfam05268, GP38, Phage tail fibre adhesin Gp38 | Back alignment and domain information |
|---|
| >gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241178 cd12734, RRM3_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP H2, hnRNP F and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family | Back alignment and domain information |
|---|
| >gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240887 cd12441, RRM_Nup53_like, RNA recognition motif in nucleoporin Nup53 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|241174 cd12730, RRM1_GRSF1, RNA recognition motif 1 in G-rich sequence factor 1 (GRSF-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or ENOX) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) | Back alignment and domain information |
|---|
| >gnl|CDD|234526 TIGR04260, Cyano_gly_rpt, rSAM-associated Gly-rich repeat protein | Back alignment and domain information |
|---|
| >gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) | Back alignment and domain information |
|---|
| >gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) | Back alignment and domain information |
|---|
| >gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224429 COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224429 COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|240842 cd12396, RRM1_Nop13p_fungi, RNA recognition motif 1 in yeast nucleolar protein 13 (Nop13p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241102 cd12658, RRM1_MYEF2, RNA recognition motif 1 in vertebrate myelin expression factor 2 (MEF-2) | Back alignment and domain information |
|---|
| >gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family | Back alignment and domain information |
|---|
| >gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|240898 cd12452, RRM_ARP_like, RNA recognition motif in yeast asparagine-rich protein (ARP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) | Back alignment and domain information |
|---|
| >gnl|CDD|147601 pfam05505, Ebola_NP, Ebola nucleoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) | Back alignment and domain information |
|---|
| >gnl|CDD|241101 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) | Back alignment and domain information |
|---|
| >gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) | Back alignment and domain information |
|---|
| >gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|112562 pfam03753, HHV6-IE, Human herpesvirus 6 immediate early protein | Back alignment and domain information |
|---|
| >gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) | Back alignment and domain information |
|---|
| >gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241111 cd12667, RRM3_RAVER1, RNA recognition motif 3 in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) | Back alignment and domain information |
|---|
| >gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|241044 cd12600, RRM2_SRSF4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp | Back alignment and domain information |
|---|
| >gnl|CDD|240956 cd12512, RRM3_RBM12, RNA recognition motif 3 in RNA-binding protein 12 (RBM12) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 675 | |||
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 100.0 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.97 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.96 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.96 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.95 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.95 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.95 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 99.94 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.94 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 99.93 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.93 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 99.92 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.92 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.92 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 99.92 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.9 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 99.9 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 99.9 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.9 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 99.9 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 99.89 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.89 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 99.88 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 99.88 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 99.86 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 99.85 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 99.82 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 99.82 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.81 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 99.77 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 99.77 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.76 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 99.76 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 99.76 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 99.76 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 99.75 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 99.74 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 99.72 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.7 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 99.69 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 99.68 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 99.66 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.63 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 99.6 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 99.59 | |
| KOG4207 | 256 | consensus Predicted splicing factor, SR protein su | 99.56 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.55 | |
| KOG0121 | 153 | consensus Nuclear cap-binding protein complex, sub | 99.55 | |
| KOG4210 | 285 | consensus Nuclear localization sequence binding pr | 99.53 | |
| KOG0113 | 335 | consensus U1 small nuclear ribonucleoprotein (RRM | 99.52 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 99.52 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 99.52 | |
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 99.51 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 99.5 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 99.49 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 99.49 | |
| KOG0113 | 335 | consensus U1 small nuclear ribonucleoprotein (RRM | 99.49 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 99.49 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 99.48 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 99.47 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 99.46 | |
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 99.46 | |
| KOG4207 | 256 | consensus Predicted splicing factor, SR protein su | 99.46 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 99.45 | |
| KOG0126 | 219 | consensus Predicted RNA-binding protein (RRM super | 99.43 | |
| KOG0121 | 153 | consensus Nuclear cap-binding protein complex, sub | 99.42 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 99.42 | |
| KOG0114 | 124 | consensus Predicted RNA-binding protein (RRM super | 99.39 | |
| PLN03213 | 759 | repressor of silencing 3; Provisional | 99.39 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 99.38 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 99.38 | |
| KOG0130 | 170 | consensus RNA-binding protein RBM8/Tsunagi (RRM su | 99.38 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 99.36 | |
| KOG0116 | 419 | consensus RasGAP SH3 binding protein rasputin, con | 99.36 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 99.34 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 99.33 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 99.33 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.32 | |
| KOG0116 | 419 | consensus RasGAP SH3 binding protein rasputin, con | 99.3 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 99.3 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 99.29 | |
| PF03546 | 519 | Treacle: Treacher Collins syndrome protein Treacle | 99.29 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 99.28 | |
| smart00360 | 71 | RRM RNA recognition motif. | 99.26 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 99.26 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 99.26 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 99.24 | |
| KOG0108 | 435 | consensus mRNA cleavage and polyadenylation factor | 99.22 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 99.21 | |
| KOG0130 | 170 | consensus RNA-binding protein RBM8/Tsunagi (RRM su | 99.21 | |
| KOG0114 | 124 | consensus Predicted RNA-binding protein (RRM super | 99.17 | |
| KOG4454 | 267 | consensus RNA binding protein (RRM superfamily) [G | 99.17 | |
| PF03546 | 519 | Treacle: Treacher Collins syndrome protein Treacle | 99.17 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 99.17 | |
| PLN03213 | 759 | repressor of silencing 3; Provisional | 99.16 | |
| KOG0126 | 219 | consensus Predicted RNA-binding protein (RRM super | 99.16 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 99.14 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 99.14 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 99.14 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 99.14 | |
| KOG4208 | 214 | consensus Nucleolar RNA-binding protein NIFK [Gene | 99.08 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 99.06 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.05 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 99.05 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 99.03 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 99.03 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 99.02 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 99.0 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 98.99 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 98.99 | |
