Citrus Sinensis ID: 045563

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
ETAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYIIS
cccEEEEEEEcccccHHHHHHHHHHHHcccccEEEEEEccccEEcccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHccccccccccEEEEEccccccccccHHHccccHHHHHcccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHcc
cccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHccccHHHHEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEEEEEcccEEEcHHHHHHHHHHHHHcccEEEEEEccccHHHHHHcccccccEEEEEEc
ETAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSheeqdgkqrclifhtfsntgwfvCGSILASLQGREDLMQKIKGLIvdsggagafdpkvwaggFGAAILKKrsssaystvedgkinglegQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVtnnppacphlylystgdkvipyqSVELLIEEQRKTGRKVFSVILGhlptwitsglspadtyrsyiis
ETAVTVVLlgwlgarrkhLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGhlptwitsglspadtyrsyiis
ETAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYIIS
***VTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKK*******************************DIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYI**
*TAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYIIS
ETAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYIIS
*TAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYIIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ETAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYIIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
Q6DHN0281 Transmembrane protein 53 yes no 0.756 0.729 0.241 2e-07
>sp|Q6DHN0|TMM53_DANRE Transmembrane protein 53 OS=Danio rerio GN=tmem53 PE=2 SV=1 Back     alignment and function desciption
 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 99/240 (41%), Gaps = 35/240 (14%)

Query: 6   VVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKE-LLSFDLGRGVEKRIADLSNEIV 64
           V+LLGW G+R KHL +Y   YN +G   + +    K   +S  LG    K +   +++++
Sbjct: 30  VILLGWAGSRDKHLAKYSSIYNEQGCTTLRYTAPLKTVFISESLGY---KELRSTAHKLL 86

Query: 65  SWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQ-KIKGLIVDSGGAGAFD 123
             +   E +     + FH FSN G+ +   ++  L   +      + G +VDS       
Sbjct: 87  ELLYDYEVENNP--IFFHVFSNGGFMLYRYMVELLHSHKQFSTLCVVGTVVDS------- 137

Query: 124 PKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKL 183
               A G    +   R   A  T    K+N L     +++        +   LL      
Sbjct: 138 ----APGSQNVVGALR---ALKTTLGPKVNVLLQYFLLALFA------VAVFLLR----- 179

Query: 184 FSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKV 243
              I+  P      +    A+  +P   P +YLYS  D+VI Y+ VE +++  ++ G  V
Sbjct: 180 ---IVLYPLTKYFHRNHYDAMMEHPAPWPQMYLYSRADRVIRYRDVEKMVKGLQEKGLMV 236

Danio rerio (taxid: 7955)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
356496739 377 PREDICTED: transmembrane protein 53-like 0.948 0.681 0.598 3e-86
356540773 387 PREDICTED: transmembrane protein 53-like 0.937 0.656 0.597 4e-85
297735134 470 unnamed protein product [Vitis vinifera] 0.948 0.546 0.595 2e-84
225430718 489 PREDICTED: transmembrane protein 53-like 0.948 0.525 0.595 3e-84
449504932 475 PREDICTED: transmembrane protein 53-like 0.904 0.515 0.563 4e-79
449451547 403 PREDICTED: transmembrane protein 53-like 0.904 0.607 0.563 1e-78
224097028 454 predicted protein [Populus trichocarpa] 0.885 0.528 0.503 3e-78
297832480 393 hypothetical protein ARALYDRAFT_480731 [ 0.940 0.648 0.548 9e-73
18398681 398 alpha/beta-hydrolase domain-containing p 0.929 0.633 0.539 2e-70
21536700 398 unknown [Arabidopsis thaliana] 0.929 0.633 0.535 4e-70
>gi|356496739|ref|XP_003517223.1| PREDICTED: transmembrane protein 53-like [Glycine max] Back     alignment and taxonomy information
 Score =  324 bits (830), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 161/269 (59%), Positives = 200/269 (74%), Gaps = 12/269 (4%)

