Citrus Sinensis ID: 045566
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 112 | ||||||
| 225447856 | 350 | PREDICTED: rae1-like protein At1g80670 [ | 1.0 | 0.32 | 0.964 | 7e-60 | |
| 255572775 | 349 | plant poly(A)+ RNA export protein, putat | 1.0 | 0.320 | 0.946 | 8e-59 | |
| 356525894 | 347 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.322 | 0.928 | 6e-58 | |
| 116783044 | 349 | unknown [Picea sitchensis] | 1.0 | 0.320 | 0.901 | 8e-58 | |
| 225443109 | 345 | PREDICTED: rae1-like protein At1g80670 [ | 1.0 | 0.324 | 0.919 | 1e-57 | |
| 255631778 | 198 | unknown [Glycine max] | 1.0 | 0.565 | 0.928 | 1e-57 | |
| 356558620 | 347 | PREDICTED: rae1-like protein At1g80670-l | 1.0 | 0.322 | 0.910 | 2e-57 | |
| 147765521 | 197 | hypothetical protein VITISV_035178 [Viti | 1.0 | 0.568 | 0.919 | 4e-57 | |
| 357445765 | 351 | RNA export [Medicago truncatula] gi|3554 | 1.0 | 0.319 | 0.883 | 4e-57 | |
| 363806810 | 347 | uncharacterized protein LOC100819240 [Gl | 1.0 | 0.322 | 0.892 | 8e-57 |
| >gi|225447856|ref|XP_002271645.1| PREDICTED: rae1-like protein At1g80670 [Vitis vinifera] gi|296081523|emb|CBI20046.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 234 bits (596), Expect = 7e-60, Method: Compositional matrix adjust.
Identities = 108/112 (96%), Positives = 111/112 (99%)
Query: 1 VLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEVAWIPEMNLLATGSW 60
VLCS WKDDGTTVFSGGCDKQVKMWPLLSGGQP+TVAMHDAPIKEVAWIPEMNLLATGSW
Sbjct: 76 VLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQPMTVAMHDAPIKEVAWIPEMNLLATGSW 135
Query: 61 DKTLKYWDTRQPNPVHTQQLPDRCYALTVRYPLMVVGTADRNLVVFNLQNPQ 112
DKTLKYWDTRQPNPVHTQQLPDRCYALTVR+PLMVVGTADRNL+VFNLQNPQ
Sbjct: 136 DKTLKYWDTRQPNPVHTQQLPDRCYALTVRHPLMVVGTADRNLIVFNLQNPQ 187
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255572775|ref|XP_002527320.1| plant poly(A)+ RNA export protein, putative [Ricinus communis] gi|223533320|gb|EEF35072.1| plant poly(A)+ RNA export protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356525894|ref|XP_003531556.1| PREDICTED: uncharacterized protein LOC100527204 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|116783044|gb|ABK22773.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|225443109|ref|XP_002274315.1| PREDICTED: rae1-like protein At1g80670 [Vitis vinifera] gi|297743618|emb|CBI36485.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255631778|gb|ACU16256.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356558620|ref|XP_003547602.1| PREDICTED: rae1-like protein At1g80670-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147765521|emb|CAN60438.1| hypothetical protein VITISV_035178 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357445765|ref|XP_003593160.1| RNA export [Medicago truncatula] gi|355482208|gb|AES63411.1| RNA export [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|363806810|ref|NP_001242030.1| uncharacterized protein LOC100819240 [Glycine max] gi|255638763|gb|ACU19686.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 112 | ||||||
| TAIR|locus:2025732 | 349 | RAE1 "AT1G80670" [Arabidopsis | 1.0 | 0.320 | 0.866 | 2.4e-53 | |
| UNIPROTKB|P78406 | 368 | RAE1 "mRNA export factor" [Hom | 0.973 | 0.296 | 0.526 | 1e-29 | |
| UNIPROTKB|Q5E9A4 | 368 | RAE1 "mRNA export factor" [Bos | 0.973 | 0.296 | 0.535 | 1.6e-29 | |
| UNIPROTKB|E2RSV2 | 368 | RAE1 "Uncharacterized protein" | 0.973 | 0.296 | 0.526 | 2.1e-29 | |
| UNIPROTKB|A5GFN6 | 368 | RAE1 "mRNA export factor" [Sus | 0.973 | 0.296 | 0.526 | 2.1e-29 | |
| MGI|MGI:1913929 | 368 | Rae1 "RAE1 RNA export 1 homolo | 0.973 | 0.296 | 0.526 | 2.1e-29 | |
| RGD|1311540 | 368 | Rae1 "RAE1 RNA export 1 homolo | 0.973 | 0.296 | 0.526 | 2.1e-29 | |
| UNIPROTKB|E1BVV3 | 214 | Gga.22300 "Uncharacterized pro | 0.973 | 0.509 | 0.517 | 2.1e-29 | |
| UNIPROTKB|E1C7F8 | 368 | Gga.22300 "Uncharacterized pro | 0.973 | 0.296 | 0.517 | 2.1e-29 | |
| FB|FBgn0034646 | 360 | Rae1 "Rae1" [Drosophila melano | 0.973 | 0.302 | 0.544 | 2.1e-29 |
| TAIR|locus:2025732 RAE1 "AT1G80670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 552 (199.4 bits), Expect = 2.4e-53, P = 2.4e-53
Identities = 97/112 (86%), Positives = 104/112 (92%)
Query: 1 VLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEVAWIPEMNLLATGSW 60
VLCS WKDDGTTVFSGGCDKQ KMWPLLSGGQPVTVAMH+ PI +AWIP MNLLATGSW
Sbjct: 75 VLCSAWKDDGTTVFSGGCDKQAKMWPLLSGGQPVTVAMHEGPIAAMAWIPGMNLLATGSW 134
Query: 61 DKTLKYWDTRQPNPVHTQQLPDRCYALTVRYPLMVVGTADRNLVVFNLQNPQ 112
DKTLKYWDTRQ NPVHTQQLPD+CY L+V++PLMVVGTADRNL+VFNLQNPQ
Sbjct: 135 DKTLKYWDTRQQNPVHTQQLPDKCYTLSVKHPLMVVGTADRNLIVFNLQNPQ 186
|
|
| UNIPROTKB|P78406 RAE1 "mRNA export factor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5E9A4 RAE1 "mRNA export factor" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RSV2 RAE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5GFN6 RAE1 "mRNA export factor" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913929 Rae1 "RAE1 RNA export 1 homolog (S. pombe)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1311540 Rae1 "RAE1 RNA export 1 homolog (S. pombe)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVV3 Gga.22300 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7F8 Gga.22300 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034646 Rae1 "Rae1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00031579001 | SubName- Full=Chromosome chr12 scaffold_57, whole genome shotgun sequence; (350 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00000457001 | • | • | 0.829 | ||||||||
| GSVIVG00014166001 | • | 0.488 | |||||||||
| GSVIVG00030682001 | • | • | 0.473 | ||||||||
| GSVIVG00000022001 | • | • | 0.464 | ||||||||
| GSVIVG00025117001 | • | 0.464 | |||||||||
| GSVIVG00020679001 | • | • | 0.463 | ||||||||
| GSVIVG00003115001 | • | 0.462 | |||||||||
| GSVIVG00003105001 | • | 0.456 | |||||||||
| GSVIVG00017915001 | • | 0.452 | |||||||||
| GSVIVG00001683001 | • | 0.449 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 112 | |||
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 6e-14 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 1e-13 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 5e-13 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 4e-12 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 2e-11 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 3e-11 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 2e-10 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 2e-09 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 2e-07 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 8e-07 | |
| pfam00400 | 39 | pfam00400, WD40, WD domain, G-beta repeat | 8e-07 | |
| smart00320 | 40 | smart00320, WD40, WD40 repeats | 9e-07 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 4e-05 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 8e-04 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
Score = 65.4 bits (160), Expect = 6e-14
Identities = 25/77 (32%), Positives = 40/77 (51%)
Query: 1 VLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEVAWIPEMNLLATGSW 60
V DGT + SG DK +++W L +G T+ H + + VA+ P+ +L++ S
Sbjct: 54 VRDVAASADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSR 113
Query: 61 DKTLKYWDTRQPNPVHT 77
DKT+K WD + T
Sbjct: 114 DKTIKVWDVETGKCLTT 130
|
Length = 289 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197651 smart00320, WD40, WD40 repeats | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 112 | |||
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.95 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.95 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.95 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.94 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.94 | |
| PTZ00421 | 493 | coronin; Provisional | 99.94 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.93 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.93 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.93 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.93 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.92 | |
| PTZ00420 | 568 | coronin; Provisional | 99.92 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.91 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.91 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.91 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.91 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 99.9 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.9 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.9 | |
| PTZ00421 | 493 | coronin; Provisional | 99.9 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.9 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.9 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.89 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.89 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.89 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.88 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.88 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.88 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 99.88 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 99.88 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.88 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 99.88 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 99.88 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.87 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 99.87 | |
| PTZ00420 | 568 | coronin; Provisional | 99.87 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 99.87 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.87 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.87 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 99.87 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.86 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 99.86 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.86 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.86 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.86 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.85 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 99.85 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 99.85 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 99.85 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.84 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 99.84 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.84 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.84 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 99.84 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.84 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 99.84 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.83 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 99.83 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.83 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 99.83 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.83 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.83 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.82 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.82 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.82 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 99.82 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.82 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 99.82 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.82 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 99.82 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 99.81 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.81 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 99.8 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 99.8 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 99.8 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 99.8 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 99.8 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 99.79 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 99.79 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 99.79 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 99.79 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 99.78 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.78 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 99.78 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.78 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 99.78 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 99.78 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 99.78 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 99.77 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 99.77 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 99.77 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 99.77 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 99.76 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 99.76 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 99.76 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 99.76 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 99.76 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 99.76 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 99.76 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 99.75 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 99.75 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 99.74 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 99.74 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 99.74 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 99.73 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 99.73 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 99.73 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 99.73 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 99.73 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 99.73 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 99.73 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 99.72 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 99.72 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 99.72 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 99.72 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 99.71 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 99.71 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 99.71 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 99.7 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 99.7 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 99.7 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 99.7 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 99.7 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 99.69 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 99.68 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 99.68 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 99.68 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 99.68 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 99.67 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 99.67 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 99.67 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 99.67 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.67 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 99.67 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 99.66 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 99.65 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 99.65 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 99.65 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 99.64 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 99.64 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 99.63 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 99.63 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 99.63 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 99.63 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 99.63 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 99.62 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 99.62 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 99.62 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 99.61 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 99.61 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 99.61 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 99.61 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 99.61 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 99.6 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 99.6 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 99.59 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 99.58 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 99.58 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 99.58 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 99.57 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 99.57 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 99.57 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 99.56 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 99.56 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 99.56 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 99.56 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 99.55 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 99.55 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 99.55 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 99.55 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 99.55 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 99.55 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 99.54 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 99.53 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 99.53 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 99.53 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 99.53 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 99.53 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 99.52 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 99.51 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 99.51 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 99.5 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 99.5 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 99.5 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 99.5 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 99.48 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 99.44 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 99.43 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 99.42 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 99.41 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 99.41 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 99.4 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 99.39 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 99.39 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 99.39 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 99.35 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 99.35 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 99.35 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 99.34 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 99.33 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 99.33 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 99.32 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 99.31 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 99.29 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 99.29 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 99.29 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 99.28 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 99.27 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 99.26 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 99.26 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 99.26 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 99.26 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 99.26 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 99.25 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 99.25 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 99.25 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 99.23 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 99.21 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 99.21 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 99.21 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 99.19 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 99.19 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 99.18 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 99.17 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 99.17 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 99.17 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 99.16 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 99.15 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 99.11 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 99.1 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 99.09 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 99.09 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 99.08 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 99.08 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 99.08 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 99.07 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 99.04 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 99.04 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 99.04 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 99.04 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 99.0 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.99 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 98.99 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 98.99 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 98.96 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 98.95 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 98.94 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 98.91 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.91 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 98.91 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 98.87 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 98.87 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 98.86 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 98.86 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 98.85 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 98.85 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 98.85 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 98.84 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 98.83 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 98.83 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 98.82 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 98.8 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 98.8 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 98.79 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 98.78 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 98.77 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 98.76 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 98.75 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 98.74 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 98.74 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 98.69 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 98.65 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 98.64 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 98.61 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 98.61 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 98.6 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 98.58 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 98.58 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 98.57 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.55 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 98.55 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 98.53 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 98.51 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 98.49 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 98.48 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 98.47 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 98.47 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 98.46 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 98.45 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 98.44 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 98.43 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 98.41 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 98.4 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 98.38 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 98.36 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 98.33 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 98.33 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 98.33 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 98.3 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 98.29 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 98.27 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 98.25 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 98.24 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 98.23 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 98.19 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 98.17 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 98.15 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 98.15 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 98.13 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 98.09 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 98.06 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 98.05 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 98.03 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 97.92 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 97.88 | |
| KOG4649 | 354 | consensus PQQ (pyrrolo-quinoline quinone) repeat p | 97.87 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 97.87 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 97.86 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 97.85 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 97.85 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 97.84 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 97.79 | |
| KOG4649 | 354 | consensus PQQ (pyrrolo-quinoline quinone) repeat p | 97.78 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 97.77 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 97.77 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 97.69 | |
| PF08596 | 395 | Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; | 97.68 | |
| KOG1008 | 783 | consensus Uncharacterized conserved protein, conta | 97.65 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 97.64 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 97.64 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 97.61 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 97.59 | |
| PRK13616 | 591 | lipoprotein LpqB; Provisional | 97.58 | |
| PF05096 | 264 | Glu_cyclase_2: Glutamine cyclotransferase; InterPr | 97.58 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 97.57 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 97.56 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 97.52 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 97.5 | |