| smart00360 | 71 | RRM RNA recognition motif. | 98.98 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 98.97 | |
| KOG0108 | 435 | consensus mRNA cleavage and polyadenylation factor | 98.97 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 98.94 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 98.94 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 98.92 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 98.91 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 98.89 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 98.89 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 98.87 | |
| KOG0153 | 377 | consensus Predicted RNA-binding protein (RRM super | 98.86 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 98.85 | |
| KOG0533 | 243 | consensus RRM motif-containing protein [RNA proces | 98.8 | |
| KOG4209 | 231 | consensus Splicing factor RNPS1, SR protein superf | 98.73 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 98.7 | |
| KOG4208 | 214 | consensus Nucleolar RNA-binding protein NIFK [Gene | 98.68 | |
| KOG0226 | 290 | consensus RNA-binding proteins [General function p | 98.67 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 98.67 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 98.67 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 98.65 | |
| KOG4209 | 231 | consensus Splicing factor RNPS1, SR protein superf | 98.6 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 98.58 | |
| KOG0153 | 377 | consensus Predicted RNA-binding protein (RRM super | 98.55 | |
| KOG0533 | 243 | consensus RRM motif-containing protein [RNA proces | 98.55 | |
| KOG4660 | 549 | consensus Protein Mei2, essential for commitment t | 98.55 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 98.48 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 98.42 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 98.39 | |
| KOG0151 | 877 | consensus Predicted splicing regulator, contains R | 98.38 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 98.38 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 98.34 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 98.3 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 98.28 | |
| KOG0226 | 290 | consensus RNA-binding proteins [General function p | 98.2 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 98.19 | |
| PF11608 | 90 | Limkain-b1: Limkain b1; InterPro: IPR024582 This e | 98.16 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 98.13 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 98.12 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 98.02 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 97.98 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 97.97 | |
| PF11608 | 90 | Limkain-b1: Limkain b1; InterPro: IPR024582 This e | 97.94 | |
| KOG4210 | 285 | consensus Nuclear localization sequence binding pr | 97.92 | |
| KOG4660 | 549 | consensus Protein Mei2, essential for commitment t | 97.9 | |
| KOG3973 | 465 | consensus Uncharacterized conserved glycine-rich p | 97.87 | |
| KOG0151 | 877 | consensus Predicted splicing regulator, contains R | 97.77 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 97.76 | |
| KOG1855 | 484 | consensus Predicted RNA-binding protein [General f | 97.71 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.7 | |
| PF08777 | 105 | RRM_3: RNA binding motif; InterPro: IPR014886 This | 97.63 | |
| KOG4454 | 267 | consensus RNA binding protein (RRM superfamily) [G | 97.62 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 97.58 | |
| KOG1855 | 484 | consensus Predicted RNA-binding protein [General f | 97.57 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 97.48 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.31 | |
| KOG3152 | 278 | consensus TBP-binding protein, activator of basal | 97.3 | |
| PF08952 | 146 | DUF1866: Domain of unknown function (DUF1866) ; In | 97.28 | |
| PF05172 | 100 | Nup35_RRM: Nup53/35/40-type RNA recognition motif; | 97.27 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 97.22 | |
| PF08777 | 105 | RRM_3: RNA binding motif; InterPro: IPR014886 This | 97.19 | |
| PF14605 | 53 | Nup35_RRM_2: Nup53/35/40-type RNA recognition moti | 97.18 | |
| PF05172 | 100 | Nup35_RRM: Nup53/35/40-type RNA recognition motif; | 97.13 | |
| KOG2416 | 718 | consensus Acinus (induces apoptotic chromatin cond | 97.05 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 96.97 | |
| KOG0115 | 275 | consensus RNA-binding protein p54nrb (RRM superfam | 96.94 | |
| PF08952 | 146 | DUF1866: Domain of unknown function (DUF1866) ; In | 96.89 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 96.86 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 96.78 | |
| PF14605 | 53 | Nup35_RRM_2: Nup53/35/40-type RNA recognition moti | 96.63 | |
| KOG1996 | 378 | consensus mRNA splicing factor [RNA processing and | 96.57 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 96.42 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 96.28 | |
| KOG2416 | 718 | consensus Acinus (induces apoptotic chromatin cond | 96.19 | |
| KOG1996 | 378 | consensus mRNA splicing factor [RNA processing and | 96.19 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 96.14 | |
| KOG3152 | 278 | consensus TBP-binding protein, activator of basal | 96.13 | |
| KOG2253 | 668 | consensus U1 snRNP complex, subunit SNU71 and rela | 95.24 | |
| KOG3262 | 215 | consensus H/ACA small nucleolar RNP component GAR1 | 95.09 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 94.94 | |
| PF03467 | 176 | Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 | 94.92 | |
| KOG0115 | 275 | consensus RNA-binding protein p54nrb (RRM superfam | 94.9 | |
| KOG4285 | 350 | consensus Mitotic phosphoprotein [Cell cycle contr | 94.65 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 94.53 | |
| KOG4285 | 350 | consensus Mitotic phosphoprotein [Cell cycle contr | 94.35 | |
| KOG2135 | 526 | consensus Proteins containing the RNA recognition | 94.32 | |
| KOG2318 | 650 | consensus Uncharacterized conserved protein [Funct | 94.28 | |
| PF08675 | 87 | RNA_bind: RNA binding domain; InterPro: IPR014789 | 94.03 | |
| PF15023 | 166 | DUF4523: Protein of unknown function (DUF4523) | 93.48 | |
| PRK06958 | 182 | single-stranded DNA-binding protein; Provisional | 93.45 | |
| PF07576 | 110 | BRAP2: BRCA1-associated protein 2; InterPro: IPR01 | 93.02 | |
| KOG2295 | 648 | consensus C2H2 Zn-finger protein [General function | 92.91 | |
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 92.83 | |
| PF10567 | 309 | Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP | 92.82 | |
| PF10309 | 62 | DUF2414: Protein of unknown function (DUF2414); In | 92.82 | |
| KOG2135 | 526 | consensus Proteins containing the RNA recognition | 92.57 | |
| PF07292 | 88 | NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 | 92.42 | |
| PF15023 | 166 | DUF4523: Protein of unknown function (DUF4523) | 92.22 | |
| PF03467 | 176 | Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 | 92.08 | |
| PF04847 | 184 | Calcipressin: Calcipressin; InterPro: IPR006931 Ca | 91.93 | |
| KOG2591 | 684 | consensus c-Mpl binding protein, contains La domai | 90.95 | |
| KOG3262 | 215 | consensus H/ACA small nucleolar RNP component GAR1 | 90.59 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 90.28 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 90.18 | |
| PF04847 | 184 | Calcipressin: Calcipressin; InterPro: IPR006931 Ca | 89.82 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 89.56 | |
| KOG4574 | 1007 | consensus RNA-binding protein (contains RRM and Pu | 87.89 | |
| PF10309 | 62 | DUF2414: Protein of unknown function (DUF2414); In | 85.68 | |
| PF03880 | 74 | DbpA: DbpA RNA binding domain ; InterPro: IPR00558 | 84.41 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 84.34 | |
| KOG2253 | 668 | consensus U1 snRNP complex, subunit SNU71 and rela | 84.18 | |
| KOG2591 | 684 | consensus c-Mpl binding protein, contains La domai | 82.94 | |
| PHA00370 | 297 | III attachment protein | 82.89 | |
| PF11767 | 66 | SET_assoc: Histone lysine methyltransferase SET as | 82.14 | |
| PF07576 | 110 | BRAP2: BRCA1-associated protein 2; InterPro: IPR01 | 81.58 | |
| PF14111 | 153 | DUF4283: Domain of unknown function (DUF4283) | 80.99 |
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.9e-34 Score=302.68 Aligned_cols=170 Identities=25% Similarity=0.494 Sum_probs=153.4
Q ss_pred CCCceEEEcCCCCCCCHHHHHHHhhhCCCeEEEEEeeCC-CCCcccEEEEEecCHHHHHHHHH-hCCcccCCeeEEEEec
Q 045516 414 GGSKTLFVGNLPFSVEQADVQNFFSEVAEVVDVRLSSDA-DGRFKGYGHVEFASVEDAHKAIE-LNGQMLGNRAIRLDFA 491 (675)
Q Consensus 414 ~~~~tlfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~~~-~g~~kG~afV~F~~~e~A~~Al~-l~g~~~~gr~i~V~~a 491 (675)
...++|||+|||+++|+++|++||..||.|+.|+|+++. +++++|||||+|.+.++|.+||. ||++.|.+++|+|.++
T Consensus 105 ~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~gr~i~V~~a 184 (346)
T TIGR01659 105 NSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVRNKRLKVSYA 184 (346)
T ss_pred CCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccCCceeeeecc
Confidence 457899999999999999999999999999999999997 89999999999999999999997 9999999999999987
Q ss_pred cccCCCCCCCCCCCCCCccCCCCCCCceEEEEecCCCCcCHHHHHHHHHhhhcccCcEEEEEecccCCCCCeeeEEEEEe
Q 045516 492 RERGAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFDSSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDF 571 (675)
Q Consensus 492 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lfV~nLp~~~te~~i~~~L~~~F~~~G~I~~v~i~~d~~tG~~rG~afV~F 571 (675)
..... ....++|||.|||..+++++ |+++|..||.|..|.|+++..+|.++|||||+|
T Consensus 185 ~p~~~------------------~~~~~~lfV~nLp~~vtee~----L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F 242 (346)
T TIGR01659 185 RPGGE------------------SIKDTNLYVTNLPRTITDDQ----LDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRF 242 (346)
T ss_pred ccccc------------------ccccceeEEeCCCCcccHHH----HHHHHHhcCCEEEEEEeecCCCCccceEEEEEE
Confidence 64321 11256899999999999998 778999999999999999999999999999999
Q ss_pred CCHHHHHHHHH-hCCceeCC--eeeEEeccccCCCCC
Q 045516 572 TDADSFNKALE-MSGTEIGG--YSLVVDEAKQRGDFG 605 (675)
Q Consensus 572 ~~~e~A~~Al~-lng~~~~G--r~l~V~~a~~r~~~~ 605 (675)
.+.++|.+||. ||+..|.+ +.|+|.++..+....
T Consensus 243 ~~~e~A~~Ai~~lng~~~~g~~~~l~V~~a~~~~~~~ 279 (346)
T TIGR01659 243 NKREEAQEAISALNNVIPEGGSQPLTVRLAEEHGKAK 279 (346)
T ss_pred CCHHHHHHHHHHhCCCccCCCceeEEEEECCcccccc
Confidence 99999999998 99999866 789999998765443
|
This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661). |
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4210 consensus Nuclear localization sequence binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >PF03546 Treacle: Treacher Collins syndrome protein Treacle; InterPro: IPR003993 Treacher Collins Syndrome (TCS) is an autosomal dominant disorder of craniofacial development, the features of which include conductive hearing loss and cleft palate [, ]; it is the most common of the human mandibulo-facial dysostosis disorders [] | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF03546 Treacle: Treacher Collins syndrome protein Treacle; InterPro: IPR003993 Treacher Collins Syndrome (TCS) is an autosomal dominant disorder of craniofacial development, the features of which include conductive hearing loss and cleft palate [, ]; it is the most common of the human mandibulo-facial dysostosis disorders [] | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >KOG0533 consensus RRM motif-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0226 consensus RNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0533 consensus RRM motif-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >KOG0226 consensus RNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes | Back alignment and domain information |
|---|
| >KOG4210 consensus Nuclear localization sequence binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1855 consensus Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation | Back alignment and domain information |
|---|
| >KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >KOG1855 consensus Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] | Back alignment and domain information |
|---|
| >PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function | Back alignment and domain information |
|---|
| >PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation | Back alignment and domain information |
|---|
| >PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif | Back alignment and domain information |
|---|
| >PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] | Back alignment and domain information |
|---|
| >KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif | Back alignment and domain information |
|---|
| >KOG1996 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1996 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] | Back alignment and domain information |
|---|
| >KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3262 consensus H/ACA small nucleolar RNP component GAR1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons | Back alignment and domain information |
|---|
| >KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2318 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) | Back alignment and domain information |
|---|
| >PF15023 DUF4523: Protein of unknown function (DUF4523) | Back alignment and domain information |
|---|
| >PRK06958 single-stranded DNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] | Back alignment and domain information |
|---|
| >KOG2295 consensus C2H2 Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing | Back alignment and domain information |
|---|
| >PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] | Back alignment and domain information |
|---|
| >PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) | Back alignment and domain information |
|---|
| >PF15023 DUF4523: Protein of unknown function (DUF4523) | Back alignment and domain information |
|---|
| >PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons | Back alignment and domain information |
|---|
| >PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells | Back alignment and domain information |
|---|
| >KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3262 consensus H/ACA small nucleolar RNP component GAR1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA00370 III attachment protein | Back alignment and domain information |
|---|
| >PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes | Back alignment and domain information |
|---|
| >PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] | Back alignment and domain information |
|---|
| >PF14111 DUF4283: Domain of unknown function (DUF4283) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 675 | ||||
| 2yh0_A | 198 | Solution Structure Of The Closed Conformation Of Hu | 2e-10 | ||
| 2dng_A | 103 | Solution Structure Of Rna Binding Domain In Eukaryo | 2e-10 | ||
| 3vaf_A | 174 | Structure Of U2af65 Variant With Bru3 Dna Length = | 5e-10 | ||
| 2g4b_A | 172 | Structure Of U2af65 Variant With Polyuridine Tract | 6e-10 | ||
| 2krr_A | 180 | Solution Structure Of The Rbd1,2 Domains From Human | 3e-09 | ||
| 1p1t_A | 104 | Nmr Structure Of The N-Terminal Rrm Domain Of Cleav | 2e-08 | ||
| 2dnz_A | 95 | Solution Structure Of The Second Rna Binding Domain | 2e-07 | ||
| 4ed5_A | 177 | Crystal Structure Of The Two N-Terminal Rrm Domains | 3e-07 | ||
| 2dgo_A | 115 | Solution Structure Of The Rna Binding Domain In Cyt | 3e-07 | ||
| 1fje_B | 175 | Solution Structure Of Nucleolin Rbd12 In Complex Wi | 3e-07 | ||
| 4egl_A | 177 | Crystal Structure Of Two Tandem Rna Recognition Mot | 3e-07 | ||
| 2dh7_A | 105 | Solution Structure Of The Second Rna Binding Domain | 5e-07 | ||
| 1up1_A | 182 | Up1, The Two Rna-Recognition Motif Domain Of Hnrnp | 6e-07 | ||
| 1pgz_A | 195 | Crystal Structure Of Up1 Complexed With D(Ttagggtta | 6e-07 | ||
| 2lyv_A | 197 | Solution Structure Of The Two Rrm Domains Of Hnrnp | 7e-07 | ||
| 1l3k_A | 196 | Up1, The Two Rna-Recognition Motif Domain Of Hnrnp | 7e-07 | ||
| 1ha1_A | 184 | Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 | 7e-07 | ||
| 2fc9_A | 101 | Solution Structure Of The Rrm_1 Domain Of Ncl Prote | 1e-06 | ||
| 2up1_A | 183 | Structure Of Up1-Telomeric Dna Complex Length = 183 | 1e-06 | ||
| 3hi9_A | 84 | The X-Ray Crystal Structure Of The First Rna Recogn | 5e-06 | ||
| 3md3_A | 166 | Crystal Structure Of The First Two Rrm Domains Of Y | 7e-06 | ||
| 1fxl_A | 167 | Crystal Structure Of Hud And Au-Rich Element Of The | 7e-06 | ||
| 2jrs_A | 108 | Solution Nmr Structure Of Caper Rrm2 Domain. Northe | 8e-06 | ||
| 2jwn_A | 124 | Solution Nmr Structure Of The Protease-Resistent Do | 1e-05 | ||
| 4f25_A | 115 | Crystal Structure Of The Second Rrm Domain Of Human | 1e-05 | ||
| 1wi8_A | 104 | Solution Structure Of The Rna Binding Domain Of Euk | 2e-05 | ||
| 2cq4_A | 114 | Solution Structure Of Rna Binding Domain In Rna Bin | 2e-05 | ||
| 2x1a_A | 97 | Structure Of Rna15 Rrm With Rna Bound (G) Length = | 2e-05 | ||
| 1x5t_A | 96 | Solution Structure Of The Second Rrm Domain In Spli | 3e-05 | ||
| 1fnx_H | 174 | Solution Structure Of The Huc Rbd1-Rbd2 Complexed W | 3e-05 | ||
| 4fxv_A | 99 | Crystal Structure Of An Elav-Like Protein 1 (Elavl1 | 6e-05 | ||
| 2x1f_A | 96 | Structure Of Rna15 Rrm With Bound Rna (Gu) Length = | 6e-05 | ||
| 2kxf_A | 199 | Solution Structure Of The First Two Rrm Domains Of | 7e-05 | ||
| 4f02_A | 213 | Crystal Structure Of The Pabp-Binding Site Of Eif4g | 8e-05 | ||
| 4f02_A | 213 | Crystal Structure Of The Pabp-Binding Site Of Eif4g | 2e-04 | ||
| 3sxl_A | 184 | Sex-Lethal Rna Recognition Domains 1 And 2 From Dro | 9e-05 | ||
| 1cvj_A | 190 | X-Ray Crystal Structure Of The Poly(A)-Binding Prot | 9e-05 | ||
| 1cvj_A | 190 | X-Ray Crystal Structure Of The Poly(A)-Binding Prot | 4e-04 | ||
| 1b7f_A | 168 | Sxl-Lethal ProteinRNA COMPLEX Length = 168 | 9e-05 | ||
| 2km8_B | 84 | Interdomain Rrm Packing Contributes To Rna Recognit | 1e-04 | ||
| 2qfj_A | 216 | Crystal Structure Of First Two Rrm Domains Of Fir B | 1e-04 | ||
| 1x5s_A | 102 | Solution Structure Of Rrm Domain In A18 Hnrnp Lengt | 1e-04 | ||
| 2hgn_A | 139 | Nmr Structure Of The Third Qrrm Domain Of Human Hnr | 2e-04 | ||
| 2j76_E | 100 | Solution Structure And Rna Interactions Of The Rna | 2e-04 | ||
| 1hd0_A | 75 | Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D | 2e-04 | ||
| 2j0s_D | 89 | The Crystal Structure Of The Exon Junction Complex | 2e-04 | ||
| 1p27_B | 106 | Crystal Structure Of The Human Y14MAGOH COMPLEX Len | 3e-04 | ||
| 2xb2_D | 90 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 3e-04 | ||
| 3md1_A | 83 | Crystal Structure Of The Second Rrm Domain Of Yeast | 4e-04 | ||
| 2hyi_B | 91 | Structure Of The Human Exon Junction Complex With A | 4e-04 | ||
| 3sde_A | 261 | Crystal Structure Of A Paraspeckle-Protein Heterodi | 4e-04 | ||
| 1d8z_A | 89 | Solution Structure Of The First Rna-Binding Domain | 4e-04 | ||
| 2xsf_A | 89 | Crystal Structure Of The Rrm Domain Of Mouse Delete | 4e-04 | ||
| 2cjk_A | 167 | Structure Of The Rna Binding Domain Of Hrp1 In Comp | 4e-04 | ||
| 2k8g_A | 95 | Solution Structure Of Rrm2 Domain Of Pabp1 Length = | 4e-04 | ||
| 2xs5_A | 87 | Crystal Structure Of The Rrm Domain Of Mouse Delete | 5e-04 | ||
| 2cph_A | 107 | Solution Structure Of The C-Terminal Rna Recognitio | 5e-04 | ||
| 1x5o_A | 114 | Solution Structure Of Rrm Domain In Rna Binding Mot | 6e-04 | ||
| 1h6k_Z | 98 | Nuclear Cap Binding Complex Length = 98 | 6e-04 | ||
| 3ex7_B | 126 | The Crystal Structure Of Ejc In Its Transition Stat | 6e-04 | ||
| 2xs2_A | 102 | Crystal Structure Of The Rrm Domain Of Mouse Delete | 6e-04 | ||
| 2dh9_A | 89 | Solution Structure Of The C-Terminal Rna Binding Do | 7e-04 | ||
| 2do0_A | 114 | Solution Structure Of The Rna Binding Domain Of Het | 8e-04 | ||
| 3b4d_A | 96 | Crystal Structure Of Human Pabpn1 Rrm Length = 96 | 9e-04 | ||
| 1fjc_A | 96 | Solution Structure Of Nucleolin Rbd2 Length = 96 | 9e-04 |
| >pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 | Back alignment and structure |
|
| >pdb|2DNG|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 4h Length = 103 | Back alignment and structure |
| >pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 | Back alignment and structure |
| >pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 | Back alignment and structure |
| >pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 | Back alignment and structure |
| >pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 | Back alignment and structure |
| >pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 | Back alignment and structure |
| >pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 | Back alignment and structure |
| >pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 | Back alignment and structure |
| >pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 | Back alignment and structure |
| >pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 | Back alignment and structure |
| >pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 | Back alignment and structure |
| >pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 | Back alignment and structure |
| >pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 | Back alignment and structure |
| >pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 | Back alignment and structure |
| >pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 | Back alignment and structure |
| >pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 | Back alignment and structure |