Query: 1   ETAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLS 60
           +   TVVLLGWLGAR KHL+RYVEWYNSRGINA+TFVV+ KELL FDLG  +E RI+ L+
Sbjct: 94  DRVATVVLLGWLGARTKHLKRYVEWYNSRGINALTFVVDVKELLRFDLGHVLETRISLLA 153

Query: 61  NEIVSWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAG 120
           + +VSWVS EE DG++RCL+FHTFSNTGWFV G ILA + G E+LM+KIKG IVDSGG  
Sbjct: 154 DHLVSWVSREEHDGRERCLVFHTFSNTGWFVYGYILARMLGSEELMEKIKGCIVDSGGGE 213

Query: 121 AFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLL 180
            F+PKVWA GF AAILKKR+S       +GK+   E +VS+S +Q  EP  IET++LSLL
Sbjct: 214 PFNPKVWAAGFSAAILKKRNSLGPVVEVEGKLKS-ETEVSLSKVQQNEPSTIETVVLSLL 272

Query: 181 EKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTG 240
           EK FS+++ LPDVNQR+ ++V+ +  + P CP LYLYST DKV+P QS+E LIEEQRK G
Sbjct: 273 EKFFSFVLQLPDVNQRLTRIVNVLMKHQP-CPQLYLYSTADKVVPCQSIETLIEEQRKMG 331

Query: 241 RKVFSVILGHLPTWITSGLSP-ADTYRSY 268
           ++V S            GLSP  D YR++
Sbjct: 332 KRVRS---------FNFGLSPHVDHYRTF 351

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356540773|ref|XP_003538859.1| PREDICTED: transmembrane protein 53-like [Glycine max] Back     alignment and taxonomy information
>gi|297735134|emb|CBI17496.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225430718|ref|XP_002266392.1| PREDICTED: transmembrane protein 53-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449504932|ref|XP_004162334.1| PREDICTED: transmembrane protein 53-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449451547|ref|XP_004143523.1| PREDICTED: transmembrane protein 53-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224097028|ref|XP_002310815.1| predicted protein [Populus trichocarpa] gi|222853718|gb|EEE91265.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297832480|ref|XP_002884122.1| hypothetical protein ARALYDRAFT_480731 [Arabidopsis lyrata subsp. lyrata] gi|297329962|gb|EFH60381.1| hypothetical protein ARALYDRAFT_480731 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18398681|ref|NP_565432.1| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] gi|20197808|gb|AAM15256.1| Expressed protein [Arabidopsis thaliana] gi|109134131|gb|ABG25064.1| At2g18245 [Arabidopsis thaliana] gi|330251651|gb|AEC06745.1| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21536700|gb|AAM61032.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
TAIR|locus:505006253398 AT2G18245 "AT2G18245" [Arabido 0.870 0.592 0.580 1.2e-72
TAIR|locus:2095375434 AT3G19970 "AT3G19970" [Arabido 0.837 0.523 0.454 8.3e-51
DICTYBASE|DDB_G0278115270 DDB_G0278115 "DUF829 family pr 0.387 0.388 0.333 1.6e-09
ZFIN|ZDB-GENE-040718-384281 tmem53 "transmembrane protein 0.391 0.377 0.274 2.1e-09
RGD|1307066276 Tmem53 "transmembrane protein 0.398 0.391 0.283 2.5e-07
UNIPROTKB|Q6P2H8277 TMEM53 "Transmembrane protein 0.479 0.469 0.294 3e-07
DICTYBASE|DDB_G0285447305 DDB_G0285447 "DUF829 family pr 0.483 0.429 0.244 5.1e-07
MGI|MGI:1916027276 Tmem53 "transmembrane protein 0.398 0.391 0.283 6.1e-07
UNIPROTKB|Q2TBP5294 TMEM53 "Transmembrane protein 0.398 0.367 0.283 1.5e-05
WB|WBGene00020402325 T10B11.6.2 [Caenorhabditis ele 0.398 0.332 0.235 0.00014
TAIR|locus:505006253 AT2G18245 "AT2G18245" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 734 (263.4 bits), Expect = 1.2e-72, P = 1.2e-72
 Identities = 140/241 (58%), Positives = 179/241 (74%)

Query:     5 TVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIV 64
             TVVLLGWLGA+ KHLRRYVEWYNSRGINA+TF V+ ++LL  DLGR +E+RIA+  NE+V
Sbjct:   124 TVVLLGWLGAKAKHLRRYVEWYNSRGINAVTFTVDVRDLLRLDLGRRLERRIAEFGNELV 183

Query:    65 SWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDP 124
             +WVS +E DG+++CL+FH+FSNTGW V G++L S  GR+DL+++IKG I+DSGGA   D 
Sbjct:   184 NWVSEKEDDGREKCLVFHSFSNTGWLVYGALLESFIGRQDLVERIKGCIIDSGGADPLDT 243

Query:   125 KVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLEKLF 184
             K+WA GF AAILKKRSS+  +T  +  I     +   S  Q KEP  IE ++LS LEKLF
Sbjct:   244 KIWAAGFTAAILKKRSSTI-TTEPNSPIK----EEDASTPQKKEPLGIENIMLSSLEKLF 298

Query:   185 SYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVF 244
                +N PDVN R+ K++  +  N P CP LYLYS+GDKV+P  SVEL I EQ+K GRK+ 
Sbjct:   299 PIFLNHPDVNTRLTKIIQKLYENHPPCPQLYLYSSGDKVVPSHSVELRIREQQKIGRKIH 358

Query:   245 S 245
             S
Sbjct:   359 S 359
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2095375 AT3G19970 "AT3G19970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278115 DDB_G0278115 "DUF829 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-384 tmem53 "transmembrane protein 53" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1307066 Tmem53 "transmembrane protein 53" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P2H8 TMEM53 "Transmembrane protein 53" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285447 DDB_G0285447 "DUF829 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1916027 Tmem53 "transmembrane protein 53" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBP5 TMEM53 "Transmembrane protein 53" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00020402 T10B11.6.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024906001
SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (412 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
pfam05705240 pfam05705, DUF829, Eukaryotic protein of unknown f 4e-49
>gnl|CDD|218708 pfam05705, DUF829, Eukaryotic protein of unknown function (DUF829) Back     alignment and domain information 
 Score =  162 bits (411), Expect = 4e-49
 Identities = 73/245 (29%), Positives = 112/245 (45%), Gaps = 35/245 (14%)

Query: 5   TVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIV 64
            V+LLGWLGAR KHL +Y + Y   G + +      ++LL         K +A   ++++
Sbjct: 2   LVLLLGWLGARPKHLAKYSDLYTRPGPDILVITSPPRDLLWP------TKGLASGLDKLL 55

Query: 65  SWVSHEEQDGKQRCLIFHTFSNTGWFVCGSILASLQGRE---DLMQKIKGLIVDSGGAGA 121
             +S E Q  +   ++FH FSN G  +   +LA+LQ R     L+ ++KG + DS   G 
Sbjct: 56  ELLS-ESQRSEYWPILFHVFSNGGPILYLCLLAALQDRYKFGKLLPRVKGQVWDSA-PGI 113

Query: 122 FDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVSVSMMQDKEPDIIETMLLSLLE 181
                  G F AA+ K    +++ T                             L   + 
Sbjct: 114 GHYHGPVGAFAAALPKLSRVASHKTRA------------------------LLALALRVT 149

Query: 182 KLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTGR 241
            L   I+ LP V    ++ ++ + N P  CP LYLYS  D+VIP++ VE  I+E R+ G 
Sbjct: 150 LLALLILFLPSVASHSRRSLNDLANTPLPCPQLYLYSKADEVIPWRDVERHIDEARQRGV 209

Query: 242 KVFSV 246
            V SV
Sbjct: 210 SVTSV 214

This family consists of several uncharacterized eukaryotic proteins. Length = 240