| PF00780 | 275 | CNH: CNH domain; InterPro: IPR001180 Based on sequ | 97.46 | |
| KOG2444 | 238 | consensus WD40 repeat protein [General function pr | 97.42 | |
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 97.4 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 97.4 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 97.39 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 97.38 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 97.37 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 97.35 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 97.32 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 97.31 | |
| KOG1008 | 783 | consensus Uncharacterized conserved protein, conta | 97.26 | |
| PF14655 | 415 | RAB3GAP2_N: Rab3 GTPase-activating protein regulat | 97.24 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 97.16 | |
| PF00930 | 353 | DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin | 97.1 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 97.1 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 96.92 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 96.91 | |
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 96.89 | |
| cd00216 | 488 | PQQ_DH Dehydrogenases with pyrrolo-quinoline quino | 96.88 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 96.75 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 96.73 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 96.72 | |
| PF02897 | 414 | Peptidase_S9_N: Prolyl oligopeptidase, N-terminal | 96.65 | |
| PF06433 | 342 | Me-amine-dh_H: Methylamine dehydrogenase heavy cha | 96.6 | |
| cd00216 | 488 | PQQ_DH Dehydrogenases with pyrrolo-quinoline quino | 96.6 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 96.53 | |
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 96.48 | |
| KOG2395 | 644 | consensus Protein involved in vacuole import and d | 96.47 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 96.46 | |
| PF07569 | 219 | Hira: TUP1-like enhancer of split; InterPro: IPR01 | 96.3 | |
| PF06433 | 342 | Me-amine-dh_H: Methylamine dehydrogenase heavy cha | 96.27 | |
| PRK13616 | 591 | lipoprotein LpqB; Provisional | 96.24 | |
| KOG2444 | 238 | consensus WD40 repeat protein [General function pr | 96.22 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 96.1 | |
| PF11715 | 547 | Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 | 96.03 | |
| PF12234 | 631 | Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 | 96.01 | |
| PF03178 | 321 | CPSF_A: CPSF A subunit region; InterPro: IPR004871 | 95.93 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 95.92 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 95.88 | |
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 95.72 | |
| PF15390 | 671 | DUF4613: Domain of unknown function (DUF4613) | 95.69 | |
| KOG2395 | 644 | consensus Protein involved in vacuole import and d | 95.66 | |
| PF07569 | 219 | Hira: TUP1-like enhancer of split; InterPro: IPR01 | 95.65 | |
| COG3823 | 262 | Glutamine cyclotransferase [Posttranslational modi | 95.37 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 95.35 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 95.15 | |
| KOG4499 | 310 | consensus Ca2+-binding protein Regucalcin/SMP30 [I | 95.12 | |
| COG3490 | 366 | Uncharacterized protein conserved in bacteria [Fun | 95.06 | |
| PF14655 | 415 | RAB3GAP2_N: Rab3 GTPase-activating protein regulat | 94.92 | |
| PF14870 | 302 | PSII_BNR: Photosynthesis system II assembly factor | 94.88 | |
| PF04841 | 410 | Vps16_N: Vps16, N-terminal region; InterPro: IPR00 | 94.85 | |
| PF14583 | 386 | Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C | 94.7 | |
| COG5167 | 776 | VID27 Protein involved in vacuole import and degra | 94.59 | |
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 94.22 | |
| PF14269 | 299 | Arylsulfotran_2: Arylsulfotransferase (ASST) | 94.15 | |
| PRK10115 | 686 | protease 2; Provisional | 94.08 | |
| TIGR03074 | 764 | PQQ_membr_DH membrane-bound PQQ-dependent dehydrog | 93.97 | |
| PF11715 | 547 | Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 | 93.85 | |
| PF05694 | 461 | SBP56: 56kDa selenium binding protein (SBP56); Int | 93.82 | |
| KOG3630 | 1405 | consensus Nuclear pore complex, Nup214/CAN compone | 93.8 | |
| TIGR03075 | 527 | PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan | 93.79 | |
| PF12657 | 173 | TFIIIC_delta: Transcription factor IIIC subunit de | 93.68 | |
| TIGR02276 | 42 | beta_rpt_yvtn 40-residue YVTN family beta-propelle | 93.57 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 93.34 | |
| TIGR03075 | 527 | PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan | 93.25 | |
| KOG1916 | 1283 | consensus Nuclear protein, contains WD40 repeats [ | 93.08 | |
| KOG3630 | 1405 | consensus Nuclear pore complex, Nup214/CAN compone | 93.02 | |
| PF00930 | 353 | DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin | 92.99 | |
| smart00564 | 33 | PQQ beta-propeller repeat. Beta-propeller repeat o | 92.91 | |
| KOG4499 | 310 | consensus Ca2+-binding protein Regucalcin/SMP30 [I | 92.73 | |
| PF15390 | 671 | DUF4613: Domain of unknown function (DUF4613) | 92.67 | |
| PF03178 | 321 | CPSF_A: CPSF A subunit region; InterPro: IPR004871 | 92.46 | |
| PF01011 | 38 | PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 | 92.18 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 92.18 | |
| PF00780 | 275 | CNH: CNH domain; InterPro: IPR001180 Based on sequ | 92.03 | |
| PF08596 | 395 | Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; | 91.97 | |
| KOG2377 | 657 | consensus Uncharacterized conserved protein [Funct | 91.83 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 91.65 | |
| KOG4441 | 571 | consensus Proteins containing BTB/POZ and Kelch do | 91.49 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 91.39 | |
| PF10647 | 253 | Gmad1: Lipoprotein LpqB beta-propeller domain; Int | 91.33 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 91.33 | |
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 91.32 | |
| COG5276 | 370 | Uncharacterized conserved protein [Function unknow | 91.14 | |
| COG5167 | 776 | VID27 Protein involved in vacuole import and degra | 91.11 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 91.1 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.06 | |
| KOG2377 | 657 | consensus Uncharacterized conserved protein [Funct | 90.95 | |
| PF14781 | 136 | BBS2_N: Ciliary BBSome complex subunit 2, N-termin | 90.73 | |
| PF14761 | 215 | HPS3_N: Hermansky-Pudlak syndrome 3 | 90.67 | |
| PF13570 | 40 | PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. | 90.57 | |
| COG3490 | 366 | Uncharacterized protein conserved in bacteria [Fun | 90.51 | |
| PF04841 | 410 | Vps16_N: Vps16, N-terminal region; InterPro: IPR00 | 90.35 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 89.75 | |
| PF14583 | 386 | Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C | 89.72 | |
| TIGR03118 | 336 | PEPCTERM_chp_1 conserved hypothetical protein TIGR | 89.31 | |
| PF14779 | 257 | BBS1: Ciliary BBSome complex subunit 1 | 89.08 | |
| PF08728 | 717 | CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans | 89.01 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 88.78 | |
| COG1520 | 370 | FOG: WD40-like repeat [Function unknown] | 88.76 | |
| PF14727 | 418 | PHTB1_N: PTHB1 N-terminus | 88.74 | |
| PF02897 | 414 | Peptidase_S9_N: Prolyl oligopeptidase, N-terminal | 88.46 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 87.69 | |
| PF14269 | 299 | Arylsulfotran_2: Arylsulfotransferase (ASST) | 86.85 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 86.82 | |
| KOG2247 | 615 | consensus WD40 repeat-containing protein [General | 86.78 | |
| PF08728 | 717 | CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans | 86.7 | |
| PF10214 | 765 | Rrn6: RNA polymerase I-specific transcription-init | 86.3 | |
| PF12657 | 173 | TFIIIC_delta: Transcription factor IIIC subunit de | 85.43 | |
| PRK13684 | 334 | Ycf48-like protein; Provisional | 85.3 | |
| PF10214 | 765 | Rrn6: RNA polymerase I-specific transcription-init | 84.56 | |
| KOG1897 | 1096 | consensus Damage-specific DNA binding complex, sub | 83.73 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 83.41 | |
| KOG1900 | 1311 | consensus Nuclear pore complex, Nup155 component ( | 82.99 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 82.87 | |
| COG4257 | 353 | Vgb Streptogramin lyase [Defense mechanisms] | 82.76 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 82.52 | |
| PRK10115 | 686 | protease 2; Provisional | 81.95 | |
| COG4590 | 733 | ABC-type uncharacterized transport system, permeas | 81.11 |
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
Probab=99.95 E-value=8.7e-28 Score=138.15 Aligned_cols=111 Identities=20% Similarity=0.353 Sum_probs=99.3
Q ss_pred CeeEEEcCCCCEEEEEcCCCcEEEEEcCCCCCcEEEeeccCCeeEEEEccCCCEEEEeeCCCcEEEeeCCCCCce----E
Q 045566 1 VLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEVAWIPEMNLLATGSWDKTLKYWDTRQPNPV----H 76 (112)
Q Consensus 1 v~~~~~~~~~~~l~~~~~~~~v~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~i~~w~~~~~~~~----~ 76 (112)
|.|++|+|+|..|++|+.|.++++||+.+..+..++++|..-|.|++|+|||+.+++|+.||.|++||.++++.+ .
T Consensus 118 Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~~~g~~l~ 197 (480)
T KOG0271|consen 118 VLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQQIGRALR 197 (480)
T ss_pred EEEEEecCCCceEEecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCCCccccccc
Confidence 578999999999999999999999999999999999999999999999999999999999999999999887654 3
Q ss_pred EecCCCeEEEEee-----CCCEEEEEeCCCcEEEEECcCC
Q 045566 77 TQQLPDRCYALTV-----RYPLMVVGTADRNLVVFNLQNP 111 (112)
Q Consensus 77 ~~~~~~~~~~~~~-----~~~~~~~~~~d~~v~~~d~~~~ 111 (112)
.+...+.+++|.| ..+.+++++.||.++|||+.-+
T Consensus 198 gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~ 237 (480)
T KOG0271|consen 198 GHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLG 237 (480)
T ss_pred CcccceeEEeecccccCCCccceecccCCCCEEEEEccCc
Confidence 4455667788876 4568999999999999998754
|
|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals | Back alignment and domain information |
|---|
| >KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >PRK13616 lipoprotein LpqB; Provisional | Back alignment and domain information |
|---|
| >PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase | Back alignment and domain information |
|---|
| >KOG2444 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin | Back alignment and domain information |
|---|
| >PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK13616 lipoprotein LpqB; Provisional | Back alignment and domain information |
|---|
| >KOG2444 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates | Back alignment and domain information |
|---|
| >PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length | Back alignment and domain information |
|---|
| >PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >PF15390 DUF4613: Domain of unknown function (DUF4613) | Back alignment and domain information |
|---|
| >KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin | Back alignment and domain information |
|---|
| >COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3490 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus | Back alignment and domain information |
|---|
| >PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A | Back alignment and domain information |
|---|
| >PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A | Back alignment and domain information |
|---|
| >COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family | Back alignment and domain information |
|---|
| >PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates | Back alignment and domain information |
|---|
| >PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea | Back alignment and domain information |
|---|
| >KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family | Back alignment and domain information |
|---|
| >PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) | Back alignment and domain information |
|---|
| >TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family | Back alignment and domain information |
|---|
| >KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >smart00564 PQQ beta-propeller repeat | Back alignment and domain information |
|---|
| >KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15390 DUF4613: Domain of unknown function (DUF4613) | Back alignment and domain information |
|---|
| >PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit | Back alignment and domain information |
|---|
| >PF01011 PQQ: PQQ enzyme repeat family | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase | Back alignment and domain information |
|---|
| >PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals | Back alignment and domain information |
|---|
| >KOG2377 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >COG5276 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG2377 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal | Back alignment and domain information |
|---|
| >PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 | Back alignment and domain information |
|---|
| >PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A | Back alignment and domain information |
|---|
| >COG3490 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A | Back alignment and domain information |
|---|
| >TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 | Back alignment and domain information |
|---|
| >PF14779 BBS1: Ciliary BBSome complex subunit 1 | Back alignment and domain information |
|---|
| >PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >COG1520 FOG: WD40-like repeat [Function unknown] | Back alignment and domain information |
|---|
| >PF14727 PHTB1_N: PTHB1 N-terminus | Back alignment and domain information |
|---|
| >PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2247 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] | Back alignment and domain information |
|---|
| >PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] | Back alignment and domain information |
|---|
| >PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) | Back alignment and domain information |
|---|
| >PRK13684 Ycf48-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] | Back alignment and domain information |
|---|
| >KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG4257 Vgb Streptogramin lyase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 112 | ||||
| 3mmy_A | 368 | Structural And Functional Analysis Of The Interacti | 5e-30 | ||
| 2h9l_A | 329 | Wdr5delta23 Length = 329 | 1e-07 | ||
| 2h68_A | 312 | Histone H3 Recognition And Presentation By The Wdr5 | 1e-07 | ||
| 2g9a_A | 311 | Structural Basis For The Specific Recognition Of Me | 1e-07 | ||
| 3smr_A | 312 | Crystal Structure Of Human Wd Repeat Domain 5 With | 1e-07 | ||
| 2g99_A | 308 | Structural Basis For The Specific Recognition Of Me | 1e-07 | ||
| 3n0d_A | 315 | Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 | 2e-07 | ||
| 2h9m_A | 313 | Wdr5 In Complex With Unmodified H3k4 Peptide Length | 2e-07 | ||
| 3psl_A | 318 | Fine-Tuning The Stimulation Of Mll1 Methyltransfera | 2e-07 | ||
| 3n0e_A | 315 | Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 | 2e-07 | ||
| 2h13_A | 317 | Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length | 2e-07 | ||
| 2co0_A | 315 | Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs | 2e-07 | ||
| 3emh_A | 318 | Structural Basis Of Wdr5-Mll Interaction Length = 3 | 2e-07 | ||
| 2cnx_A | 315 | Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. | 2e-07 | ||
| 4a7j_A | 318 | Symmetric Dimethylation Of H3 Arginine 2 Is A Novel | 2e-07 | ||
| 2xl2_A | 334 | Wdr5 In Complex With An Rbbp5 Peptide Recruited To | 2e-07 | ||
| 2gnq_A | 336 | Structure Of Wdr5 Length = 336 | 2e-07 | ||
| 4aez_A | 401 | Crystal Structure Of Mitotic Checkpoint Complex Len | 2e-07 | ||
| 3mxx_A | 315 | Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 | 3e-07 | ||
| 2pbi_B | 354 | The Multifunctional Nature Of Gbeta5RGS9 REVEALED F | 4e-06 | ||
| 2ovp_B | 445 | Structure Of The Skp1-Fbw7 Complex Length = 445 | 5e-05 | ||
| 3sn6_B | 351 | Crystal Structure Of The Beta2 Adrenergic Receptor- | 7e-05 | ||
| 1a0r_B | 340 | Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- | 7e-05 | ||
| 1got_B | 340 | Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer | 7e-05 | ||
| 2bcj_B | 340 | Crystal Structure Of G Protein-coupled Receptor Kin | 7e-05 | ||
| 1gg2_B | 340 | G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet | 7e-05 | ||
| 2zkq_a | 317 | Structure Of A Mammalian Ribosomal 40s Subunit With | 1e-04 | ||
| 4aow_A | 340 | Crystal Structure Of The Human Rack1 Protein At A R | 1e-04 | ||
| 4ggd_A | 431 | Structural Analysis Of Human Cdc20 Supports Multisi | 1e-04 | ||
| 4gga_A | 420 | Structural Analysis Of Human Cdc20 Supports Multi-S | 1e-04 | ||
| 3acp_A | 417 | Crystal Structure Of Yeast Rpn14, A Chaperone Of Th | 1e-04 | ||
| 3vl1_A | 420 | Crystal Structure Of Yeast Rpn14 Length = 420 | 1e-04 | ||
| 2ymu_A | 577 | Structure Of A Highly Repetitive Propeller Structur | 2e-04 | ||
| 4ggc_A | 318 | Structural Analysis Of Human Cdc20 Supports Multi-S | 4e-04 | ||
| 3izb_a | 319 | Localization Of The Small Subunit Ribosomal Protein | 5e-04 | ||
| 3rfg_A | 319 | Crystal Structure Of The Yeast Rack1 Dimer In Space | 5e-04 | ||
| 3rfh_A | 319 | Crystal Structure Of The Yeast Rack1 Dimer In Space | 5e-04 | ||
| 1trj_A | 314 | Homology Model Of Yeast Rack1 Protein Fitted Into 1 | 5e-04 | ||
| 3ow8_A | 321 | Crystal Structure Of The Wd Repeat-Containing Prote | 5e-04 | ||
| 3sfz_A | 1249 | Crystal Structure Of Full-Length Murine Apaf-1 Leng | 5e-04 | ||
| 3shf_A | 1256 | Crystal Structure Of The R265s Mutant Of Full-Lengt | 5e-04 | ||
| 3jyv_R | 313 | Structure Of The 40s Rrna And Proteins And PE TRNA | 5e-04 | ||
| 3frx_A | 319 | Crystal Structure Of The Yeast Orthologue Of Rack1, | 6e-04 | ||
| 1erj_A | 393 | Crystal Structure Of The C-Terminal Wd40 Domain Of | 8e-04 |
| >pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 | Back alignment and structure |
|
| >pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 | Back alignment and structure |
| >pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 | Back alignment and structure |
| >pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 | Back alignment and structure |
| >pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 | Back alignment and structure |
| >pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 | Back alignment and structure |
| >pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 | Back alignment and structure |
| >pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 | Back alignment and structure |
| >pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 | Back alignment and structure |
| >pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 | Back alignment and structure |
| >pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 | Back alignment and structure |
| >pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 | Back alignment and structure |
| >pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 | Back alignment and structure |
| >pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 | Back alignment and structure |
| >pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 | Back alignment and structure |
| >pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 | Back alignment and structure |
| >pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 | Back alignment and structure |
| >pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 | Back alignment and structure |
| >pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 | Back alignment and structure |
| >pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 | Back alignment and structure |
| >pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 | Back alignment and structure |
| >pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 | Back alignment and structure |
| >pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 | Back alignment and structure |
| >pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 | Back alignment and structure |
| >pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 | Back alignment and structure |
| >pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 | Back alignment and structure |
| >pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 | Back alignment and structure |
| >pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 | Back alignment and structure |
| >pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 | Back alignment and structure |
| >pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 | Back alignment and structure |
| >pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 | Back alignment and structure |
| >pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 | Back alignment and structure |
| >pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 | Back alignment and structure |
| >pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 | Back alignment and structure |
| >pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 | Back alignment and structure |
| >pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 | Back alignment and structure |
| >pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 | Back alignment and structure |
| >pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 | Back alignment and structure |
| >pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 | Back alignment and structure |
| >pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 | Back alignment and structure |
| >pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 | Back alignment and structure |
| >pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 | Back alignment and structure |
| >pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 | Back alignment and structure |
| >pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 112 | |||
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.96 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.96 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.95 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.95 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.95 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.95 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.95 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.95 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.94 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.94 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.94 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.94 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.94 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.94 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.94 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.94 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.94 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.93 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.93 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.93 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.93 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.93 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.93 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.93 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.93 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.93 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.93 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.93 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.93 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.93 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.93 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.92 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.92 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.92 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.92 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.92 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.92 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.92 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.92 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.92 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.92 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.92 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.92 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.92 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.92 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.92 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.92 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.92 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.91 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.91 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.91 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.91 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.91 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.91 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.91 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.91 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.91 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.91 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.91 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.91 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.91 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.91 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.91 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.9 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.9 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.9 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.9 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.9 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.9 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.9 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.9 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.9 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.9 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.9 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.9 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.89 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.89 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.89 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.89 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.89 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.89 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.89 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.89 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.89 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.89 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.89 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.89 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.89 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.89 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.89 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.89 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.89 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.89 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.88 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.88 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.88 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.88 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.88 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.88 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.88 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.88 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.88 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.88 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.88 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.88 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.88 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.87 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.87 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.87 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.87 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.87 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.87 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.87 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.86 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.86 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.86 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.85 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.84 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.84 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.83 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.83 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.83 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.83 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.81 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 99.8 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 99.8 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 99.78 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 99.77 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 99.74 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 99.69 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 99.69 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 99.68 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 99.66 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 99.65 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 99.65 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 99.64 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 99.64 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 99.62 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 99.62 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 99.62 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 99.61 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 99.61 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 99.61 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 99.6 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 99.59 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 99.59 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 99.59 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 99.59 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 99.58 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 99.57 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 99.57 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 99.56 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 99.56 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 99.55 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 99.55 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 99.55 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 99.54 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 99.52 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 99.51 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 99.5 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 99.45 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 99.43 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 99.42 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 99.42 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 99.4 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 99.37 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 99.36 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 99.36 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 99.35 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 99.35 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 99.31 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 99.3 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 99.29 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 99.28 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 99.27 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 99.25 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 99.24 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 99.23 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 99.23 