Citrus Sinensis ID: 045532
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| 255578609 | 195 | conserved hypothetical protein [Ricinus | 0.780 | 0.692 | 0.695 | 8e-46 | |
| 147856870 | 281 | hypothetical protein VITISV_012166 [Viti | 0.572 | 0.352 | 0.872 | 1e-42 | |
| 225440755 | 120 | PREDICTED: uncharacterized protein LOC10 | 0.583 | 0.841 | 0.875 | 3e-42 | |
| 224140053 | 115 | predicted protein [Populus trichocarpa] | 0.658 | 0.991 | 0.784 | 2e-41 | |
| 224091919 | 104 | predicted protein [Populus trichocarpa] | 0.578 | 0.961 | 0.851 | 5e-41 | |
| 356572600 | 109 | PREDICTED: uncharacterized protein LOC10 | 0.589 | 0.935 | 0.836 | 9e-40 | |
| 356505406 | 109 | PREDICTED: uncharacterized protein LOC10 | 0.589 | 0.935 | 0.826 | 3e-39 | |
| 449518366 | 140 | PREDICTED: uncharacterized protein LOC10 | 0.647 | 0.8 | 0.691 | 6e-38 | |
| 449437444 | 120 | PREDICTED: uncharacterized protein LOC10 | 0.658 | 0.95 | 0.722 | 2e-37 | |
| 449451175 | 121 | PREDICTED: uncharacterized protein LOC10 | 0.589 | 0.842 | 0.736 | 6e-37 |
| >gi|255578609|ref|XP_002530166.1| conserved hypothetical protein [Ricinus communis] gi|223530327|gb|EEF32221.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 188 bits (477), Expect = 8e-46, Method: Compositional matrix adjust.
Identities = 103/148 (69%), Positives = 114/148 (77%), Gaps = 13/148 (8%)
Query: 29 PFPHPRLAKALFSFYLKAGGGIYRCVHTAK--MSRRNGNVPKLDLKLNLSPPRGNPHMES 86
PFP P + + G IY +T K MSRRNGN PKLDLKLNLSPPR +P +ES
Sbjct: 58 PFPLPLGWQKFLNL---QTGEIYYTKNTRKKTMSRRNGNGPKLDLKLNLSPPRADPRVES 114
Query: 87 PSQSATVSPTSPPSSCVSSE-NQEDMLQYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCP 145
P++SATVSPTSPPSSCVSSE NQ+D L+YSNSPEATSMVLVGCPRCLMYVMLSEDDPKCP
Sbjct: 115 PNRSATVSPTSPPSSCVSSELNQDDTLRYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCP 174
Query: 146 KCKSTVLLDFLHDKNNNSNNNTRETRRS 173
KCKSTVLLDFLH+ NT +TR S
Sbjct: 175 KCKSTVLLDFLHE-------NTVQTRNS 195
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147856870|emb|CAN79170.1| hypothetical protein VITISV_012166 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225440755|ref|XP_002281204.1| PREDICTED: uncharacterized protein LOC100266492 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224140053|ref|XP_002323401.1| predicted protein [Populus trichocarpa] gi|222868031|gb|EEF05162.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224091919|ref|XP_002309400.1| predicted protein [Populus trichocarpa] gi|222855376|gb|EEE92923.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356572600|ref|XP_003554456.1| PREDICTED: uncharacterized protein LOC100805043 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505406|ref|XP_003521482.1| PREDICTED: uncharacterized protein LOC100788969 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449518366|ref|XP_004166213.1| PREDICTED: uncharacterized protein LOC101226911 isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449437444|ref|XP_004136502.1| PREDICTED: uncharacterized protein LOC101204832 [Cucumis sativus] gi|449532679|ref|XP_004173308.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226713 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449451175|ref|XP_004143337.1| PREDICTED: uncharacterized protein LOC101217127 isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| TAIR|locus:2164235 | 122 | AT5G06270 "AT5G06270" [Arabido | 0.647 | 0.918 | 0.512 | 1.6e-24 | |
| TAIR|locus:2098328 | 117 | AT3G11600 "AT3G11600" [Arabido | 0.624 | 0.923 | 0.508 | 1.6e-22 | |
| TAIR|locus:2176327 | 93 | AT5G22270 "AT5G22270" [Arabido | 0.219 | 0.408 | 0.666 | 1.6e-13 | |
| TAIR|locus:4515103251 | 99 | AT3G52561 "AT3G52561" [Arabido | 0.277 | 0.484 | 0.416 | 1.3e-06 | |
| TAIR|locus:2032900 | 259 | AT1G16500 "AT1G16500" [Arabido | 0.277 | 0.185 | 0.431 | 1.1e-05 |
| TAIR|locus:2164235 AT5G06270 "AT5G06270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
Identities = 64/125 (51%), Positives = 75/125 (60%)
Query: 59 MSRRNGNVPKLDLKLNLSPPRGNPH--MEXXXXXXXXXXXXXXXXXXXXE-NQED-MLQY 114
MSRR+ PKL+LKLNLSPP + + E NQ++ ++Y
Sbjct: 1 MSRRS---PKLELKLNLSPPTSSQRRMVRSPSRSATTSPTSPPSSCVSSEMNQDEPSVRY 57
Query: 115 SNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDKXX------XXXXXTR 168
S SPE TSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLH+ R
Sbjct: 58 STSPETTSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHENATNANANAAAASSGR 117
Query: 169 ETRRS 173
+TRR+
Sbjct: 118 KTRRN 122
|
|
| TAIR|locus:2098328 AT3G11600 "AT3G11600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176327 AT5G22270 "AT5G22270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515103251 AT3G52561 "AT3G52561" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032900 AT1G16500 "AT1G16500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00021534001 | SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (261 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| PF00397 | 31 | WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp | 96.83 | |
| smart00456 | 32 | WW Domain with 2 conserved Trp (W) residues. Also | 95.95 | |
| cd00201 | 31 | WW Two conserved tryptophans domain; also known as | 95.06 | |
| PRK08351 | 61 | DNA-directed RNA polymerase subunit E''; Validated | 87.86 | |
| PRK06393 | 64 | rpoE DNA-directed RNA polymerase subunit E''; Vali | 81.08 |
| >PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet | Back alignment and domain information |
|---|
Probab=96.83 E-value=0.0008 Score=40.71 Aligned_cols=29 Identities=14% Similarity=0.136 Sum_probs=23.4
Q ss_pred CCcchhccceeeeeccccE-EEeeccCcccCCC
Q 045532 32 HPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRN 63 (173)
Q Consensus 32 lP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~ 63 (173)
||.+|+ .+.|-.+|++ |+|..|.+.+|..
T Consensus 1 LP~gW~---~~~~~~~g~~YY~N~~t~~s~W~~ 30 (31)
T PF00397_consen 1 LPPGWE---EYFDPDSGRPYYYNHETGESQWER 30 (31)
T ss_dssp SSTTEE---EEEETTTSEEEEEETTTTEEESSS
T ss_pred CCcCCE---EEEcCCCCCEEEEeCCCCCEEeCC
Confidence 789996 8888668999 7799998766643
|
This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A .... |
| >smart00456 WW Domain with 2 conserved Trp (W) residues | Back alignment and domain information |
|---|
| >cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs | Back alignment and domain information |
|---|
| >PRK08351 DNA-directed RNA polymerase subunit E''; Validated | Back alignment and domain information |
|---|
| >PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| 1wr7_A | 41 | NEDD4-2; all-beta, ligase; NMR {Mus musculus} | 97.59 | |
| 2law_A | 38 | Yorkie homolog; YAP, SMAD1, CDK, signal transducti | 97.54 | |
| 2djy_A | 42 | SMAD ubiquitination regulatory factor 2; beta shee | 97.45 | |
| 1i5h_W | 50 | Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, | 97.44 | |
| 1wr3_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 97.42 | |
| 1wr4_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 97.41 | |
| 1e0m_A | 37 | Wwprototype; SH3 prototype, protein design, de nov | 97.39 | |
| 2dmv_A | 43 | Itchy homolog E3 ubiquitin protein ligase; WW doma | 97.34 | |
| 2ysg_A | 40 | Syntaxin-binding protein 4; synip, STXBP4, WW doma | 97.32 | |
| 2kyk_A | 39 | E3 ubiquitin-protein ligase itchy homolog; LMP2A, | 97.32 | |
| 2zaj_A | 49 | Membrane-associated guanylate kinase, WW and PDZ d | 97.3 | |
| 2ysf_A | 40 | E3 ubiquitin-protein ligase itchy homolog; AIP4, N | 97.29 | |
| 2l4j_A | 46 | YES-associated protein 2 (YAP2); WW domain, medaka | 97.26 | |
| 2kpz_A | 49 | E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV | 97.21 | |
| 2jmf_A | 53 | E3 ubiquitin-protein ligase suppressor of deltex; | 97.19 | |
| 2ysh_A | 40 | GAS-7, growth-arrest-specific protein 7; WW domain | 97.19 | |
| 2ez5_W | 46 | Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma | 97.18 | |
| 1ymz_A | 43 | CC45; artificial protein, computational design, un | 97.11 | |
| 2ysb_A | 49 | Salvador homolog 1 protein; WW domain, structural | 96.95 | |
| 2yse_A | 60 | Membrane-associated guanylate kinase, WW and PDZ d | 96.93 | |
| 2jv4_A | 54 | Peptidyl-prolyl CIS/trans isomerase; ppiase domain | 96.84 | |
| 2dwv_A | 49 | Salvador homolog 1 protein; WW domain, dimer, stru | 96.77 | |
| 1wmv_A | 54 | WWOX, WW domain containing oxidoreductase; all-bet | 96.67 | |
| 2ysd_A | 57 | Membrane-associated guanylate kinase, WW and PDZ d | 96.61 | |
| 1jmq_A | 46 | YAP65, 65 kDa YES-associated protein; polyproline | 96.35 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 96.03 | |
| 2jx8_A | 52 | Hpcif1, phosphorylated CTD-interacting factor 1; p | 96.03 | |
| 2ysc_A | 39 | Amyloid beta A4 precursor protein-binding family B | 95.96 | |
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 95.77 | |
| 2ho2_A | 38 | Fe65 protein, amyloid beta A4 protein-binding fami | 95.66 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 95.13 | |
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 95.05 | |
| 3tc5_A | 166 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 94.67 | |
| 2e45_A | 55 | Fe65 protein, amyloid beta A4 precursor protein-bi | 94.51 | |
| 3l4h_A | 109 | E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d | 94.16 | |
| 2l5f_A | 92 | PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA | 92.56 | |
| 2ysi_A | 40 | Transcription elongation regulator 1; Ca150, FBP28 | 91.18 | |
| 1o6w_A | 75 | PRP40, PRE-mRNA processing protein PRP40; WW domai | 90.77 | |
| 3olm_A | 429 | E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S | 86.96 | |
| 1ywi_A | 41 | Formin-binding protein 3; WW domain, class II, pro | 85.81 | |
| 1ryq_A | 69 | DNA-directed RNA polymerase, subunit E''; structur | 84.88 | |
| 1e0n_A | 27 | Hypothetical protein; YJQ8WW domain, WW domain, sa | 84.79 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 84.6 | |
| 2jxw_A | 75 | WW domain-binding protein 4; WW domain containing | 83.33 | |
| 1e0l_A | 37 | Formin binding protein; SH3 domain, WW domain, FBP | 82.18 |
| >1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=97.59 E-value=3.2e-05 Score=48.61 Aligned_cols=36 Identities=11% Similarity=-0.037 Sum_probs=28.5
Q ss_pred CCCCCCCCCcchhccceeeeeccccE-EEeeccCcccCCCC
Q 045532 25 NPFLPFPHPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRNG 64 (173)
Q Consensus 25 ~~~l~~plP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~ 64 (173)
++..+.+||.+|| +++| .+|++ |+|..|.+..|..+
T Consensus 2 ~p~~~~~LP~gWe---~~~~-~~G~~Yy~n~~t~~t~We~P 38 (41)
T 1wr7_A 2 SPGIQSFLPPGWE---MRIA-PNGRPFFIDHNTKTTTWEDP 38 (41)
T ss_dssp TTCCCCSSCTTEE---EEEC-TTSCEEEEETTTTEEESSCG
T ss_pred CCCccCCCCCCcE---EEEc-CCCCEEEEECCCCCeecCCC
Confidence 3556789999998 8889 68999 77988877776554
|
| >2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A | Back alignment and structure |
|---|
| >1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* | Back alignment and structure |
|---|
| >1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* | Back alignment and structure |
|---|
| >1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} | Back alignment and structure |
|---|
| >2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* | Back alignment and structure |
|---|
| >2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A | Back alignment and structure |
|---|
| >2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} | Back alignment and structure |
|---|
| >2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* | Back alignment and structure |
|---|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* | Back alignment and structure |
|---|
| >2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A | Back alignment and structure |
|---|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* | Back alignment and structure |
|---|
| >3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... | Back alignment and structure |
|---|
| >2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A | Back alignment and structure |
|---|
| >1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E | Back alignment and structure |
|---|
| >1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| d1pina1 | 34 | Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId | 97.73 | |
| d1jmqa_ | 46 | Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 | 97.47 | |
| d2jmfa1 | 33 | Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr | 97.41 | |
| d1i5hw_ | 50 | Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n | 97.05 | |
| d1tk7a1 | 45 | Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso | 96.94 | |
| d2rm0w1 | 37 | Formin binding protein FBP28 domain {Domestic mous | 92.27 |
| >d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: WW domain-like superfamily: WW domain family: WW domain domain: Mitotic rotamase PIN1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.73 E-value=7.2e-06 Score=48.97 Aligned_cols=32 Identities=13% Similarity=0.029 Sum_probs=28.0
Q ss_pred CCCcchhccceeeeeccccE-EEeeccCcccCCCCC
Q 045532 31 PHPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRNGN 65 (173)
Q Consensus 31 plP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~~ 65 (173)
.||.||| +++|-.+|++ |+|..|..++|..|.
T Consensus 1 ~LP~GW~---~~~d~~~G~~YY~n~~T~~T~W~~Pt 33 (34)
T d1pina1 1 KLPPGWE---KRMSRSSGRVYYFNHITNASQWERPS 33 (34)
T ss_dssp CCCTTEE---EEECTTSCCEEEEETTTCCEESSCSC
T ss_pred CcCCCcE---EEECCCCCCEEEEECCCCCEEccCCC
Confidence 5899998 9999999999 779999888887764
|
| >d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|