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 100.0
KOG2521350 consensus Uncharacterized conserved protein [Funct 99.96
PRK05077414 frsA fermentation/respiration switch protein; Revi 98.16
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.1
PRK13604307 luxD acyl transferase; Provisional 98.09
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.06
PRK10566249 esterase; Provisional 98.02
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.0
PRK11460232 putative hydrolase; Provisional 97.91
PHA02857276 monoglyceride lipase; Provisional 97.79
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.78
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 97.73
PLN02511388 hydrolase 97.64
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.58
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.57
PRK10749330 lysophospholipase L2; Provisional 97.54
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.52
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.47
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.39
COG1647243 Esterase/lipase [General function prediction only] 97.38
PLN02652395 hydrolase; alpha/beta fold family protein 97.36
PRK10985324 putative hydrolase; Provisional 97.3
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.23
PLN02298330 hydrolase, alpha/beta fold family protein 97.19
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 97.1
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 97.02
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 96.99
COG0400207 Predicted esterase [General function prediction on 96.96
PLN02442283 S-formylglutathione hydrolase 96.87
TIGR03611257 RutD pyrimidine utilization protein D. This protei 96.78
COG2267298 PldB Lysophospholipase [Lipid metabolism] 96.76
PLN02385349 hydrolase; alpha/beta fold family protein 96.7
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 96.7
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 96.67
PRK03592295 haloalkane dehalogenase; Provisional 96.58
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 96.5
PLN02824294 hydrolase, alpha/beta fold family protein 96.43
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 96.42
PLN02679360 hydrolase, alpha/beta fold family protein 96.36
PRK10162318 acetyl esterase; Provisional 96.32
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 96.32
PRK03204286 haloalkane dehalogenase; Provisional 96.29
PLN02211273 methyl indole-3-acetate methyltransferase 96.29
KOG1838409 consensus Alpha/beta hydrolase [General function p 96.27
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 96.21
PRK10673255 acyl-CoA esterase; Provisional 96.18
PLN02894402 hydrolase, alpha/beta fold family protein 96.1
PRK00870302 haloalkane dehalogenase; Provisional 96.1
PRK11071190 esterase YqiA; Provisional 96.1
PRK10349256 carboxylesterase BioH; Provisional 96.0
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 95.95
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 95.84
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 95.8
KOG2382315 consensus Predicted alpha/beta hydrolase [General 95.77
PLN02965255 Probable pheophorbidase 95.76
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 95.76
PLN02578354 hydrolase 95.52
PRK10115686 protease 2; Provisional 94.83
PRK05855 582 short chain dehydrogenase; Validated 94.66
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 93.81
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 93.23
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 92.88
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 91.05
PF10503220 Esterase_phd: Esterase PHB depolymerase 90.98
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 90.71
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 90.58
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 90.52
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 87.11
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 86.45
PRK06765389 homoserine O-acetyltransferase; Provisional 85.11
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 84.63
PLN02872395 triacylglycerol lipase 84.53
PRK00175379 metX homoserine O-acetyltransferase; Provisional 84.28
COG3208244 GrsT Predicted thioesterase involved in non-riboso 83.94
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 83.46
KOG3043242 consensus Predicted hydrolase related to dienelact 81.43
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information 
Probab=100.00  E-value=4.3e-50  Score=352.03  Aligned_cols=227  Identities=31%  Similarity=0.528  Sum_probs=172.9

Q ss_pred             cEEEEEccCCCchHHHHHHHHHHhhCCcceEEEeecccceeecccchhhhhhHHHHHHHHHHhhcccccCCCCceEEEEe
Q 045563            4 VTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEKRIADLSNEIVSWVSHEEQDGKQRCLIFHT   83 (271)
Q Consensus         4 ~lVvl~gW~ga~~khl~KY~~~Y~~~g~~~l~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~l~~~~~~~~~~~il~H~   83 (271)
                      |||||||||||++|||+||+++|++.|++++++.+++.+++++.      +.++++++.+++.+.+..+. ..++|+||+
T Consensus         1 plvvl~gW~gA~~~hl~KY~~~Y~~~g~~il~~~~~~~~~~~~~------~~~~~~~~~l~~~l~~~~~~-~~~~il~H~   73 (240)
T PF05705_consen    1 PLVVLLGWMGAKPKHLAKYSDLYQDPGFDILLVTSPPADFFWPS------KRLAPAADKLLELLSDSQSA-SPPPILFHS   73 (240)
T ss_pred             CEEEEEeCCCCCHHHHHHHHHHHHhcCCeEEEEeCCHHHHeeec------cchHHHHHHHHHHhhhhccC-CCCCEEEEE
Confidence            79999999999999999999999999999999999999999876      35678888888888765432 235999999