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 99.2 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 99.18 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 99.18 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 99.18 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 99.17 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 99.16 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 99.15 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 99.15 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 99.15 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 99.14 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 99.11 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 99.11 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 99.11 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 99.1 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 99.1 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 99.06 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 99.04 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 99.02 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 99.01 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 99.0 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 98.99 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 98.98 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.97 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 98.96 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 98.94 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 98.93 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.92 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 98.9 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 98.88 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 98.87 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 98.86 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 98.86 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 98.85 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 98.83 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 98.82 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.8 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 98.74 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 98.73 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.7 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.7 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.69 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 98.69 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 98.65 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 98.63 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 98.58 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 98.56 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 98.55 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 98.51 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 98.49 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 98.43 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 98.43 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.41 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 98.41 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 98.39 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 98.36 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 98.35 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 98.3 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 98.28 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 98.25 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 98.24 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 98.21 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 98.19 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 98.09 | |
| 2ad6_A | 571 | Methanol dehydrogenase subunit 1; PQQ configuratio | 98.05 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 97.98 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 97.96 | |
| 3pbp_A | 452 | Nucleoporin NUP82; beta-propeller, mRNA export, mR | 97.96 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 97.96 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 97.93 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 97.91 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 97.89 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 97.87 | |
| 1flg_A | 582 | Protein (quinoprotein ethanol dehydrogenase); supe | 97.86 | |
| 1kv9_A | 668 | Type II quinohemoprotein alcohol dehydrogenase; el | 97.83 | |
| 1w6s_A | 599 | Methanol dehydrogenase subunit 1; anisotropic, ele | 97.82 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 97.79 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 97.76 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 97.71 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 97.68 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 97.65 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 97.56 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 97.54 | |
| 2ad6_A | 571 | Methanol dehydrogenase subunit 1; PQQ configuratio | 97.48 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 97.48 | |
| 1kv9_A | 668 | Type II quinohemoprotein alcohol dehydrogenase; el | 97.41 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 97.38 | |
| 1flg_A | 582 | Protein (quinoprotein ethanol dehydrogenase); supe | 97.34 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 97.25 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 97.22 | |
| 1w6s_A | 599 | Methanol dehydrogenase subunit 1; anisotropic, ele | 97.04 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 96.92 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 96.91 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 96.82 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 96.81 | |
| 3pbp_A | 452 | Nucleoporin NUP82; beta-propeller, mRNA export, mR | 96.71 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 96.56 | |
| 2be1_A | 339 | Serine/threonine-protein kinase/endoribonuclease; | 96.53 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 96.51 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 96.4 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 96.33 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 96.16 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 96.16 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 96.05 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 95.98 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 95.96 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 95.71 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 95.64 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 95.61 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 95.59 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 95.21 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 95.07 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 94.99 | |
| 3amr_A | 355 | 3-phytase; beta-propeller, phytate, MYO-inositol h | 94.98 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 94.98 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 94.94 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 94.91 | |
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 94.87 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 94.62 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 94.55 | |
| 3sbq_A | 638 | Nitrous-oxide reductase; beta-propeller, cupredoxi | 94.48 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 94.36 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 94.34 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 94.3 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 93.71 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 93.67 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 93.56 | |
| 3sbq_A | 638 | Nitrous-oxide reductase; beta-propeller, cupredoxi | 93.32 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 93.17 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 93.11 | |
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 92.89 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 92.66 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 92.62 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 92.25 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 92.11 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 92.06 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 91.92 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 91.66 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 91.6 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 91.5 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 91.42 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 91.39 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 90.93 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 90.46 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 90.26 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 90.14 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 90.07 | |
| 2xbg_A | 327 | YCF48-like protein; photosynthesis, photosystem II | 89.51 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 89.43 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 89.36 | |
| 3zwu_A | 592 | Alkaline phosphatase PHOX; hydrolase, beta-propell | 89.21 | |
| 2xbg_A | 327 | YCF48-like protein; photosynthesis, photosystem II | 88.96 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 88.75 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 88.69 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 88.61 | |
| 3f7f_A | 729 | Nucleoporin NUP120; nuclear pore complex, macromol | 88.2 | |
| 3f7f_A | 729 | Nucleoporin NUP120; nuclear pore complex, macromol | 87.78 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 86.37 | |
| 3ei3_A | 1158 | DNA damage-binding protein 1; UV-damage, DDB, nucl | 86.21 | |
| 2be1_A | 339 | Serine/threonine-protein kinase/endoribonuclease; | 85.62 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 85.61 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 84.95 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 84.51 |
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
Probab=99.96 E-value=3.4e-27 Score=135.84 Aligned_cols=111 Identities=16% Similarity=0.256 Sum_probs=102.2
Q ss_pred CeeEEEcCCCCEEEEEcCCCcEEEEEcCCCCCcEEEeeccCCeeEEEEccCCCEEEEeeCCCcEEEeeCCCCCceEEecC
Q 045566 1 VLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEVAWIPEMNLLATGSWDKTLKYWDTRQPNPVHTQQL 80 (112)
Q Consensus 1 v~~~~~~~~~~~l~~~~~~~~v~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~i~~w~~~~~~~~~~~~~ 80 (112)
|.+++|+|+++++++++.|+.|++||+.+++.+..+..|..++.+++|+|+++++++++.|+.|++||+++++.+..+..
T Consensus 16 V~~~~fsp~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i~vwd~~~~~~~~~~~~ 95 (304)
T 2ynn_A 16 VKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEA 95 (304)
T ss_dssp EEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEEEETTTCCEEEEEEC
T ss_pred eEEEEECCCCCEEEEEcCCCcEEEEECCCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEEEEEECCCCcEEEEEeC
Confidence 57899999999999999999999999998888888889999999999999999999999999999999999988766654
Q ss_pred ---CCeEEEEeeCCCEEEEEeCCCcEEEEECcCC
Q 045566 81 ---PDRCYALTVRYPLMVVGTADRNLVVFNLQNP 111 (112)
Q Consensus 81 ---~~~~~~~~~~~~~~~~~~~d~~v~~~d~~~~ 111 (112)
.+..++|+|+++++++++.|+.|++||++++
T Consensus 96 h~~~v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~ 129 (304)
T 2ynn_A 96 HPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENN 129 (304)
T ss_dssp CSSCEEEEEECSSSSEEEEEETTSCEEEEEGGGT
T ss_pred CCCcEEEEEEcCCCCEEEEECCCCeEEEEECCCC
Confidence 4578999999999999999999999998764
|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 | Back alignment and structure |
|---|
| >1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A | Back alignment and structure |
|---|
| >3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... | Back alignment and structure |
|---|
| >2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 112 | ||||
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 5e-13 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 9e-10 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 2e-08 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 2e-04 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 4e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 1e-11 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 1e-11 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 3e-06 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 3e-06 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 5e-05 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 4e-04 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 9e-11 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 4e-09 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 6e-07 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.004 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 2e-10 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 1e-06 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 7e-05 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 9e-04 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 5e-10 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 2e-04 | |
| d1pgua2 | 287 | b.69.4.1 (A:327-613) Actin interacting protein 1 { | 5e-07 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 2e-06 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 6e-05 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 9e-05 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 3e-06 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 6e-04 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 7e-04 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 0.001 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 0.001 | |
| d1k32a3 | 360 | b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar | 1e-05 | |
| d1pgua1 | 325 | b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba | 2e-05 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 3e-05 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 6e-04 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 0.002 | |
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 3e-05 | |
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 1e-04 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 3e-05 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 5e-05 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 9e-05 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 2e-04 | |
| d1nr0a2 | 299 | b.69.4.1 (A:313-611) Actin interacting protein 1 { | 3e-04 | |
| d1sq9a_ | 393 | b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake | 1e-04 | |
| d1sq9a_ | 393 | b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake | 1e-04 | |
| d1sq9a_ | 393 | b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake | 0.004 | |
| d1pbyb_ | 337 | b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase | 8e-04 | |
| d1jmxb_ | 346 | b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase | 0.001 |
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: beta1-subunit of the signal-transducing G protein heterotrimer species: Cow (Bos taurus) [TaxId: 9913]
Score = 61.3 bits (147), Expect = 5e-13
Identities = 17/68 (25%), Positives = 30/68 (44%)
Query: 1 VLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEVAWIPEMNLLATGSW 60
+ ++ G + +G D +W L + +A HD + + + +ATGSW
Sbjct: 273 ITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSW 332
Query: 61 DKTLKYWD 68
D LK W+
Sbjct: 333 DSFLKIWN 340
|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 112 | |||
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.94 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.94 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.94 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.93 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.92 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.92 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.91 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.9 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.9 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.9 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.9 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.9 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.89 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.89 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.89 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.89 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.88 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.88 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.87 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.87 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.86 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.85 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.84 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.83 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.78 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.78 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.76 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.76 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.72 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.68 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 99.68 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.67 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.66 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.64 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 99.56 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 99.53 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.52 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 99.51 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 99.49 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 99.46 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 99.39 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 99.32 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 99.29 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 99.29 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 99.23 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 99.21 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 99.2 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 99.2 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 99.14 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 98.96 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 98.87 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 98.54 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 98.46 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 98.45 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.4 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 98.26 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 98.26 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 98.25 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.13 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 97.97 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 97.94 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.89 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 97.71 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.64 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 97.62 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 97.53 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 97.5 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.05 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 96.98 | |
| d1flga_ | 582 | Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax | 96.93 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 96.43 | |
| d2ad6a1 | 571 | Methanol dehydrogenase, heavy chain {Methylophilus | 96.43 | |
| d1kv9a2 | 560 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 96.27 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 95.92 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 95.89 | |
| d1kv9a2 | 560 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 95.81 | |
| d1kb0a2 | 573 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 95.71 | |
| d1w6sa_ | 596 | Methanol dehydrogenase, heavy chain {Methylobacter | 95.63 | |
| d1kb0a2 | 573 | Quinoprotein alcohol dehydrogenase, N-terminal dom | 95.6 | |
| d2ad6a1 | 571 | Methanol dehydrogenase, heavy chain {Methylophilus | 95.28 | |
| d1fwxa2 | 459 | Nitrous oxide reductase, N-terminal domain {Paraco | 95.25 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 95.01 | |
| d1utca2 | 327 | Clathrin heavy-chain terminal domain {Rat (Rattus | 94.39 | |
| d1qfma1 | 430 | Prolyl oligopeptidase, N-terminal domain {Pig (Sus | 93.82 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 93.41 | |
| d1fwxa2 | 459 | Nitrous oxide reductase, N-terminal domain {Paraco | 93.2 | |
| d1flga_ | 582 | Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax | 92.58 | |
| d1w6sa_ | 596 | Methanol dehydrogenase, heavy chain {Methylobacter | 91.63 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 90.34 | |
| d1utca2 | 327 | Clathrin heavy-chain terminal domain {Rat (Rattus | 90.23 | |
| d1qfma1 | 430 | Prolyl oligopeptidase, N-terminal domain {Pig (Sus | 85.26 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 83.56 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 81.03 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 80.08 |
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Antiviral protein Ski8 (Ski8p) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94 E-value=4.5e-26 Score=133.44 Aligned_cols=111 Identities=12% Similarity=0.118 Sum_probs=94.5
Q ss_pred CeeEEEcCCCCEEEEEcCCCcEEEEEcCCCCCcEEE------eeccCCeeEEEEccCCCEEEEeeCCCc---EEEeeCCC
Q 045566 1 VLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPVTV------AMHDAPIKEVAWIPEMNLLATGSWDKT---LKYWDTRQ 71 (112)
Q Consensus 1 v~~~~~~~~~~~l~~~~~~~~v~~~~~~~~~~~~~~------~~~~~~v~~~~~~~~~~~~~~~~~~~~---i~~w~~~~ 71 (112)
+.+++|+|++ ++++|+.|+.|++||+.+++++..+ .+|..+|.+++|+|+++++++++.|+. |++||+++
T Consensus 187 ~~~v~~s~dg-~lasgs~Dg~i~iwd~~~~~~~~~~~~~~~l~~h~~~V~~l~~spdg~~l~sgs~D~t~~~i~lwd~~~ 265 (393)
T d1sq9a_ 187 ATSVDISERG-LIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEF 265 (393)
T ss_dssp CCEEEECTTS-EEEEECTTSEEEEEETTTTEEEEEEECCC---CCCCCEEEEEECSSTTEEEEEEEETTEEEEEEEETTT
T ss_pred EEEEEECCCC-EEEEEeCCCcEEEEeecccccccccccccccccccceEEEcccccccceeeeecCCCCcceeeeccccc
Confidence 4579999987 8899999999999999887765433 468899999999999999999998874 89999998
Q ss_pred CCceEEec----------------CCCeEEEEeeCCCEEEEEeCCCcEEEEECcCCC
Q 045566 72 PNPVHTQQ----------------LPDRCYALTVRYPLMVVGTADRNLVVFNLQNPQ 112 (112)
Q Consensus 72 ~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~d~~v~~~d~~~~~ 112 (112)
++.+..+. ..+..++|+|++++|++++.|+.|++||+++++
T Consensus 266 g~~~~~l~~~~~~~~~~~~~~gH~~~V~~l~fspd~~~l~S~s~D~~v~vWd~~~g~ 322 (393)
T d1sq9a_ 266 GERIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKE 322 (393)
T ss_dssp CCEEEEECBC--------CCBSBSSCEEEEEECSSSSEEEEEETTSEEEEEETTTTE
T ss_pred ceeeeeeccccccccceeeeecccCceeeeccCCCCCeeEEECCCCEEEEEECCCCC
Confidence 87665543 235789999999999999999999999998863
|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|