| >pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 | Back alignment and structure |
| >pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 | Back alignment and structure |
| >pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 | Back alignment and structure |
| >pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 | Back alignment and structure |
| >pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 | Back alignment and structure |
| >pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 | Back alignment and structure |
| >pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 | Back alignment and structure |
| >pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 | Back alignment and structure |
| >pdb|1WI8|A Chain A, Solution Structure Of The Rna Binding Domain Of Eukaryotic Initiation Factor 4b Length = 104 | Back alignment and structure |
| >pdb|2CQ4|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 23 Length = 114 | Back alignment and structure |
| >pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 | Back alignment and structure |
| >pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 | Back alignment and structure |
| >pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 | Back alignment and structure |
| >pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 | Back alignment and structure |
| >pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 | Back alignment and structure |
| >pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 | Back alignment and structure |
| >pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 | Back alignment and structure |
| >pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 | Back alignment and structure |
| >pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 | Back alignment and structure |
| >pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 | Back alignment and structure |
| >pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 | Back alignment and structure |
| >pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 | Back alignment and structure |
| >pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 | Back alignment and structure |
| >pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 | Back alignment and structure |
| >pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 | Back alignment and structure |
| >pdb|2HGN|A Chain A, Nmr Structure Of The Third Qrrm Domain Of Human Hnrnp F Length = 139 | Back alignment and structure |
| >pdb|2J76|E Chain E, Solution Structure And Rna Interactions Of The Rna Recognition Motif From Eukaryotic Translation Initiation Factor 4b Length = 100 | Back alignment and structure |
| >pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 | Back alignment and structure |
| >pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 | Back alignment and structure |
| >pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 | Back alignment and structure |
| >pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 | Back alignment and structure |
| >pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 | Back alignment and structure |
| >pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 | Back alignment and structure |
| >pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 | Back alignment and structure |
| >pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 | Back alignment and structure |
| >pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 | Back alignment and structure |
| >pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 | Back alignment and structure |
| >pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 | Back alignment and structure |
| >pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 | Back alignment and structure |
| >pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 | Back alignment and structure |
| >pdb|1X5O|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 1 Length = 114 | Back alignment and structure |
| >pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 | Back alignment and structure |
| >pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 | Back alignment and structure |
| >pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 | Back alignment and structure |
| >pdb|2DH9|A Chain A, Solution Structure Of The C-Terminal Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein M Length = 89 | Back alignment and structure |
| >pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 | Back alignment and structure |
| >pdb|3B4D|A Chain A, Crystal Structure Of Human Pabpn1 Rrm Length = 96 | Back alignment and structure |
| >pdb|1FJC|A Chain A, Solution Structure Of Nucleolin Rbd2 Length = 96 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 675 | |||
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 100.0 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 100.0 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 100.0 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.97 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.97 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.97 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.97 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.97 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.96 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.96 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.96 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.96 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.96 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.96 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.96 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.95 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.95 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.95 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.95 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.95 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 99.84 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 99.83 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 99.83 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 99.79 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 99.78 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 99.78 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 99.77 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 99.75 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 99.75 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 99.74 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 99.74 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 99.74 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 99.74 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 99.73 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 99.73 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.73 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 99.73 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.73 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 99.73 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 99.72 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 99.72 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 99.72 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 99.72 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 99.72 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 99.72 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 99.72 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 99.72 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 99.72 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 99.72 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 99.72 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 99.71 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 99.71 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 99.71 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 99.71 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 99.71 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 99.71 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 99.71 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 99.71 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 99.71 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 99.71 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 99.71 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 99.71 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 99.71 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 99.7 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 99.7 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 99.7 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 99.7 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.7 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 99.7 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 99.7 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 99.7 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 99.7 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 99.7 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 99.7 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 99.7 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 99.7 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 99.7 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 99.69 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 99.69 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 99.69 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 99.69 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 99.69 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 99.69 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 99.69 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 99.69 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 99.69 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.69 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 99.69 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 99.69 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 99.69 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 99.69 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 99.69 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 99.68 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 99.68 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 99.68 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 99.68 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 99.68 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 99.68 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 99.68 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 99.68 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 99.68 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 99.68 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 99.68 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 99.68 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 99.68 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 99.68 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 99.68 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 99.67 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.67 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.67 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 99.67 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 99.67 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 99.67 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 99.67 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 99.67 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 99.67 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 99.67 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 99.67 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 99.67 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 99.66 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 99.66 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 99.66 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 99.66 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 99.66 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.66 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 99.66 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 99.66 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 99.66 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 99.65 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 99.65 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 99.65 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 99.65 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 99.65 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 99.65 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 99.65 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 99.65 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 99.65 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 99.65 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.65 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 99.65 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.65 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 99.65 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 99.65 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 99.64 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 99.64 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 99.64 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 99.64 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 99.64 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 99.64 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 99.64 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 99.64 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 99.64 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 99.64 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 99.63 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 99.63 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 99.63 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 99.63 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 99.63 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 99.63 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 99.63 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 99.63 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 99.63 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 99.63 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 99.63 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 99.63 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 99.63 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 99.63 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 99.62 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 99.62 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 99.62 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 99.62 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 99.62 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.62 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 99.62 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 99.62 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 99.62 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 99.62 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 99.62 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 99.62 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 99.62 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 99.62 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.62 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 99.62 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 99.62 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 99.61 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.61 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 99.61 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.61 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 99.61 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 99.61 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 99.61 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 99.61 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 99.61 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 99.61 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 99.6 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 99.6 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 99.6 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 99.6 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 99.6 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 99.6 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 99.6 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 99.59 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 99.59 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 99.59 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 99.59 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 99.59 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 99.59 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 99.59 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 99.59 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 99.58 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 99.58 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 99.37 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 99.58 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 99.58 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 99.58 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 99.58 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 99.58 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 99.58 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 99.58 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 99.58 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 99.58 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 99.58 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 99.57 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.57 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 99.57 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 99.57 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 99.57 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 99.57 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 99.57 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 99.57 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 99.35 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 99.57 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 99.56 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 99.56 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 99.56 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 99.56 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.56 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 99.56 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 99.56 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 99.56 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 99.55 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 99.55 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 99.55 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.55 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 99.55 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 99.55 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 99.55 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 99.55 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 99.55 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 99.55 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 99.55 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.54 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 99.54 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 99.54 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.54 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 99.54 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 99.54 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 99.54 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 99.54 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 99.54 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.54 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 99.54 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 99.54 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 99.54 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 99.53 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 99.53 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 99.53 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 99.53 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.53 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 99.52 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 99.52 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 99.52 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 99.52 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 99.52 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 99.52 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 99.52 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.52 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.52 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 99.51 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 99.51 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.51 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 99.51 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 99.51 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.51 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 99.5 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.5 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 99.5 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 99.5 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 99.5 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.5 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 99.5 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 99.5 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 99.5 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 99.49 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 99.49 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 99.49 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 99.49 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 99.49 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 99.49 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 99.49 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 99.49 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 99.48 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 99.48 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 99.48 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 99.48 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 99.48 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 99.48 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.48 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 99.48 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 99.47 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 99.47 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 99.46 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.46 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 99.46 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 99.46 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 99.46 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 99.46 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 99.46 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 99.45 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.45 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 99.45 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.45 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 99.45 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 99.44 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 99.43 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 99.43 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.43 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.43 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 99.42 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.42 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.42 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 99.42 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 99.42 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 99.42 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 99.42 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 99.41 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 99.41 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 99.41 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 99.4 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.4 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.39 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 99.38 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 99.38 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 99.36 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 99.36 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 99.36 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.35 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 99.35 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 99.34 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 99.33 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 99.33 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 99.32 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 99.32 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.32 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 99.32 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 99.31 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.31 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 99.31 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.3 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 99.3 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 99.3 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 99.3 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 99.29 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 99.27 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 99.25 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 99.22 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 99.2 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 99.19 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 99.16 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 99.14 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 99.05 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 99.04 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 98.91 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 98.89 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 98.84 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 98.81 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 98.72 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 98.61 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 98.58 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 98.56 | |
| 2l9w_A | 117 | U4/U6 snRNA-associated-splicing factor PRP24; RRM, | 98.19 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 98.12 | |
| 2l9w_A | 117 | U4/U6 snRNA-associated-splicing factor PRP24; RRM, | 97.89 | |
| 1wey_A | 104 | Calcipressin 1; structural genomics, RRM domain, r | 97.49 | |
| 1wey_A | 104 | Calcipressin 1; structural genomics, RRM domain, r | 97.38 | |
| 1wwh_A | 119 | Nucleoporin 35, nucleoporin; structural genomics, | 97.28 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 97.2 | |
| 1wwh_A | 119 | Nucleoporin 35, nucleoporin; structural genomics, | 97.06 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 96.88 | |
| 1whv_A | 100 | Poly(A)-specific ribonuclease; RNA recognition mot | 96.51 | |
| 3p3d_A | 132 | Nucleoporin 53; structural genomics, PSI-2, protei | 96.44 | |
| 3ctr_A | 101 | Poly(A)-specific ribonuclease PARN; protein-RNA-co | 96.14 | |
| 3p3d_A | 132 | Nucleoporin 53; structural genomics, PSI-2, protei | 95.88 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 95.62 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 95.54 | |
| 3pq1_A | 464 | Poly(A) RNA polymerase; nucleotidyl transferase, R | 95.25 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 92.87 | |
| 1whv_A | 100 | Poly(A)-specific ribonuclease; RNA recognition mot | 92.67 | |
| 3ctr_A | 101 | Poly(A)-specific ribonuclease PARN; protein-RNA-co | 92.47 | |
| 3pq1_A | 464 | Poly(A) RNA polymerase; nucleotidyl transferase, R | 86.32 | |
| 2pk2_A | 358 | Cyclin-T1, protein TAT; TAR, twinning, transcripti | 80.35 |
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5e-33 Score=272.72 Aligned_cols=178 Identities=24% Similarity=0.425 Sum_probs=152.5
Q ss_pred CCCCceEEEcCCCCCCCHHHHHHHhhhCCCeEEEEEeeCC-CCCcccEEEEEecCHHHHHHHHHhCCcccCCeeEEEEec
Q 045516 413 SGGSKTLFVGNLPFSVEQADVQNFFSEVAEVVDVRLSSDA-DGRFKGYGHVEFASVEDAHKAIELNGQMLGNRAIRLDFA 491 (675)
Q Consensus 413 ~~~~~tlfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~~~-~g~~kG~afV~F~~~e~A~~Al~l~g~~~~gr~i~V~~a 491 (675)
....++|||+|||+++++++|++||+.||.|..|+|+++. +|+++|||||+|.+.++|.+||.+++..|.|+.|.|.++
T Consensus 10 ~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~g~~l~v~~~ 89 (196)
T 1l3k_A 10 PEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRA 89 (196)
T ss_dssp CGGGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEEC
T ss_pred CCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcCCCCCccceEEEEeCCHHHHHHHHhcCCCEECCEEeeeecc
Confidence 4567999999999999999999999999999999999997 799999999999999999999999999999999999998
Q ss_pred cccCCCCCCCCCCCCCCccCCCCCCCceEEEEecCCCCcCHHHHHHHHHhhhcccCcEEEEEecccCCCCCeeeEEEEEe
Q 045516 492 RERGAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFDSSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDF 571 (675)
Q Consensus 492 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lfV~nLp~~~te~~i~~~L~~~F~~~G~I~~v~i~~d~~tG~~rG~afV~F 571 (675)
........ .......++|||+|||+.+++++ |+++|..||.|..|+|+++..+|.++|||||+|
T Consensus 90 ~~~~~~~~------------~~~~~~~~~l~V~nLp~~~t~~~----l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~F 153 (196)
T 1l3k_A 90 VSREDSQR------------PGAHLTVKKIFVGGIKEDTEEHH----LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTF 153 (196)
T ss_dssp CC-----------------------CCSEEEEECCTTTCCHHH----HHHHHTTTSCEEEEEEEECTTTCCEEEEEEEEE
T ss_pred cCcccccc------------cccCCCcceEEEeCCCCCCCHHH----HHHHHhcCCCeEEEEEeecCCCCCccceEEEEE
Confidence 65432111 11123468999999999999998 778999999999999999999999999999999
Q ss_pred CCHHHHHHHHHhCCceeCCeeeEEeccccCCCCCC
Q 045516 572 TDADSFNKALEMSGTEIGGYSLVVDEAKQRGDFGS 606 (675)
Q Consensus 572 ~~~e~A~~Al~lng~~~~Gr~l~V~~a~~r~~~~~ 606 (675)
.+.++|.+||.+++..|+|+.|.|.++.++.....
T Consensus 154 ~~~~~A~~A~~~~~~~~~G~~i~v~~a~~k~~~~~ 188 (196)
T 1l3k_A 154 DDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMAS 188 (196)
T ss_dssp SSHHHHHHHHHCSCCEETTEECEEEECC-------
T ss_pred CCHHHHHHHHHhCCcEECCEEEEEEecCChhHhcc
Confidence 99999999999889999999999999998877643
|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* | Back alignment and structure |
|---|
| >3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} | Back alignment and structure |
|---|
| >3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* | Back alignment and structure |
|---|
| >3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 675 | ||||
| d1u1qa_ | 183 | d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 | 6e-24 | |
| d2cpha1 | 94 | d.58.7.1 (A:454-547) Probable RNA-binding protein | 5e-17 | |
| d2cpha1 | 94 | d.58.7.1 (A:454-547) Probable RNA-binding protein | 4e-10 | |
| d2cq4a1 | 101 | d.58.7.1 (A:132-232) RNA binding protein 23 {Human | 6e-17 | |
| d1no8a_ | 78 | d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu | 1e-16 | |
| d1h2vz_ | 93 | d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro | 1e-16 | |
| d1h2vz_ | 93 | d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro | 6e-08 | |
| d1cvja1 | 80 | d.58.7.1 (A:11-90) Poly(A)-binding protein {Human | 2e-16 | |
| d1cvja1 | 80 | d.58.7.1 (A:11-90) Poly(A)-binding protein {Human | 2e-11 | |
| d1x4ga1 | 96 | d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s | 3e-16 | |
| d1x4ga1 | 96 | d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s | 9e-08 | |
| d1fjca_ | 96 | d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice | 1e-15 | |
| d1fjca_ | 96 | d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice | 1e-07 | |
| d1b7fa1 | 82 | d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil | 1e-15 | |
| d1b7fa1 | 82 | d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil | 5e-10 | |
| d2cpfa1 | 85 | d.58.7.1 (A:362-446) Probable RNA-binding protein | 2e-15 | |
| d2cpfa1 | 85 | d.58.7.1 (A:362-446) Probable RNA-binding protein | 2e-08 | |
| d1uawa_ | 77 | d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax | 2e-15 | |
| d1uawa_ | 77 | d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax | 4e-11 | |
| d2f9da1 | 114 | d.58.7.1 (A:12-125) Pre-mRNA branch site protein p | 1e-14 | |
| d2f9da1 | 114 | d.58.7.1 (A:12-125) Pre-mRNA branch site protein p | 8e-06 | |
| d1cvja2 | 89 | d.58.7.1 (A:91-179) Poly(A)-binding protein {Human | 2e-14 | |
| d1cvja2 | 89 | d.58.7.1 (A:91-179) Poly(A)-binding protein {Human | 5e-08 | |
| d1u2fa_ | 90 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 2e-14 | |
| d1u2fa_ | 90 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 2e-09 | |
| d2cqba1 | 89 | d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer | 2e-14 | |
| d2cqba1 | 89 | d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer | 2e-08 | |
| d1fxla1 | 82 | d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom | 3e-14 | |
| d1fxla1 | 82 | d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom | 2e-09 | |
| d2ghpa3 | 86 | d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici | 4e-14 | |
| d2ghpa3 | 86 | d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici | 4e-07 | |
| d1nu4a_ | 91 | d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo | 5e-14 | |
| d1nu4a_ | 91 | d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo | 8e-09 | |
| d1rk8a_ | 88 | d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr | 5e-14 | |
| d1rk8a_ | 88 | d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr | 3e-08 | |
| d1zh5a2 | 85 | d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo | 6e-14 | |
| d1b7fa2 | 85 | d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil | 1e-13 | |
| d1b7fa2 | 85 | d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil | 7e-08 | |
| d1l3ka1 | 84 | d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN | 1e-13 | |
| d1l3ka1 | 84 | d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN | 2e-08 | |
| d2u2fa_ | 85 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 1e-13 | |
| d2u2fa_ | 85 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 3e-09 | |
| d2cq3a1 | 93 | d.58.7.1 (A:110-202) RNA-binding protein 9 {Human | 2e-13 | |
| d2msta_ | 75 | d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 | 2e-13 | |
| d2msta_ | 75 | d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 | 4e-09 | |
| d1hd0a_ | 75 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 2e-13 | |
| d1hd0a_ | 75 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 2e-08 | |
| d2cpja1 | 86 | d.58.7.1 (A:65-150) Non-POU domain-containing octa | 2e-13 | |
| d2cpja1 | 86 | d.58.7.1 (A:65-150) Non-POU domain-containing octa | 4e-05 | |
| d1x4ba1 | 103 | d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle | 2e-13 | |
| d1x4ba1 | 103 | d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle | 6e-10 | |
| d2cqpa1 | 86 | d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous | 3e-13 | |
| d2cqpa1 | 86 | d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous | 1e-06 | |
| d1x5ta1 | 83 | d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu | 3e-13 | |
| d2cqga1 | 90 | d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD | 3e-13 | |
| d2cqga1 | 90 | d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD | 8e-06 | |
| d2cqca1 | 83 | d.58.7.1 (A:109-191) Arginine/serine-rich splicing | 3e-13 | |
| d2cqca1 | 83 | d.58.7.1 (A:109-191) Arginine/serine-rich splicing | 4e-07 | |
| d2cq0a1 | 90 | d.58.7.1 (A:231-320) Eukaryotic translation initia | 4e-13 | |
| d2cq0a1 | 90 | d.58.7.1 (A:231-320) Eukaryotic translation initia | 7e-08 | |
| d1fxla2 | 85 | d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho | 5e-13 | |
| d1fxla2 | 85 | d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho | 6e-07 | |
| d1fjeb1 | 91 | d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc | 5e-13 | |
| d1fjeb1 | 91 | d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc | 2e-06 | |
| d1x5ua1 | 93 | d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu | 5e-13 | |
| d1x5ua1 | 93 | d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu | 1e-08 | |
| d2bz2a1 | 79 | d.58.7.1 (A:35-113) Negative elongation factor E, | 7e-13 | |
| d2bz2a1 | 79 | d.58.7.1 (A:35-113) Negative elongation factor E, | 5e-07 | |
| d2cpda1 | 86 | d.58.7.1 (A:223-308) APOBEC1 stimulating protein { | 8e-13 | |
| d2cpda1 | 86 | d.58.7.1 (A:223-308) APOBEC1 stimulating protein { | 1e-04 | |
| d2cqia1 | 90 | d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa | 1e-12 | |
| d2cqia1 | 90 | d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa | 5e-06 | |
| d1x0fa1 | 75 | d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 | 1e-12 | |
| d1x0fa1 | 75 | d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 | 1e-08 | |
| d1wf2a_ | 98 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 2e-12 | |
| d1wf2a_ | 98 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 6e-06 | |
| d2ghpa1 | 81 | d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici | 2e-12 | |
| d2ghpa1 | 81 | d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici | 2e-07 | |
| d1x4aa1 | 95 | d.58.7.1 (A:9-103) Splicing factor, arginine/serin | 2e-12 | |
| d1x4aa1 | 95 | d.58.7.1 (A:9-103) Splicing factor, arginine/serin | 8e-08 | |
| d1wf0a_ | 88 | d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { | 2e-12 | |
| d1l3ka2 | 79 | d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 | 3e-12 | |
| d1l3ka2 | 79 | d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 | 3e-08 | |
| d2cqha1 | 80 | d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is | 3e-12 | |
| d1wi8a_ | 104 | d.58.7.1 (A:) Eukaryotic translation initiation fa | 4e-12 | |
| d1wi8a_ | 104 | d.58.7.1 (A:) Eukaryotic translation initiation fa | 8e-08 | |
| d2adca1 | 109 | d.58.7.1 (A:335-443) Polypyrimidine tract-binding | 7e-12 | |
| d2adca2 | 88 | d.58.7.1 (A:444-531) Polypyrimidine tract-binding | 9e-12 | |
| d2disa1 | 96 | d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { | 1e-11 | |
| d2disa1 | 96 | d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { | 3e-06 | |
| d1x5sa1 | 90 | d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote | 1e-11 | |
| d2cqda1 | 103 | d.58.7.1 (A:1-103) RNA-binding region containing p | 1e-11 | |
| d2cqda1 | 103 | d.58.7.1 (A:1-103) RNA-binding region containing p | 1e-05 | |
| d1whwa_ | 99 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 2e-11 | |
| d1whwa_ | 99 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 1e-06 | |
| d1u6fa1 | 139 | d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa | 2e-11 | |
| d1u6fa1 | 139 | d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa | 1e-06 | |
| d1p1ta_ | 104 | d.58.7.1 (A:) Cleavage stimulation factor, 64 kda | 4e-11 | |
| d1p1ta_ | 104 | d.58.7.1 (A:) Cleavage stimulation factor, 64 kda | 2e-05 | |
| d1weza_ | 102 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 5e-11 | |
| d1weza_ | 102 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 5e-07 | |
| d2cpya1 | 103 | d.58.7.1 (A:536-638) RNA-binding protein 12 {Human | 6e-11 | |
| d2cpya1 | 103 | d.58.7.1 (A:536-638) RNA-binding protein 12 {Human | 5e-09 | |
| d2cpza1 | 102 | d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin | 6e-11 | |
| d2cpza1 | 102 | d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin | 3e-06 | |
| d2cpxa1 | 102 | d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 | 7e-11 | |
| d1x4ha1 | 98 | d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( | 9e-11 | |
| d2ghpa2 | 75 | d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin | 9e-11 | |
| d2ghpa2 | 75 | d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin | 4e-09 | |
| d1weya_ | 104 | d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) | 1e-10 | |
| d2cpea1 | 101 | d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma | 2e-10 | |
| d2adba1 | 108 | d.58.7.1 (A:177-284) Polypyrimidine tract-binding | 2e-10 | |
| d1x4ea1 | 72 | d.58.7.1 (A:8-79) RNA-binding motif, single-strand | 3e-10 | |
| d1wg1a_ | 88 | d.58.7.1 (A:) Probable RNA-binding protein KIAA157 | 4e-10 | |
| d1wwha1 | 81 | d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu | 6e-10 | |
| d1wwha1 | 81 | d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu | 2e-07 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | d.58.7.3 (A:) 6e-10 | ||
| d2b0ga1 | 83 | d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph | 2e-09 | |
| d2cq1a1 | 88 | d.58.7.1 (A:51-138) Polypyrimidine tract-binding p | 3e-09 | |
| d1whya_ | 97 | d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb | 3e-09 | |
| d2dita1 | 99 | d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma | 3e-09 | |
| d2dita1 | 99 | d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma | 2e-04 | |
| d1wexa_ | 104 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 4e-09 | |
| d1x5oa1 | 101 | d.58.7.1 (A:8-108) RNA-binding motif, single-stran | 5e-09 | |
| d3begb1 | 87 | d.58.7.1 (B:121-207) Splicing factor, arginine/ser | 5e-09 | |
| d1o0pa_ | 104 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 5e-09 | |
| d1wela1 | 112 | d.58.7.1 (A:412-523) RNA-binding protein 12 {Human | 9e-09 | |
| d1wela1 | 112 | d.58.7.1 (A:412-523) RNA-binding protein 12 {Human | 0.004 | |
| d1wg4a_ | 98 | d.58.7.1 (A:) Splicing factor, arginine/serine-ric | 2e-08 | |
| d2cq2a1 | 101 | d.58.7.1 (A:25-125) Alkylation repair AlkB homolog | 1e-07 | |
| d2cpia1 | 89 | d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C | 2e-07 | |
| d1wg5a_ | 104 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 2e-07 | |
| d1wg5a_ | 104 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 1e-04 | |
| d1wi6a1 | 75 | d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding | 2e-06 | |
| d1whxa_ | 111 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 6e-05 | |
| d1owxa_ | 113 | d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien | 1e-04 |
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1) species: Human (Homo sapiens) [TaxId: 9606]
Score = 97.4 bits (241), Expect = 6e-24
Identities = 40/189 (21%), Positives = 74/189 (39%), Gaps = 17/189 (8%)
Query: 416 SKTLFVGNLPFSVEQADVQNFFSEVAEVVDVRLSSDAD-GRFKGYGHVEFASVEDAHKAI 474
+ LF+G L F +++ F + + D + D + R +G+G V +A+VE+ A+
Sbjct: 6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAM 65
Query: 475 ELNGQMLGNRAIRLDFARERGAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFDSSVGEDQ 534
+ R + A R IF+ G E
Sbjct: 66 NARPHKVDGRVVEPKRAVSREDSQRPGAHLTV------------KKIFVGGIKEDTEEHH 113
Query: 535 VRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNKALEMSGTEIGGYSLV 594
L ++F G+I I + D +G +G A++ F D DS +K + + G++
Sbjct: 114 ----LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCE 169
Query: 595 VDEAKQRGD 603
V +A + +
Sbjct: 170 VRKALSKQE 178
|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 675 | |||
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.97 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 99.79 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.78 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 99.78 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.78 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.78 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 99.77 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.77 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 99.77 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 99.77 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.77 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.77 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 99.76 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 99.76 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.76 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.76 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.76 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 99.76 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 99.76 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.76 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 99.76 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 99.76 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.75 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 99.75 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.75 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.75 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.75 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.75 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 99.74 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.74 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 99.74 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.74 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 99.74 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 99.74 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 99.72 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.72 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 99.72 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.72 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.72 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.71 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 99.71 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 99.71 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 99.7 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.7 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 99.7 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.7 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.7 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 99.69 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 99.69 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 99.69 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.69 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.69 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.68 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.68 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 99.68 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 99.68 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 99.67 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 99.67 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 99.67 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 99.67 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.67 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.66 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 99.66 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.66 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.66 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.66 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 99.66 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.66 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.66 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 99.66 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 99.65 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.65 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 99.65 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 99.65 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 99.65 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.65 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 99.64 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.64 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 99.64 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 99.64 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 99.64 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 99.64 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 99.64 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 99.64 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.63 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.63 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 99.63 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.63 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 99.63 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 99.63 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.63 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 99.63 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.63 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.62 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 99.62 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.62 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 99.62 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.62 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 99.61 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.61 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 99.61 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 99.61 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 99.61 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.61 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 99.6 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 99.6 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 99.6 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.6 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 99.59 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.59 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 99.59 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 99.59 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 99.58 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.58 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.58 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 99.58 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.57 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 99.57 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 99.57 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.56 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 99.55 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.55 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.55 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.55 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.55 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 99.55 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.55 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.54 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.53 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.53 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.52 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 99.52 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.51 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 99.51 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 99.5 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 99.5 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.5 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 99.49 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 99.49 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.49 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 99.48 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 99.47 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 99.47 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.47 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 99.47 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 99.47 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 99.47 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 99.47 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 99.47 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 99.46 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 99.46 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 99.46 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 99.45 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.44 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 99.4 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 99.39 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 99.37 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 99.36 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 99.36 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.34 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 99.34 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.33 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 99.33 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.32 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 99.3 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.29 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 99.22 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.18 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.16 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.1 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 99.08 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 99.06 | |
| d1ufwa_ | 95 | Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] | 97.8 | |
| d2dgxa1 | 73 | Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 | 97.57 | |
| d1ufwa_ | 95 | Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] | 97.44 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 97.11 | |
| d2dgxa1 | 73 | Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 | 96.53 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 96.04 | |
| d1whva_ | 100 | Poly(A)-specific ribonuclease PARN {Mouse (Mus mus | 90.46 |
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=7.5e-30 Score=245.89 Aligned_cols=171 Identities=24% Similarity=0.432 Sum_probs=152.3
Q ss_pred CceEEEcCCCCCCCHHHHHHHhhhCCCeEEEEEeeCC-CCCcccEEEEEecCHHHHHHHHHhCCcccCCeeEEEEecccc
Q 045516 416 SKTLFVGNLPFSVEQADVQNFFSEVAEVVDVRLSSDA-DGRFKGYGHVEFASVEDAHKAIELNGQMLGNRAIRLDFARER 494 (675)
Q Consensus 416 ~~tlfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~~~-~g~~kG~afV~F~~~e~A~~Al~l~g~~~~gr~i~V~~a~~~ 494 (675)
.|+|||+|||+.+|+++|+++|++||.|..|.|+++. ++.++|||||+|.+.+.|.+|+.+++..++++.|.+......
T Consensus 6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~~~~ 85 (183)
T d1u1qa_ 6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSR 85 (183)
T ss_dssp HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEECCCT
T ss_pred CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhhhhc
Confidence 4899999999999999999999999999999999987 899999999999999999999998888899999888776543
Q ss_pred CCCCCCCCCCCCCCccCCCCCCCceEEEEecCCCCcCHHHHHHHHHhhhcccCcEEEEEecccCCCCCeeeEEEEEeCCH
Q 045516 495 GAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFDSSVGEDQVRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDA 574 (675)
Q Consensus 495 ~~~~~~~~~~~~~~~~~~~~~~~~~~lfV~nLp~~~te~~i~~~L~~~F~~~G~I~~v~i~~d~~tG~~rG~afV~F~~~ 574 (675)
..... .......++|||+|||+.+++++ |+++|..||.|..|.|+.+..+|.++|||||+|.+.
T Consensus 86 ~~~~~------------~~~~~~~~~i~V~~lp~~~te~~----L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~ 149 (183)
T d1u1qa_ 86 EDSQR------------PGAHLTVKKIFVGGIKEDTEEHH----LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDH 149 (183)
T ss_dssp TGGGS------------TTTTCCCSEEEEECCCTTCCHHH----HHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCH
T ss_pred ccccc------------cccccccceeEEccCCCcCCHHH----HhhhhccCCceeeeeeecccccCccceeEEEEECCH
Confidence 32111 11233468999999999999998 778999999999999999999999999999999999
Q ss_pred HHHHHHHHhCCceeCCeeeEEeccccCC
Q 045516 575 DSFNKALEMSGTEIGGYSLVVDEAKQRG 602 (675)
Q Consensus 575 e~A~~Al~lng~~~~Gr~l~V~~a~~r~ 602 (675)
+.|.+||.++++.|+|+.|+|.++.++.
T Consensus 150 e~A~~Al~~~~~~~~G~~i~V~~A~~k~ 177 (183)
T d1u1qa_ 150 DSVDKIVIQKYHTVNGHNCEVRKALSKQ 177 (183)
T ss_dssp HHHHHHHTSSCEEETTEEEEEEECCCHH
T ss_pred HHHHHHHHhCCCeECCEEEEEEecCCcc
Confidence 9999999999999999999999997754
|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|