Q ss_pred             cccchHHHHHHHHHHhcCC---CCccCCeeEEEEeCCCCCCCChhhhhhhhhhhhhcccccccccccccCcccccccccc
Q 045563           84 FSNTGWFVCGSILASLQGR---EDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVS  160 (271)
Q Consensus        84 FSnGG~~~~~~l~~~l~~~---~~~~~~i~g~I~DS~Pg~~~~~~~~~~g~~~a~l~~~~~~~~~~~~~~~l~~~~~~~~  160 (271)
                      |||||++++.++++.+++.   +.+.++++|+|||||||.+.. .....+++++ +++...                   
T Consensus        74 FSnGG~~~~~~l~~~~~~~~~~~~~~~~i~g~I~DS~P~~~~~-~~~~~~~~~~-~~~~~~-------------------  132 (240)
T PF05705_consen   74 FSNGGSFLYSQLLEAYQSRKKFGKLLPRIKGIIFDSCPGIPTY-SSSARAFSAA-LPKSSP-------------------  132 (240)
T ss_pred             EECchHHHHHHHHHHHHhcccccccccccceeEEeCCCCcccc-ccHHHHHHHH-cCccch-------------------
Confidence            9999999999999888862   456667999999999998863 1222333333 222100                   


Q ss_pred             cccccCCchHHHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHhhcCCCCCCeEEEecCCCCcCChhHHHHHHHHHHHcC
Q 045563          161 VSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTG  240 (271)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~LyiYS~~D~li~~~~Ve~~~~~~r~~G  240 (271)
                       .+..+..+ .+..+ .... .........+.+....++.++.+...+.++|||||||++|++|+|+|||+|++++|++|
T Consensus       133 -~~~~~~~~-~~~~~-~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lylYS~~D~l~~~~~ve~~~~~~~~~G  208 (240)
T PF05705_consen  133 -RWFVPLWP-LLQFL-LRLS-IISYFIFGYPDVQEYYRRALNDFANSPSRCPRLYLYSKADPLIPWRDVEEHAEEARRKG  208 (240)
T ss_pred             -hhHHHHHH-HHHHH-HHHH-HHHHHHhcCCcHHHHHHHHHhhhhcCCCCCCeEEecCCCCcCcCHHHHHHHHHHHHHcC
Confidence             00000000 11111 1111 11112222455566677778888888889999999999999999999999999999999


Q ss_pred             CcEEEEEcCCCCCCCCcCCccccccccCcC
Q 045563          241 RKVFSVILGHLPTWITSGLSPADTYRSYII  270 (271)
Q Consensus       241 ~~V~~~~f~~S~H~~~~~~~~v~H~r~~p~  270 (271)
                      ++|+.++|+||+|        |+|+|+||+
T Consensus       209 ~~V~~~~f~~S~H--------V~H~r~~p~  230 (240)
T PF05705_consen  209 WDVRAEKFEDSPH--------VAHLRKHPD  230 (240)
T ss_pred             CeEEEecCCCCch--------hhhcccCHH
Confidence            9999999999999        999999996

>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 41.8 bits (97), Expect = 2e-04
 Identities = 33/279 (11%), Positives = 79/279 (28%), Gaps = 95/279 (34%)

Query: 50  RGVEKRIADLSNEIVSWVS---HEEQDGKQRCLIFHTFSNTGWFVCGS--ILASLQ-GRE 103
             V+K + ++      ++      EQ  +Q  ++   +      +     + A     R 
Sbjct: 77  EMVQKFVEEVLRINYKFLMSPIKTEQ--RQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRL 134

Query: 104 DLMQKIK----------GLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKI- 152
               K++           +++D G            G G   +      A       K+ 
Sbjct: 135 QPYLKLRQALLELRPAKNVLID-GV----------LGSGKTWV------ALDVCLSYKVQ 177

Query: 153 NGLEGQVS-VSMMQDKEPDIIETMLLSL----------------------------LEKL 183
             ++ ++  +++     P+ +  ML  L                            L +L
Sbjct: 178 CKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRL 237

Query: 184 F-------SYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDK-----VIPYQSVEL 231
                     ++ L +V  +  K  +A   +   C    L +T  K     +    +  +
Sbjct: 238 LKSKPYENCLLV-LLNV--QNAKAWNAFNLS---CK--ILLTTRFKQVTDFLSAATTTHI 289

Query: 232 LIEEQRKT-----GRKVFSVILGH----LPTWITSGLSP 261
            ++    T      + +    L      LP  + +  +P
Sbjct: 290 SLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTT-NP 327
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.54
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.44
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.31
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.3
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.29
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.27
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.26
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 98.24
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.22
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.21
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.19
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.18
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.18
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.16
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.16
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.15
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.15
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 98.13
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.09
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.09
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.08
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.07
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.07
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.06
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.05
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.04
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.03
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.0
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.99
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.99
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 97.98
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 97.94
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 97.92
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.92
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.92
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 97.91
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 97.9
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 97.9
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 97.9
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 97.82
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.81
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.78
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.78
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.77
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.77
3h04_A275 Uncharacterized protein; protein with unknown func 97.74
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.72
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.72
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.72
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 97.71
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.7
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.68
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 97.66
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.66
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 97.66
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.66
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 97.66
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.66
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.66
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.66
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.65
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 97.65
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 97.64
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 97.64
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.64
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.64
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.63
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.61
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.6
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.59
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.58
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 97.56
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 97.56
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 97.54
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 97.54
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 97.53
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 97.52
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 97.49
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.48
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.48
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 97.47
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.46
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.46
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 97.45
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.44
4fle_A202 Esterase; structural genomics, PSI-biology, northe 97.42
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 97.41
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.38
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.38
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.38
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 97.38
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 97.37
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 97.36
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.36
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.34
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 97.32
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.32
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 97.3
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 97.29
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.29
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.29
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.28
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.25
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 97.21
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.21
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.2
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.19
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 97.17
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.15
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 97.15
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 97.13
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 97.13
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 97.13
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.13
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 97.12
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.11
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.11
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.11
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.1
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.07
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.04
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.04
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.03
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 97.03
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.02
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 96.99
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 96.99
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 96.97
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 96.97
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.95
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 96.95
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.93
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 96.92
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 96.89
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.87
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.86
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 96.85
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 96.84
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 96.84
1iup_A282 META-cleavage product hydrolase; aromatic compound 96.83
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 96.8
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 96.79
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 96.78
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 96.72
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 96.71
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 96.7
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 96.67
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 96.61
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.59
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.52
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 96.46
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 96.45
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 96.38
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 96.25
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 95.97
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 95.92
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 95.75
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.75
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 95.65
3lp5_A250 Putative cell surface hydrolase; structural genom 95.32
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 95.31
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 95.05
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 94.91
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 94.9
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 93.84
3d59_A383 Platelet-activating factor acetylhydrolase; secret 94.8
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 94.48
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 94.47
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 94.29
1kez_A300 Erythronolide synthase; polyketide synthase, modul 93.44
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 93.37
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.24
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 93.09
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 92.88
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 92.83
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 92.48
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 92.47
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 92.09
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 90.1
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 89.9
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 89.63
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 89.02
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 88.6
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 88.12
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 87.47
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 87.13
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 86.4
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 86.22
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 85.89
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 85.88
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 85.7
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 85.52
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 84.92
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 84.71
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 84.62
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 84.19
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 84.05
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 83.75
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 83.71
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 83.3
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 83.3
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 83.02
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 82.96
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 82.95
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 82.94
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 82.72
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 82.67
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 82.33
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 81.63
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 81.62
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 80.46
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 80.04
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
Probab=98.54  E-value=9e-06  Score=67.28  Aligned_cols=204  Identities=13%  Similarity=0.038  Sum_probs=107.1

Q ss_pred             CccEEEEEccCCCchHHHHHHHHHHhhCCcceEEEeecccceeecccchhhhh-hHHHHHHHHHHhhcccccCCCCceEE
Q 045563            2 TAVTVVLLGWLGARRKHLRRYVEWYNSRGINAITFVVEAKELLSFDLGRGVEK-RIADLSNEIVSWVSHEEQDGKQRCLI   80 (271)
Q Consensus         2 ~~~lVvl~gW~ga~~khl~KY~~~Y~~~g~~~l~~~~~~~~~~~~~~g~~~~~-~~~~~~~~i~~~l~~~~~~~~~~~il   80 (271)
                      .+++|++.||.+..... ....+...+.|+.++.+..+..-.....  ..... .....++.+.+.+..-..  ...+++
T Consensus        22 ~~~vv~~HG~~~~~~~~-~~~~~~l~~~G~~v~~~d~~g~g~s~~~--~~~~~~~~~~~~~d~~~~i~~l~~--~~~~~~   96 (251)
T 3dkr_A           22 DTGVVLLHAYTGSPNDM-NFMARALQRSGYGVYVPLFSGHGTVEPL--DILTKGNPDIWWAESSAAVAHMTA--KYAKVF   96 (251)
T ss_dssp             SEEEEEECCTTCCGGGG-HHHHHHHHHTTCEEEECCCTTCSSSCTH--HHHHHCCHHHHHHHHHHHHHHHHT--TCSEEE
T ss_pred             CceEEEeCCCCCCHHHH-HHHHHHHHHCCCEEEecCCCCCCCCChh--hhcCcccHHHHHHHHHHHHHHHHH--hcCCeE
Confidence            45788889988777644 7788888889999988776543111000  00001 222233333333222111  156999


Q ss_pred             EEecccchHHHHHHHHHHhcCCCCccCCeeEEEEeCCCCCCCChhhhhhhhhhhhhcccccccccccccCcccccccccc
Q 045563           81 FHTFSNTGWFVCGSILASLQGREDLMQKIKGLIVDSGGAGAFDPKVWAGGFGAAILKKRSSSAYSTVEDGKINGLEGQVS  160 (271)
Q Consensus        81 ~H~FSnGG~~~~~~l~~~l~~~~~~~~~i~g~I~DS~Pg~~~~~~~~~~g~~~a~l~~~~~~~~~~~~~~~l~~~~~~~~  160 (271)
                      +-.+|.||...+... ..   +   ...++++|+.+.+....... +.. . ..+...... ..         +      
T Consensus        97 l~G~S~Gg~~a~~~a-~~---~---p~~~~~~i~~~p~~~~~~~~-~~~-~-~~~~~~~~~-~~---------~------  150 (251)
T 3dkr_A           97 VFGLSLGGIFAMKAL-ET---L---PGITAGGVFSSPILPGKHHL-VPG-F-LKYAEYMNR-LA---------G------  150 (251)
T ss_dssp             EEESHHHHHHHHHHH-HH---C---SSCCEEEESSCCCCTTCBCH-HHH-H-HHHHHHHHH-HH---------T------
T ss_pred             EEEechHHHHHHHHH-Hh---C---ccceeeEEEecchhhccchh-hHH-H-HHHHHHHHh-hc---------c------
Confidence            999999996554322 22   2   23678888877665532111 111 0 111000000 00         0      


Q ss_pred             cccccCCchHHHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHhhcCCCCCCeEEEecCCCCcCChhHHHHHHHHHHHcC
Q 045563          161 VSMMQDKEPDIIETMLLSLLEKLFSYIINLPDVNQRIKKVVSAVTNNPPACPHLYLYSTGDKVIPYQSVELLIEEQRKTG  240 (271)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~LyiYS~~D~li~~~~Ve~~~~~~r~~G  240 (271)
                         ..+ ....+.......    +.      .......+....+.+  ..+|.|+++++.|.++|.+..+++.+...+. 
T Consensus       151 ---~~~-~~~~~~~~~~~~----~~------~~~~~~~~~~~~~~~--~~~P~l~i~g~~D~~~~~~~~~~~~~~~~~~-  213 (251)
T 3dkr_A          151 ---KSD-ESTQILAYLPGQ----LA------AIDQFATTVAADLNL--VKQPTFIGQAGQDELVDGRLAYQLRDALINA-  213 (251)
T ss_dssp             ---CCC-CHHHHHHHHHHH----HH------HHHHHHHHHHHTGGG--CCSCEEEEEETTCSSBCTTHHHHHHHHCTTC-
T ss_pred             ---cCc-chhhHHhhhHHH----HH------HHHHHHHHHhccccc--cCCCEEEEecCCCcccChHHHHHHHHHhcCC-
Confidence               000 000011000000    00      011111112222332  3689999999999999999999988776654 


Q ss_pred             CcEEEEEcCCCCC
Q 045563          241 RKVFSVILGHLPT  253 (271)
Q Consensus       241 ~~V~~~~f~~S~H  253 (271)
                      .+++.+.++++.|
T Consensus       214 ~~~~~~~~~~~gH  226 (251)
T 3dkr_A          214 ARVDFHWYDDAKH  226 (251)
T ss_dssp             SCEEEEEETTCCS
T ss_pred             CCceEEEeCCCCc
Confidence            5788899999999
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 98.46
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.33
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.3
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.26
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.1
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.09
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.06
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.06
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 98.0
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.89
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.89
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.83
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.82
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 97.78
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.74
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 97.73
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 97.67
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.65
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.64
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 97.61
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.6
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.56
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.53
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.48
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 97.45
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.41
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.4
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.34
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.3
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 97.25
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 97.24
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 97.16
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.15
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 96.9
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.9
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 96.9
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 96.81
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 96.69
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 96.55
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 96.48
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 96.45
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 96.35
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 96.28
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 96.06
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 95.82
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 95.82
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 95.57
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 94.94
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 94.67
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 94.22
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 94.11
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 94.0
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 93.93
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 92.83
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 91.16
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 90.89
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 90.61
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 90.24
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 89.89
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 87.87
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 82.39
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 82.27
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 81.1
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 80.23
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase/lipase
domain: Carboxylesterase Est
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=98.46  E-value=4.6e-06  Score=65.83  Aligned_cols=51  Identities=12%  Similarity=0.012  Sum_probs=41.2

Q ss_pred             CCCCeEEEecCCCCcCChhHHHHHHHHHHHcCCcEEEEEcCCCCCCCCcCCccccccccCc
Q 045563          209 PACPHLYLYSTGDKVIPYQSVELLIEEQRKTGRKVFSVILGHLPTWITSGLSPADTYRSYI  269 (271)
Q Consensus       209 ~~~p~LyiYS~~D~li~~~~Ve~~~~~~r~~G~~V~~~~f~~S~H~~~~~~~~v~H~r~~p  269 (271)
                      ..+|.|+++++.|.++|.+..+++.+..+  +-+++.+.++++.|        .-|+-.+|
T Consensus       176 ~~~p~lii~g~~D~~~~~~~~~~~~~~~~--~~~~~~~~~~~~gH--------~~~~~~~~  226 (242)
T d1tqha_         176 IYAPTFVVQARHDEMINPDSANIIYNEIE--SPVKQIKWYEQSGH--------VITLDQEK  226 (242)
T ss_dssp             CCSCEEEEEETTCSSSCTTHHHHHHHHCC--CSSEEEEEETTCCS--------SGGGSTTH
T ss_pred             eccccceeecccCCccCHHHHHHHHHHcC--CCCcEEEEECCCCC--------cCccccCH
Confidence            46899999999999999999998876543  44688899999999        66665444
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure