Citrus Sinensis ID: 045555


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
ccHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHccccc
cHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHccc
MGFALEIfgnmknkdvISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQtsnirrdefTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
MGFALEIFgnmknkdviSWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFremqtsnirrdefttvRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
**FALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSAC***
MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTHN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q9LSB8 687 Putative pentatricopeptid yes no 1.0 0.254 0.515 5e-51
Q9C866 570 Pentatricopeptide repeat- no no 0.977 0.3 0.421 1e-39
Q9SJZ3 681 Pentatricopeptide repeat- no no 0.977 0.251 0.385 8e-38
Q9SJG6 559 Pentatricopeptide repeat- no no 0.982 0.307 0.367 7e-34
Q9MA50 500 Pentatricopeptide repeat- no no 0.96 0.336 0.359 4e-33
Q38959455 Pentatricopeptide repeat- no no 0.965 0.371 0.387 8e-33
Q9FG16 622 Pentatricopeptide repeat- no no 0.977 0.274 0.354 3e-32
Q9FFG8 657 Pentatricopeptide repeat- no no 0.982 0.261 0.357 2e-31
Q683I9 573 Pentatricopeptide repeat- no no 0.977 0.298 0.361 4e-31
Q1PEU4 555 Pentatricopeptide repeat- no no 0.988 0.311 0.362 5e-31
>sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containing protein At3g15930 OS=Arabidopsis thaliana GN=PCMP-E51 PE=3 SV=2 Back     alignment and function desciption
 Score =  200 bits (508), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 101/196 (51%), Positives = 128/196 (65%), Gaps = 21/196 (10%)

Query: 1   MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRV 60
           M  A+ IF +MK +DVISWT+IV GY+ RG + +AR YF QMP RD + WT MIDGYLR 
Sbjct: 287 MDIAVRIFRSMKARDVISWTSIVKGYVERGNLKLARTYFDQMPVRDRISWTIMIDGYLRA 346

Query: 61  NRFREALTLFREMQTSNIRRDEFTTVRILTT---------------------FNNDIFVG 99
             F E+L +FREMQ++ +  DEFT V +LT                        ND+ VG
Sbjct: 347 GCFNESLEIFREMQSAGMIPDEFTMVSVLTACAHLGSLEIGEWIKTYIDKNKIKNDVVVG 406

Query: 100 IALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIR 159
            ALIDMY KCG  EKAQ+VF  M ++DKFTWTAM+VGLA +G G  A+ +F QM   SI+
Sbjct: 407 NALIDMYFKCGCSEKAQKVFHDMDQRDKFTWTAMVVGLANNGQGQEAIKVFFQMQDMSIQ 466

Query: 160 LDEVTYVGVLSACTHN 175
            D++TY+GVLSAC H+
Sbjct: 467 PDDITYLGVLSACNHS 482





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C866|PPR65_ARATH Pentatricopeptide repeat-containing protein At1g31430 OS=Arabidopsis thaliana GN=PCMP-E55 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E28 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protein At2g42920, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E75 PE=2 SV=1 Back     alignment and function description
>sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protein At1g05750, chloroplastic OS=Arabidopsis thaliana GN=PDE247 PE=2 SV=1 Back     alignment and function description
>sp|Q38959|PP257_ARATH Pentatricopeptide repeat-containing protein At3g26630, chloroplastic OS=Arabidopsis thaliana GN=PCMP-A6 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFG8|PP417_ARATH Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana GN=PCMP-H17 PE=2 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|Q1PEU4|PP201_ARATH Pentatricopeptide repeat-containing protein At2g44880 OS=Arabidopsis thaliana GN=PCMP-E9 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
356528966 712 PREDICTED: putative pentatricopeptide re 0.994 0.244 0.620 2e-63
255553251 512 pentatricopeptide repeat-containing prot 0.994 0.339 0.625 3e-63
449491161 744 PREDICTED: LOW QUALITY PROTEIN: putative 0.994 0.233 0.594 2e-62
449436619 723 PREDICTED: putative pentatricopeptide re 0.994 0.240 0.594 2e-62
357468161 874 Pentatricopeptide repeat-containing prot 0.994 0.199 0.584 4e-60
225442904 724 PREDICTED: putative pentatricopeptide re 1.0 0.241 0.591 9e-59
224134923 635 predicted protein [Populus trichocarpa] 0.942 0.259 0.607 8e-58
9294596 695 unnamed protein product [Arabidopsis tha 1.0 0.251 0.515 2e-49
15233234 687 pentatricopeptide repeat-containing prot 1.0 0.254 0.515 2e-49
357127483 552 PREDICTED: putative pentatricopeptide re 0.994 0.315 0.492 7e-48
>gi|356528966|ref|XP_003533068.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Glycine max] Back     alignment and taxonomy information
 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 143/195 (73%), Gaps = 21/195 (10%)

Query: 1   MGFALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRV 60
           M  A  +F NMKN+DVISWT+IV+G+ N GQ+D+AR+YF Q+PERDYV WTAMIDGYLR+
Sbjct: 259 MDEAQSVFDNMKNRDVISWTSIVTGFANIGQIDLARKYFDQIPERDYVSWTAMIDGYLRM 318

Query: 61  NRFREALTLFREMQTSNIRRDEFTTVRILT---------------------TFNNDIFVG 99
           NRF EAL LFREMQ SN++ DEFT V ILT                     +  ND FVG
Sbjct: 319 NRFIEALALFREMQMSNVKPDEFTMVSILTACAHLGALELGEWVKTYIDKNSIKNDTFVG 378

Query: 100 IALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIR 159
            ALIDMY KCG+V KA++VF +M  KDKFTWTAMIVGLAI+GHG+ AL MFS M+ ASI 
Sbjct: 379 NALIDMYFKCGNVGKAKKVFKEMHHKDKFTWTAMIVGLAINGHGEEALAMFSNMIEASIT 438

Query: 160 LDEVTYVGVLSACTH 174
            DE+TY+GVL ACTH
Sbjct: 439 PDEITYIGVLCACTH 453




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255553251|ref|XP_002517668.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543300|gb|EEF44832.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449491161|ref|XP_004158817.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g15930-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449436619|ref|XP_004136090.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357468161|ref|XP_003604365.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505420|gb|AES86562.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225442904|ref|XP_002264123.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134923|ref|XP_002327523.1| predicted protein [Populus trichocarpa] gi|222836077|gb|EEE74498.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|9294596|dbj|BAB02877.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15233234|ref|NP_188214.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546758|sp|Q9LSB8.2|PP235_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g15930 gi|332642227|gb|AEE75748.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357127483|ref|XP_003565409.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
TAIR|locus:2041198 681 SLO1 "SLOW GROWTH 1" [Arabidop 0.497 0.127 0.459 6.3e-35
TAIR|locus:2205200 741 OTP82 "AT1G08070" [Arabidopsis 0.428 0.101 0.493 6.2e-34
TAIR|locus:2054789 534 MEF21 "mitochondrial editing f 0.491 0.161 0.406 1.9e-28
TAIR|locus:2161018 530 AT5G56310 "AT5G56310" [Arabido 0.468 0.154 0.439 5.4e-28
TAIR|locus:2054966 555 AHG11 "ABA hypersensitive germ 0.817 0.257 0.331 3.8e-14
TAIR|locus:2006927 538 AT1G33350 [Arabidopsis thalian 0.462 0.150 0.395 1.9e-26
TAIR|locus:2027589 611 PGN "AT1G56570" [Arabidopsis t 0.474 0.135 0.404 3.3e-26
TAIR|locus:2129361 612 AT4G14050 [Arabidopsis thalian 0.474 0.135 0.409 4.2e-26
TAIR|locus:2018092 656 MEF9 "AT1G62260" [Arabidopsis 0.754 0.201 0.333 3.1e-14
TAIR|locus:2047017 597 AT2G21090 "AT2G21090" [Arabido 0.48 0.140 0.404 2.9e-12
TAIR|locus:2041198 SLO1 "SLOW GROWTH 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 221 (82.9 bits), Expect = 6.3e-35, Sum P(2) = 6.3e-35
 Identities = 40/87 (45%), Positives = 60/87 (68%)

Query:     4 ALEIFGNMKNKDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRF 63
             A  IF N++ + ++SWTT++SGY   G +D++R+ F  M E+D VLW AMI G ++  R 
Sbjct:   311 ARRIFDNLEKRTIVSWTTMISGYARCGLLDVSRKLFDDMEEKDVVLWNAMIGGSVQAKRG 370

Query:    64 REALTLFREMQTSNIRRDEFTTVRILT 90
             ++AL LF+EMQTSN + DE T +  L+
Sbjct:   371 QDALALFQEMQTSNTKPDEITMIHCLS 397


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054789 MEF21 "mitochondrial editing factor 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161018 AT5G56310 "AT5G56310" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054966 AHG11 "ABA hypersensitive germination 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2006927 AT1G33350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027589 PGN "AT1G56570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129361 AT4G14050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018092 MEF9 "AT1G62260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047017 AT2G21090 "AT2G21090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00000293001
SubName- Full=Chromosome chr9 scaffold_104, whole genome shotgun sequence; (724 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-29
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-26
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-25
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-23
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-23
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-21
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-11
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  113 bits (283), Expect = 2e-29
 Identities = 57/164 (34%), Positives = 84/164 (51%), Gaps = 21/164 (12%)

Query: 30  GQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFT---TV 86
           G ++ AR  F  MPE+  V W +M+ GY       EAL L+ EM+ S +  D+FT    +
Sbjct: 273 GDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMI 332

Query: 87  RILTT------------------FNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKF 128
           RI +                   F  DI    AL+D+Y K G +E A+ VF +M RK+  
Sbjct: 333 RIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLI 392

Query: 129 TWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSAC 172
           +W A+I G    G G  A++MF +M+   +  + VT++ VLSAC
Sbjct: 393 SWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSAC 436


Length = 697

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PF1304150 PPR_2: PPR repeat family 99.74
PF1304150 PPR_2: PPR repeat family 99.6
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.46
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.42
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.23
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.21
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.2
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.15
PF1285434 PPR_1: PPR repeat 99.13
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.1
PF1285434 PPR_1: PPR repeat 99.03
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.0
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 98.9
PRK12370553 invasion protein regulator; Provisional 98.9
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.89
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.87
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.86
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.86
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.85
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.83
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.82
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.79
PRK12370553 invasion protein regulator; Provisional 98.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.7
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.68
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.66
KOG1126638 consensus DNA-binding cell division cycle control 98.65
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.65
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.64
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.63
KOG2003 840 consensus TPR repeat-containing protein [General f 98.63
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.63
PRK15359144 type III secretion system chaperone protein SscB; 98.62
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.61
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.59
PRK14574 822 hmsH outer membrane protein; Provisional 98.59
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.58
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.56
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.54
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.5
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.49
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.48
KOG1126638 consensus DNA-binding cell division cycle control 98.48
PRK11189296 lipoprotein NlpI; Provisional 98.46
PRK15359144 type III secretion system chaperone protein SscB; 98.45
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.45
PRK11189296 lipoprotein NlpI; Provisional 98.44
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.42
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.41
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.41
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.4
PRK10370198 formate-dependent nitrite reductase complex subuni 98.39
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.39
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.38
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.37
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.35
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.35
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.34
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.33
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.32
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.3
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.29
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.28
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.26
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.18
PRK10370198 formate-dependent nitrite reductase complex subuni 98.18
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.17
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.17
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.15
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.14
PRK14574 822 hmsH outer membrane protein; Provisional 98.13
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.12
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.11
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.04
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.01
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.01
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.99
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.99
KOG1129 478 consensus TPR repeat-containing protein [General f 97.98
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.98
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.96
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.95
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.92
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.87
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.87
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.85
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.84
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.84
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.83
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.83
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.83
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.8
KOG1129478 consensus TPR repeat-containing protein [General f 97.78
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.73
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.72
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.7
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.7
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.69
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.68
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.67
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.66
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.65
KOG2076 895 consensus RNA polymerase III transcription factor 97.63
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.62
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.62
KOG1125579 consensus TPR repeat-containing protein [General f 97.61
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.61
KOG2003 840 consensus TPR repeat-containing protein [General f 97.6
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.6
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.59
KOG0547606 consensus Translocase of outer mitochondrial membr 97.56
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.54
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.54
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.54
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.53
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.51
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.49
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.46
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.46
KOG0547606 consensus Translocase of outer mitochondrial membr 97.46
PF12688120 TPR_5: Tetratrico peptide repeat 97.46
KOG2076 895 consensus RNA polymerase III transcription factor 97.45
KOG0553 304 consensus TPR repeat-containing protein [General f 97.44
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.39
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.39
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.36
PLN02789 320 farnesyltranstransferase 97.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.34
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.33
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.33
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.28
KOG1125579 consensus TPR repeat-containing protein [General f 97.24
PRK10803263 tol-pal system protein YbgF; Provisional 97.24
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.23
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.23
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.22
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.22
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.18
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.17
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.15
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.15
PF1337173 TPR_9: Tetratricopeptide repeat 97.13
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.12
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.11
PF12688120 TPR_5: Tetratrico peptide repeat 97.11
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.09
KOG0553304 consensus TPR repeat-containing protein [General f 97.09
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.07
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.06
PLN02789320 farnesyltranstransferase 96.97
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.96
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.94
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.88
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.86
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.84
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.83
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.76
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.74
PRK10803263 tol-pal system protein YbgF; Provisional 96.73
COG4700251 Uncharacterized protein conserved in bacteria cont 96.72
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 96.7
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.64
PF1337173 TPR_9: Tetratricopeptide repeat 96.6
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.6
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.58
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.57
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.56
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.55
KOG3941 406 consensus Intermediate in Toll signal transduction 96.55
PRK15331165 chaperone protein SicA; Provisional 96.5
COG3629280 DnrI DNA-binding transcriptional activator of the 96.48
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.47
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.45
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.45
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.27
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.24
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 96.24
PRK15331165 chaperone protein SicA; Provisional 96.15
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.07
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 96.05
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.03
KOG3941 406 consensus Intermediate in Toll signal transduction 96.02
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.95
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.75
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.73
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.72
KOG4162799 consensus Predicted calmodulin-binding protein [Si 95.71
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 95.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.69
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.48
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.45
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.44
smart00299140 CLH Clathrin heavy chain repeat homology. 95.37
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.32
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.28
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.2
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 95.08
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 95.06
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 94.91
PRK04841 903 transcriptional regulator MalT; Provisional 94.9
KOG1914656 consensus mRNA cleavage and polyadenylation factor 94.89
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.87
COG3629280 DnrI DNA-binding transcriptional activator of the 94.75
PF13512142 TPR_18: Tetratricopeptide repeat 94.72
KOG1128 777 consensus Uncharacterized conserved protein, conta 94.72
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.7
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 94.67
PF1342844 TPR_14: Tetratricopeptide repeat 94.62
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.61
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.09
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.98
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 93.97
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.91
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.83
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 93.8
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.7
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.65
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.53
PF1342844 TPR_14: Tetratricopeptide repeat 93.52
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 93.45
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 93.45
PRK04841 903 transcriptional regulator MalT; Provisional 93.44
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 93.07
PF13512142 TPR_18: Tetratricopeptide repeat 93.02
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.93
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.88
smart00299140 CLH Clathrin heavy chain repeat homology. 92.69
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.68
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.55
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.52
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.48
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.43
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.33
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.31
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 92.29
KOG4555175 consensus TPR repeat-containing protein [Function 92.06
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.96
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 91.87
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.81
PF13762145 MNE1: Mitochondrial splicing apparatus component 91.62
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 91.37
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.94
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 90.88
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.76
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 90.69
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.51
PRK10564303 maltose regulon periplasmic protein; Provisional 90.27
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.18
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 89.91
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 89.89
KOG4555175 consensus TPR repeat-containing protein [Function 89.63
COG4455 273 ImpE Protein of avirulence locus involved in tempe 89.61
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.36
PF1343134 TPR_17: Tetratricopeptide repeat 89.35
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.35
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.33
COG4455 273 ImpE Protein of avirulence locus involved in tempe 89.01
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.85
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.75
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.68
KOG2041 1189 consensus WD40 repeat protein [General function pr 88.35
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.33
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 88.26
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.23
COG4700251 Uncharacterized protein conserved in bacteria cont 88.04
COG3118304 Thioredoxin domain-containing protein [Posttransla 88.01
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 87.44
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 87.38
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.1
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 86.76
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.66
PF13170 297 DUF4003: Protein of unknown function (DUF4003) 86.28
KOG1585308 consensus Protein required for fusion of vesicles 85.98
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 85.67
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 84.83
COG4105 254 ComL DNA uptake lipoprotein [General function pred 84.65
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.56
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 84.06
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 83.76
PRK09687280 putative lyase; Provisional 83.39
KOG4234271 consensus TPR repeat-containing protein [General f 83.13
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 83.02
KOG2796366 consensus Uncharacterized conserved protein [Funct 82.97
PRK11906458 transcriptional regulator; Provisional 82.91
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.72
COG3898 531 Uncharacterized membrane-bound protein [Function u 82.44
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.31
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 81.99
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 81.82
KOG2610 491 consensus Uncharacterized conserved protein [Funct 81.72
KOG2908 380 consensus 26S proteasome regulatory complex, subun 81.69
PF10475291 DUF2450: Protein of unknown function N-terminal do 81.06
PF13762145 MNE1: Mitochondrial splicing apparatus component 80.91
PRK10564303 maltose regulon periplasmic protein; Provisional 80.88
KOG4234271 consensus TPR repeat-containing protein [General f 80.7
PF14669233 Asp_Glu_race_2: Putative aspartate racemase 80.69
KOG4570 418 consensus Uncharacterized conserved protein [Funct 80.57
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 80.49
PF14669233 Asp_Glu_race_2: Putative aspartate racemase 80.28
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 80.14
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.1e-37  Score=244.97  Aligned_cols=162  Identities=35%  Similarity=0.616  Sum_probs=156.8

Q ss_pred             CcHHHHHHHHHHHHhcCChhHHHHHhhcCCCCChhHHHHHHHHHhccCChHHHHHHHHHhHhCCCCCChHHHHHhhh---
Q 045555           14 KDVISWTTIVSGYINRGQVDIARQYFAQMPERDYVLWTAMIDGYLRVNRFREALTLFREMQTSNIRRDEFTTVRILT---   90 (175)
Q Consensus        14 ~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~l~~---   90 (175)
                      ||..+||+||.+|++.|++++|.++|+.|.++|.++||+||.+|++.|++++|.++|++|.+.|+.||..||+.++.   
T Consensus       257 ~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~  336 (697)
T PLN03081        257 GDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFS  336 (697)
T ss_pred             ccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHH
Confidence            46667789999999999999999999999999999999999999999999999999999999999999999999998   


Q ss_pred             ------------------ccCcchhHHHHHHHHHHhcCCHHHHHHHHHhhcCCChhhHHHHHHHHHhcCChhHHHHHHHH
Q 045555           91 ------------------TFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDKFTWTAMIVGLAISGHGDTALDMFSQ  152 (175)
Q Consensus        91 ------------------~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~  152 (175)
                                        ++.||..++|+||++|++.|++++|.++|++|.+||..+||+||.+|+++|+.++|.++|++
T Consensus       337 ~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~  416 (697)
T PLN03081        337 RLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFER  416 (697)
T ss_pred             hccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHH
Confidence                              67999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHCCCCCcHHHHHHHHhhhcCC
Q 045555          153 MLRASIRLDEVTYVGVLSACTHN  175 (175)
Q Consensus       153 m~~~g~~p~~~t~~~ll~~~~~~  175 (175)
                      |.+.|+.||..||+.+|.+|+++
T Consensus       417 M~~~g~~Pd~~T~~~ll~a~~~~  439 (697)
T PLN03081        417 MIAEGVAPNHVTFLAVLSACRYS  439 (697)
T ss_pred             HHHhCCCCCHHHHHHHHHHHhcC
Confidence            99999999999999999999874



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10475 DUF2450: Protein of unknown function N-terminal domain (DUF2450) ; InterPro: IPR019515 This entry represents Vacuolar protein sorting-associated protein 54, and is thought to be involved in retrograde transport from early and late endosomes to late Golgi found in eukaryotes, but its function is not known Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14669 Asp_Glu_race_2: Putative aspartate racemase Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF14669 Asp_Glu_race_2: Putative aspartate racemase Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 49.0 bits (115), Expect = 2e-07
 Identities = 13/154 (8%), Positives = 44/154 (28%), Gaps = 21/154 (13%)

Query: 15  DVISWTTIVSGYINRGQVDIARQYFAQMPER-------DYVLWTAMIDGYLRVNRFREAL 67
                       +   Q+ +A         +          ++ A++ G+ R   F+E +
Sbjct: 126 QQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELV 185

Query: 68  TLFREMQTSNIRRDEFTTVRILTTFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLRKDK 127
            +   ++ + +  D       L ++        A +    +            + + ++ 
Sbjct: 186 YVLFMVKDAGLTPD-------LLSYA-------AALQCMGRQDQDAGTIERCLEQMSQEG 231

Query: 128 FTWTAMIVGLAISGHGDTALDMFSQMLRASIRLD 161
               A+   + +S      +      ++ +  L 
Sbjct: 232 LKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLP 265


>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.89
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.87
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.73
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.7
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.42
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.41
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.4
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.39
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.37
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.37
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.34
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.31
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.31
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.3
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.3
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.28
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.27
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.25
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.24
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.23
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.23
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.22
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.21
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.2
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.2
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.19
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.17
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.16
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.16
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.14
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.12
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.12
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.1
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.08
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.07
3u4t_A272 TPR repeat-containing protein; structural genomics 99.06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.04
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.03
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.03
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.02
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.99
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.98
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.94
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.93
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.93
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.91
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.9
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.89
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.88
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.87
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.87
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.86
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.86
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.86
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.85
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.84
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.82
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.82
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.8
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.79
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.79
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.79
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.78
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.75
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.75
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.74
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.74
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.73
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.73
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.71
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.71
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.69
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.67
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.67
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.66
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.66
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.65
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.64
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.63
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.63
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.62
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.61
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.61
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.6
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.6
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.59
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.59
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.59
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.59
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.58
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.57
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.56
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.56
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.55
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.55
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.55
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.55
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.52
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.52
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.5
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.5
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.49
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.49
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.49
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.49
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.48
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.47
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.47
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.47
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.47
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.46
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.46
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.45
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.44
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.44
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.44
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.44
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.42
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.42
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.42
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.41
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.4
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.39
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.38
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 98.38
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.36
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.35
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.33
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.33
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.31
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.3
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.28
3k9i_A117 BH0479 protein; putative protein binding protein, 98.27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.27
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.26
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.26
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.24
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.21
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.2
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.2
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.14
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.1
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.1
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.08
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.07
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.04
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.01
3k9i_A117 BH0479 protein; putative protein binding protein, 97.98
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.96
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.96
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.95
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 97.93
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.92
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.87
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.86
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.83
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.82
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.81
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.79
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.77
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.76
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.7
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.69
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.69
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.67
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.66
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.63
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.58
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.48
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.41
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.33
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.29
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.24
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.13
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.11
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.03
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.99
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.95
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.86
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.77
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.7
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.53
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.48
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.32
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.2
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.19
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.07
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.03
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.0
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.93
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.75
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.69
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.4
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.36
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.98
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.97
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.71
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.15
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 93.08
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.93
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.37
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.34
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.75
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.43
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.38
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.05
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 88.35
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 88.35
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 87.65
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 87.6
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 87.51
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 87.28
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.82
2p58_C116 Putative type III secretion protein YSCG; type III 86.53
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 85.77
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 85.55
2uwj_G115 Type III export protein PSCG; virulence, chaperone 85.43
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 85.42
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 85.04
2p58_C116 Putative type III secretion protein YSCG; type III 84.96
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 84.41
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 83.71
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 82.64
3ygs_P97 Procaspase 9; apoptosis, caspase activation, caspa 82.54
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 81.99
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 81.6
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=9.6e-34  Score=216.94  Aligned_cols=171  Identities=11%  Similarity=0.090  Sum_probs=141.0

Q ss_pred             HHHHhhccCC----Cc-HHHHHHHHHHHHhcCChhHHHHHhhcCC----CCChhHHHHHHHHHhccCC---------hHH
Q 045555            4 ALEIFGNMKN----KD-VISWTTIVSGYINRGQVDIARQYFAQMP----ERDYVLWTAMIDGYLRVNR---------FRE   65 (175)
Q Consensus         4 A~~~~~~m~~----~~-~~~~~~li~~~~~~~~~~~a~~~~~~m~----~~~~~~~~~li~~~~~~~~---------~~~   65 (175)
                      +..+.+.+.+    +. ...++.+|.+|++.|++++|.++|++|.    +||.+|||+||++|++.+.         ++.
T Consensus         9 ~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~   88 (501)
T 4g26_A            9 SENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSR   88 (501)
T ss_dssp             ---------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHH
T ss_pred             HHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHH
Confidence            4455555554    22 2357778888888888888888888887    3788888888888877654         577


Q ss_pred             HHHHHHHhHhCCCCCChHHHHHhhh---------------------ccCcchhHHHHHHHHHHhcCCHHHHHHHHHhh--
Q 045555           66 ALTLFREMQTSNIRRDEFTTVRILT---------------------TFNNDIFVGIALIDMYCKCGDVEKAQRVFWKM--  122 (175)
Q Consensus        66 a~~~~~~m~~~~~~p~~~~~~~l~~---------------------~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~--  122 (175)
                      |.++|++|...|+.||..||++++.                     |+.||..+||++|.+|++.|++++|.++|++|  
T Consensus        89 A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~  168 (501)
T 4g26_A           89 GFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVE  168 (501)
T ss_dssp             HHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHh
Confidence            8888888888888888888888887                     77888999999999999999999999999999  


Q ss_pred             --cCCChhhHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCcHHHHHHHHhhhcC
Q 045555          123 --LRKDKFTWTAMIVGLAISGHGDTALDMFSQMLRASIRLDEVTYVGVLSACTH  174 (175)
Q Consensus       123 --~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~  174 (175)
                        ..||..+|++||.+|++.|++++|.++|++|.+.|..|+..||..|+..+++
T Consensus       169 ~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s  222 (501)
T 4g26_A          169 SEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKS  222 (501)
T ss_dssp             TTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHS
T ss_pred             cCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhc
Confidence              4589999999999999999999999999999999999999999999998764



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>3ygs_P Procaspase 9; apoptosis, caspase activation, caspase recruitment, recognition complex; 2.50A {Homo sapiens} SCOP: a.77.1.3 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.22
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.11
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.07
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.04
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.84
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.7
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.7
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.7
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.58
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.57
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.57
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.56
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.56
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.46
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.39
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.39
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.33
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.3
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.27
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.26
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.23
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.12
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.09
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.97
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.96
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.92
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.91
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.89
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.68
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.65
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.64
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.63
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.62
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.53
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.42
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.33
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.3
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.25
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.92
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.84
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.71
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.68
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.33
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.73
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.19
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.64
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.98
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 89.87
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.41
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 84.8
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 82.9
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 82.44
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.22  E-value=4.8e-10  Score=79.90  Aligned_cols=166  Identities=13%  Similarity=0.079  Sum_probs=111.6

Q ss_pred             hHHHHhhccCC--C-cHHHHHHHHHHHHhcCChhHHHHHhhcCCC---CChhHHHHHHHHHhccCChHHHHHHHHHhHhC
Q 045555            3 FALEIFGNMKN--K-DVISWTTIVSGYINRGQVDIARQYFAQMPE---RDYVLWTAMIDGYLRVNRFREALTLFREMQTS   76 (175)
Q Consensus         3 ~A~~~~~~m~~--~-~~~~~~~li~~~~~~~~~~~a~~~~~~m~~---~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~   76 (175)
                      +|...++...+  | +..++..+...+...|++++|...|+....   .+...+..+...+.+.|++++|+..|++..+.
T Consensus       187 ~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~  266 (388)
T d1w3ba_         187 LAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL  266 (388)
T ss_dssp             HHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh
Confidence            45555554432  2 455666677777777777777777765442   34455666666677777777777777776663


Q ss_pred             CCCCCh-HHHHHhhh--------------------ccCcchhHHHHHHHHHHhcCCHHHHHHHHHhhcC--C-ChhhHHH
Q 045555           77 NIRRDE-FTTVRILT--------------------TFNNDIFVGIALIDMYCKCGDVEKAQRVFWKMLR--K-DKFTWTA  132 (175)
Q Consensus        77 ~~~p~~-~~~~~l~~--------------------~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~--~-~~~~~~~  132 (175)
                      .  |+. ..+..+-.                    ..+.+...+..+...+.+.|++++|.+.|++..+  | +..+|..
T Consensus       267 ~--p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~  344 (388)
T d1w3ba_         267 Q--PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSN  344 (388)
T ss_dssp             C--SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHH
T ss_pred             C--CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHH
Confidence            2  321 12211111                    3345567778899999999999999999999854  4 5678888


Q ss_pred             HHHHHHhcCChhHHHHHHHHHHHCCCCCc-HHHHHHHHhhh
Q 045555          133 MIVGLAISGHGDTALDMFSQMLRASIRLD-EVTYVGVLSAC  172 (175)
Q Consensus       133 li~~~~~~g~~~~a~~~~~~m~~~g~~p~-~~t~~~ll~~~  172 (175)
                      +...|.+.|++++|.+.|++.++.  .|+ ...+..+-..+
T Consensus       345 la~~~~~~g~~~~A~~~~~~al~l--~P~~~~a~~~lg~~~  383 (388)
T d1w3ba_         345 LASVLQQQGKLQEALMHYKEAIRI--SPTFADAYSNMGNTL  383 (388)
T ss_dssp             HHHHHHTTTCCHHHHHHHHHHHTT--CTTCHHHHHHHHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHH
Confidence            999999999999999999998863  564 55566554443



>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure