Citrus Sinensis ID: 045532


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MSLLPSRHDACMGSMAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGGGIYRCVHTAKMSRRNGNVPKLDLKLNLSPPRGNPHMESPSQSATVSPTSPPSSCVSSENQEDMLQYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDKNNNSNNNTRETRRS
cccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccEEcccccccccccccccccccccccccccccccccHHHHHHccccccccccEEEEEcccccEEEEEEccccccccccccccccccccccccccccccccccc
cccccccccHHHHHHHHHHHHHccccccccccccccccccEEEccccccEEEEcccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEcccccccccccccEHHHHHHHccccccccccccccc
msllpsrhdacmGSMAIKFAektknpflpfphprLAKALFSFYLKAGGGIYRCVHTAkmsrrngnvpkldlklnlspprgnphmespsqsatvsptsppsscvssenqedmlqysnspeatsmvLVGCPRCLMYVmlseddpkcpkckstvLLDFLhdknnnsnnntretrrs
msllpsrhdaCMGSMAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGGGIYRCVHTAKmsrrngnvpklDLKLNLSPPRGNPHMESPSQSATVSPTSPPSSCVSSENQEDMLQYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLdflhdknnnsnnntretrrs
MSLLPSRHDACMGSMAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGGGIYRCVHTAKMSRRNGNVPKLDLKLNLSPPRGNPHMEspsqsatvsptsppsscvssENQEDMLQYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDKnnnsnnnTRETRRS
**************MAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGGGIYRCVHTAK***************************************************************SMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLH****************
********DACMGSMAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGG***************************************************************************VLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDF******************
MSLLPSRHDACMGSMAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGGGIYRCVHTAKMSRRNGNVPKLDLKLNLSPPR********************************LQYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDKNNNS**********
*****SRHDACMGSMAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGGGIYRCVHTAK*******VPKLDLKLNLS*******************************************ATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDK**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLPSRHDACMGSMAIKFAEKTKNPFLPFPHPRLAKALFSFYLKAGGGIYRCVHTAKMSRRNGNVPKLDLKLNLSPPRGNPHMESPSQSATVSPTSPPSSCVSSENQEDMLQYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDKNNNSNNNTRETRRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
255578609195 conserved hypothetical protein [Ricinus 0.780 0.692 0.695 8e-46
147856870 281 hypothetical protein VITISV_012166 [Viti 0.572 0.352 0.872 1e-42
225440755120 PREDICTED: uncharacterized protein LOC10 0.583 0.841 0.875 3e-42
224140053115 predicted protein [Populus trichocarpa] 0.658 0.991 0.784 2e-41
224091919104 predicted protein [Populus trichocarpa] 0.578 0.961 0.851 5e-41
356572600109 PREDICTED: uncharacterized protein LOC10 0.589 0.935 0.836 9e-40
356505406109 PREDICTED: uncharacterized protein LOC10 0.589 0.935 0.826 3e-39
449518366140 PREDICTED: uncharacterized protein LOC10 0.647 0.8 0.691 6e-38
449437444120 PREDICTED: uncharacterized protein LOC10 0.658 0.95 0.722 2e-37
449451175121 PREDICTED: uncharacterized protein LOC10 0.589 0.842 0.736 6e-37
>gi|255578609|ref|XP_002530166.1| conserved hypothetical protein [Ricinus communis] gi|223530327|gb|EEF32221.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 103/148 (69%), Positives = 114/148 (77%), Gaps = 13/148 (8%)

Query: 29  PFPHPRLAKALFSFYLKAGGGIYRCVHTAK--MSRRNGNVPKLDLKLNLSPPRGNPHMES 86
           PFP P   +   +      G IY   +T K  MSRRNGN PKLDLKLNLSPPR +P +ES
Sbjct: 58  PFPLPLGWQKFLNL---QTGEIYYTKNTRKKTMSRRNGNGPKLDLKLNLSPPRADPRVES 114

Query: 87  PSQSATVSPTSPPSSCVSSE-NQEDMLQYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCP 145
           P++SATVSPTSPPSSCVSSE NQ+D L+YSNSPEATSMVLVGCPRCLMYVMLSEDDPKCP
Sbjct: 115 PNRSATVSPTSPPSSCVSSELNQDDTLRYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCP 174

Query: 146 KCKSTVLLDFLHDKNNNSNNNTRETRRS 173
           KCKSTVLLDFLH+       NT +TR S
Sbjct: 175 KCKSTVLLDFLHE-------NTVQTRNS 195




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147856870|emb|CAN79170.1| hypothetical protein VITISV_012166 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225440755|ref|XP_002281204.1| PREDICTED: uncharacterized protein LOC100266492 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140053|ref|XP_002323401.1| predicted protein [Populus trichocarpa] gi|222868031|gb|EEF05162.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224091919|ref|XP_002309400.1| predicted protein [Populus trichocarpa] gi|222855376|gb|EEE92923.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356572600|ref|XP_003554456.1| PREDICTED: uncharacterized protein LOC100805043 [Glycine max] Back     alignment and taxonomy information
>gi|356505406|ref|XP_003521482.1| PREDICTED: uncharacterized protein LOC100788969 [Glycine max] Back     alignment and taxonomy information
>gi|449518366|ref|XP_004166213.1| PREDICTED: uncharacterized protein LOC101226911 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437444|ref|XP_004136502.1| PREDICTED: uncharacterized protein LOC101204832 [Cucumis sativus] gi|449532679|ref|XP_004173308.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226713 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449451175|ref|XP_004143337.1| PREDICTED: uncharacterized protein LOC101217127 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2164235122 AT5G06270 "AT5G06270" [Arabido 0.647 0.918 0.512 1.6e-24
TAIR|locus:2098328117 AT3G11600 "AT3G11600" [Arabido 0.624 0.923 0.508 1.6e-22
TAIR|locus:217632793 AT5G22270 "AT5G22270" [Arabido 0.219 0.408 0.666 1.6e-13
TAIR|locus:451510325199 AT3G52561 "AT3G52561" [Arabido 0.277 0.484 0.416 1.3e-06
TAIR|locus:2032900259 AT1G16500 "AT1G16500" [Arabido 0.277 0.185 0.431 1.1e-05
TAIR|locus:2164235 AT5G06270 "AT5G06270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
 Identities = 64/125 (51%), Positives = 75/125 (60%)

Query:    59 MSRRNGNVPKLDLKLNLSPPRGNPH--MEXXXXXXXXXXXXXXXXXXXXE-NQED-MLQY 114
             MSRR+   PKL+LKLNLSPP  +    +                     E NQ++  ++Y
Sbjct:     1 MSRRS---PKLELKLNLSPPTSSQRRMVRSPSRSATTSPTSPPSSCVSSEMNQDEPSVRY 57

Query:   115 SNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDKXX------XXXXXTR 168
             S SPE TSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLH+               R
Sbjct:    58 STSPETTSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHENATNANANAAAASSGR 117

Query:   169 ETRRS 173
             +TRR+
Sbjct:   118 KTRRN 122




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2098328 AT3G11600 "AT3G11600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176327 AT5G22270 "AT5G22270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103251 AT3G52561 "AT3G52561" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032900 AT1G16500 "AT1G16500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00021534001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (261 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 96.83
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 95.95
cd0020131 WW Two conserved tryptophans domain; also known as 95.06
PRK0835161 DNA-directed RNA polymerase subunit E''; Validated 87.86
PRK0639364 rpoE DNA-directed RNA polymerase subunit E''; Vali 81.08
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
Probab=96.83  E-value=0.0008  Score=40.71  Aligned_cols=29  Identities=14%  Similarity=0.136  Sum_probs=23.4

Q ss_pred             CCcchhccceeeeeccccE-EEeeccCcccCCC
Q 045532           32 HPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRN   63 (173)
Q Consensus        32 lP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~   63 (173)
                      ||.+|+   .+.|-.+|++ |+|..|.+.+|..
T Consensus         1 LP~gW~---~~~~~~~g~~YY~N~~t~~s~W~~   30 (31)
T PF00397_consen    1 LPPGWE---EYFDPDSGRPYYYNHETGESQWER   30 (31)
T ss_dssp             SSTTEE---EEEETTTSEEEEEETTTTEEESSS
T ss_pred             CCcCCE---EEEcCCCCCEEEEeCCCCCEEeCC
Confidence            789996   8888668999 7799998766643



This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A ....

>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 97.59
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 97.54
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 97.45
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 97.44
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 97.42
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 97.41
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 97.39
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 97.34
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 97.32
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 97.32
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 97.3
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 97.29
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 97.26
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 97.21
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 97.19
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 97.19
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 97.18
1ymz_A43 CC45; artificial protein, computational design, un 97.11
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 96.95
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 96.93
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 96.84
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 96.77
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 96.67
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 96.61
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 96.35
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 96.03
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 96.03
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 95.96
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 95.77
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 95.66
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 95.13
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 95.05
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 94.67
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 94.51
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 94.16
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 92.56
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 91.18
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 90.77
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 86.96
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 85.81
1ryq_A69 DNA-directed RNA polymerase, subunit E''; structur 84.88
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 84.79
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 84.6
2jxw_A75 WW domain-binding protein 4; WW domain containing 83.33
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 82.18
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
Probab=97.59  E-value=3.2e-05  Score=48.61  Aligned_cols=36  Identities=11%  Similarity=-0.037  Sum_probs=28.5

Q ss_pred             CCCCCCCCCcchhccceeeeeccccE-EEeeccCcccCCCC
Q 045532           25 NPFLPFPHPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRNG   64 (173)
Q Consensus        25 ~~~l~~plP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~   64 (173)
                      ++..+.+||.+||   +++| .+|++ |+|..|.+..|..+
T Consensus         2 ~p~~~~~LP~gWe---~~~~-~~G~~Yy~n~~t~~t~We~P   38 (41)
T 1wr7_A            2 SPGIQSFLPPGWE---MRIA-PNGRPFFIDHNTKTTTWEDP   38 (41)
T ss_dssp             TTCCCCSSCTTEE---EEEC-TTSCEEEEETTTTEEESSCG
T ss_pred             CCCccCCCCCCcE---EEEc-CCCCEEEEECCCCCeecCCC
Confidence            3556789999998   8889 68999 77988877776554



>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 97.73
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 97.47
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 97.41
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 97.05
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 96.94
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 92.27
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Mitotic rotamase PIN1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.73  E-value=7.2e-06  Score=48.97  Aligned_cols=32  Identities=13%  Similarity=0.029  Sum_probs=28.0

Q ss_pred             CCCcchhccceeeeeccccE-EEeeccCcccCCCCC
Q 045532           31 PHPRLAKALFSFYLKAGGGI-YRCVHTAKMSRRNGN   65 (173)
Q Consensus        31 plP~~WE~~~q~LDlqSGki-yln~rt~kmS~~~~~   65 (173)
                      .||.|||   +++|-.+|++ |+|..|..++|..|.
T Consensus         1 ~LP~GW~---~~~d~~~G~~YY~n~~T~~T~W~~Pt   33 (34)
T d1pina1           1 KLPPGWE---KRMSRSSGRVYYFNHITNASQWERPS   33 (34)
T ss_dssp             CCCTTEE---EEECTTSCCEEEEETTTCCEESSCSC
T ss_pred             CcCCCcE---EEECCCCCCEEEEECCCCCEEccCCC
Confidence            5899998   9999999999 779999888887764



>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure