Citrus Sinensis ID: 045600

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------90
MVGIAERSERWPEAYIKLTDKDSDSVRTSESDERYRFQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHNKNLKALPLPALALRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLVGD
cccHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccc
ccHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccEccc
mvgiaerserwpEAYIKLtdkdsdsvrtsesderyrfQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIhnknlkalplpalALRTLEAFEITSYHIalssfpiikkpCVFLQNLMirglsncglhADLLHVYIKCrlsgcpsddftfPFLIKACSslsdlrigrEIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLlfdqipladlvscntlmagysfngldQEALETFRRILTvglkpnvstfssvipvctrlghfcfgkslhgftiksgylfddfLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIipscenycsfqcgeslTACVIknglgnqpSVLTALLSMYAKlgnidsakflfdqipnrnlLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSgcsklddvllgksAHAFSLRKGIVSNLDVLNALLMFysdggqfsyAFTLFHrmstrssvsWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFlpnlnkngnikqgMVIHGYAIKTGCVADVTFLNALITMYCncgstndgRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLgaglepdnvTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSliykdafswsvmingyglygdGEAALELFKQMqlsgvrpneiTYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLlgrtghlnEAFIFvkklpckpsvSILESLLGACRIHGNVELGEIISGmlfemdpenpgsyVMLHNIYASAGRWEDAYRVRScmkrsrlkkvpgfslvgd
mvgiaerserwpeayikltdkdsdsvrtsesderyrfQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHNKNLKALPLPALALRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRScmkrsrlkkvpgfslvgd
MVGIAERSERWPEAYIKLTDKDSDSVRTSESDERYRFQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHnknlkalplpalalRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLVGD
**********************************YRFQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHNKNLKALPLPALALRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMK***************
*******SERWPEAYIKLTDKDSDSVRTSESDERYRFQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHNKNLKALPLPALALRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLVGD
MVGIAERSERWPEAYIKLTD*************RYRFQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHNKNLKALPLPALALRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLVGD
MVGIAERSERWPEAYIKLTDKDSDSVRTSESDERYRFQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHNKNLKALPLPALALRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLV**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGIAERSERWPEAYIKLTDKDSDSVRTSESDERYRFQCVISSKMACCLSSLHSEVRAFLDLYNSYLKLKIHNKNLKALPLPALALRTLEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLVGD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query899 2.2.26 [Sep-21-2011]
Q9SVP7 1064 Pentatricopeptide repeat- yes no 0.878 0.742 0.310 1e-119
Q9M1V3 960 Pentatricopeptide repeat- no no 0.824 0.771 0.322 1e-116
Q7XJN6860 Pentatricopeptide repeat- no no 0.862 0.901 0.332 1e-113
Q9SS831028 Pentatricopeptide repeat- no no 0.798 0.698 0.316 1e-112
O80647836 Pentatricopeptide repeat- no no 0.864 0.929 0.309 1e-112
Q9C507787 Putative pentatricopeptid no no 0.819 0.936 0.318 1e-110
Q9SVA5834 Pentatricopeptide repeat- no no 0.804 0.866 0.316 1e-109
Q3E6Q1 809 Pentatricopeptide repeat- no no 0.685 0.761 0.337 1e-109
Q9FNN9849 Putative pentatricopeptid no no 0.832 0.881 0.287 1e-108
Q0WN60 970 Pentatricopeptide repeat- no no 0.824 0.763 0.303 1e-108
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function desciption
 Score =  429 bits (1104), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 250/805 (31%), Positives = 425/805 (52%), Gaps = 15/805 (1%)

Query: 100 ALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSS 159
           A   F  + +  +F  N MI+ L++  L  ++  ++++        ++ TF  +++AC  
Sbjct: 139 AFKVFDEMPERTIFTWNKMIKELASRNLIGEVFGLFVRMVSENVTPNEGTFSGVLEACRG 198

Query: 160 LS-DLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNT 218
            S    +  +IH  I   G   + V+   L+D Y++ G +  AR +FD + L D  S   
Sbjct: 199 GSVAFDVVEQIHARILYQGLRDSTVVCNPLIDLYSRNGFVDLARRVFDGLRLKDHSSWVA 258

Query: 219 LMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSG 278
           +++G S N  + EA+  F  +  +G+ P    FSSV+  C ++     G+ LHG  +K G
Sbjct: 259 MISGLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIESLEIGEQLHGLVLKLG 318

Query: 279 YLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFR 338
           +  D ++  AL+S+Y    +L +A  +F ++ +++A  +N +I+  +Q     +A E+F+
Sbjct: 319 FSSDTYVCNALVSLYFHLGNLISAEHIFSNMSQRDAVTYNTLINGLSQCGYGEKAMELFK 378

Query: 339 QMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLG 398
           +M    ++PD  T  S++ +C    +   G+ L A   K G  +   +  ALL++YAK  
Sbjct: 379 RMHLDGLEPDSNTLASLVVACSADGTLFRGQQLHAYTTKLGFASNNKIEGALLNLYAKCA 438

Query: 399 NIDSAKFLFDQIPNRNLLCWNAMMSAY-----VRNRFWDASLAVFRQMQFAGLNPDAVSI 453
           +I++A   F +    N++ WN M+ AY     +RN F      +FRQMQ   + P+  + 
Sbjct: 439 DIETALDYFLETEVENVVLWNVMLVAYGLLDDLRNSF-----RIFRQMQIEEIVPNQYTY 493

Query: 454 ISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMST 513
            S+L  C +L D+ LG+  H+  ++     N  V + L+  Y+  G+   A+ +  R + 
Sbjct: 494 PSILKTCIRLGDLELGEQIHSQIIKTNFQLNAYVCSVLIDMYAKLGKLDTAWDILIRFAG 553

Query: 514 RSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVI 573
           +  VSW T+I+   Q    ++A+   ++M   G+  D V L + +        +K+G  I
Sbjct: 554 KDVVSWTTMIAGYTQYNFDDKALTTFRQMLDRGIRSDEVGLTNAVSACAGLQALKEGQQI 613

Query: 574 HGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQT 633
           H  A  +G  +D+ F NAL+T+Y  CG   +  L     + GD      WNA++S + Q+
Sbjct: 614 HAQACVSGFSSDLPFQNALVTLYSRCGKIEESYLAFEQTEAGDN---IAWNALVSGFQQS 670

Query: 634 NKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVS 693
              ++A+  F  +   G++ +N T  S + A     ++     + A + + G D    V 
Sbjct: 671 GNNEEALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQVHAVITKTGYDSETEVC 730

Query: 694 NALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVR 753
           NAL+  Y +CG+IS A K F  +  K+  SW+ +IN Y  +G G  AL+ F QM  S VR
Sbjct: 731 NALISMYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGFGSEALDSFDQMIHSNVR 790

Query: 754 PNEITYLGVLSACSHAGLVEQSKMVFKSM-VEHGISQKMEHYACMVDLLGRTGHLNEAFI 812
           PN +T +GVLSACSH GLV++    F+SM  E+G+S K EHY C+VD+L R G L+ A  
Sbjct: 791 PNHVTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHYVCVVDMLTRAGLLSRAKE 850

Query: 813 FVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGR 872
           F++++P KP   +  +LL AC +H N+E+GE  +  L E++PE+  +YV+L N+YA + +
Sbjct: 851 FIQEMPIKPDALVWRTLLSACVVHKNMEIGEFAAHHLLELEPEDSATYVLLSNLYAVSKK 910

Query: 873 WEDAYRVRSCMKRSRLKKVPGFSLV 897
           W+     R  MK   +KK PG S +
Sbjct: 911 WDARDLTRQKMKEKGVKKEPGQSWI 935

Arabidopsis thaliana (taxid: 3702)
>sp|Q9M1V3|PP296_ARATH Pentatricopeptide repeat-containing protein At3g63370 OS=Arabidopsis thaliana GN=PCMP-H83 PE=2 SV=2 Back     alignment and function description
>sp|Q7XJN6|PP197_ARATH Pentatricopeptide repeat-containing protein At2g40720 OS=Arabidopsis thaliana GN=PCMP-E26 PE=3 SV=1 Back     alignment and function description
>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E88 PE=2 SV=1 Back     alignment and function description
>sp|O80647|PP195_ARATH Pentatricopeptide repeat-containing protein At2g39620 OS=Arabidopsis thaliana GN=PCMP-E33 PE=3 SV=1 Back     alignment and function description
>sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E66 PE=3 SV=1 Back     alignment and function description
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNN9|PP370_ARATH Putative pentatricopeptide repeat-containing protein At5g08490 OS=Arabidopsis thaliana GN=PCMP-E32 PE=3 SV=1 Back     alignment and function description
>sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protein At1g18485 OS=Arabidopsis thaliana GN=PCMP-H8 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query899
147779768 1167 hypothetical protein VITISV_003014 [Viti 0.889 0.685 0.452 0.0
225438700 1008 PREDICTED: pentatricopeptide repeat-cont 0.828 0.739 0.470 0.0
224084334558 predicted protein [Populus trichocarpa] 0.550 0.887 0.560 1e-165
357120534989 PREDICTED: pentatricopeptide repeat-cont 0.864 0.785 0.366 1e-144
359486639 1005 PREDICTED: pentatricopeptide repeat-cont 0.882 0.789 0.336 1e-139
147843467 1005 hypothetical protein VITISV_010010 [Viti 0.882 0.789 0.335 1e-139
242041975 1026 hypothetical protein SORBIDRAFT_01g04494 0.855 0.749 0.357 1e-139
115467784992 Os06g0314100 [Oryza sativa Japonica Grou 0.864 0.783 0.364 1e-136
125555089992 hypothetical protein OsI_22717 [Oryza sa 0.864 0.783 0.362 1e-136
147801171957 hypothetical protein VITISV_014689 [Viti 0.899 0.845 0.326 1e-132
>gi|147779768|emb|CAN71727.1| hypothetical protein VITISV_003014 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/882 (45%), Positives = 552/882 (62%), Gaps = 82/882 (9%)

Query: 89   LEAFEITSYHIALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDF 148
            +  F + +  +ALS+F  I+KP VFLQNLMIR L + GL  D+L VY+KCR+ GCPSDDF
Sbjct: 287  ISCFHLGAPELALSAFEAIEKPSVFLQNLMIRRLCDHGLFEDVLCVYLKCRVLGCPSDDF 346

Query: 149  TFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQI 208
            TFPF+IKACS+L  + I   +HC++ RT + +NLVIQTALVDFYAK G M+ ARL+ D+I
Sbjct: 347  TFPFVIKACSALGAVWIAEGVHCIVLRTAFEENLVIQTALVDFYAKTGRMVKARLVLDKI 406

Query: 209  PLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGK 268
               DLV+ N L++GYS NG D+E  E  R+IL +GLKPNVSTF+S+IP+CTR+     GK
Sbjct: 407  SQPDLVTWNALISGYSLNGFDKEVFEVLRQILEMGLKPNVSTFASIIPLCTRMKCLDIGK 466

Query: 269  SLHGFTIKSGYLFDDFLVPALISM-------------------------------YAGDL 297
            S+HGF +KSG+  D+FL PALISM                               YA + 
Sbjct: 467  SIHGFVVKSGFSSDEFLTPALISMYAGGGNLFIARDLFDSAAEKNVVIWNSMISAYAQNQ 526

Query: 298  DLSTARKLFDSLLEKN------------------ASVW---------------------N 318
              S A K+F  +L+ N                  A+ W                      
Sbjct: 527  KSSEAFKMFQQMLKANMQPNVVTFVSIIPCCENSANFWXGKSLHAHVMKYRLDSQLSVAT 586

Query: 319  AMISAYTQSKKFFEAFEIFRQMIRAEMQPD-LVTFVSIIPSCENYCSFQCGESLTACVIK 377
            A++S Y +      A  IF QM R     D +++   I+     +   +    L    IK
Sbjct: 587  ALLSMYAKLGDXNSAXFIFYQMPRKTSYRDSMISGYGIMSMGRPFFWVRL---LMHLAIK 643

Query: 378  NG--LGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASL 435
             G    +  ++  ALL+ Y+  G + S+  LF ++P RN + WN ++S  V N     ++
Sbjct: 644  TGKEFDSXLNISNALLAFYSDCGKLSSSFKLFQKMPLRNAISWNTLISGCVHNGDTKKAV 703

Query: 436  AVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFY 495
            A+  +MQ   +  D V++IS++  C   ++++ G + H ++++ G   ++ ++NAL+  Y
Sbjct: 704  ALLHKMQQEKMELDLVTLISIIPICRVXENLIQGMTLHGYAIKTGFACDVSLVNALISMY 763

Query: 496  SDGGQFSYAFTLFHRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLI 555
             + G  +    LF  M  RS VSWN LI+    +    E +    +M  EG + + VTL+
Sbjct: 764  FNCGDINAGKFLFEVMPWRSIVSWNALITGYRFHYLQNEVMASFCQMIXEGQKPNYVTLL 823

Query: 556  SFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMG 615
            + LP+      + QG  IH +A++TG + +   + +LI+MY    + N     + LF+MG
Sbjct: 824  NLLPSCX---TLLQGKSIHAFAVRTGVIVETPIITSLISMYARFENINS---FIFLFEMG 877

Query: 616  DKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTH 675
             K +I+LWNAI+SVYVQT  AK++V FF ELL A +EPD +T LS+ISA V ++SLNL++
Sbjct: 878  GKEDIALWNAIMSVYVQTKNAKESVTFFCELLHARVEPDYITFLSLISACVQLSSLNLSN 937

Query: 676  SLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYG 735
            S+MA+VI+KG DKH+ +SNAL+D + RCGNIS+A+K+F  L  KDA SWS MINGYGL+G
Sbjct: 938  SVMAYVIQKGFDKHIVISNALIDLFARCGNISIAKKIFEGLSSKDAVSWSTMINGYGLHG 997

Query: 736  DGEAALELFKQMQLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYA 795
            D EAAL L  QM+LSG++P+ ITY  VLSACSH G ++Q  M+F SMVE G+ ++MEHYA
Sbjct: 998  DSEAALALLSQMRLSGMKPDGITYASVLSACSHGGFIDQGWMIFNSMVEEGVPRRMEHYA 1057

Query: 796  CMVDLLGRTGHLNEAFIFVKKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPE 855
            CMVDLLGRTG LNEA+ FV+KLPCKPSVS+LESLL AC IHGNV+LGE I  +LFE+DP+
Sbjct: 1058 CMVDLLGRTGQLNEAYDFVEKLPCKPSVSLLESLLXACIIHGNVKLGEKICSLLFELDPK 1117

Query: 856  NPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLV 897
            N GSYVML+NIYA+AGRW DA RVRS M+  +L+K+PGFSLV
Sbjct: 1118 NSGSYVMLYNIYAAAGRWMDANRVRSDMEERQLRKIPGFSLV 1159

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225438700|ref|XP_002277701.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224084334|ref|XP_002307262.1| predicted protein [Populus trichocarpa] gi|222856711|gb|EEE94258.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357120534|ref|XP_003561982.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|359486639|ref|XP_002284011.2| PREDICTED: pentatricopeptide repeat-containing protein At2g39620-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147843467|emb|CAN82070.1| hypothetical protein VITISV_010010 [Vitis vinifera] Back     alignment and taxonomy information
>gi|242041975|ref|XP_002468382.1| hypothetical protein SORBIDRAFT_01g044940 [Sorghum bicolor] gi|241922236|gb|EER95380.1| hypothetical protein SORBIDRAFT_01g044940 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|115467784|ref|NP_001057491.1| Os06g0314100 [Oryza sativa Japonica Group] gi|54291635|dbj|BAD62428.1| PPR-repeat protein-like [Oryza sativa Japonica Group] gi|113595531|dbj|BAF19405.1| Os06g0314100 [Oryza sativa Japonica Group] gi|125597005|gb|EAZ36785.1| hypothetical protein OsJ_21122 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125555089|gb|EAZ00695.1| hypothetical protein OsI_22717 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|147801171|emb|CAN62238.1| hypothetical protein VITISV_014689 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query899
TAIR|locus:2119440 1064 AT4G13650 [Arabidopsis thalian 0.884 0.747 0.311 1.1e-110
TAIR|locus:2064828860 AT2G40720 [Arabidopsis thalian 0.860 0.9 0.340 7e-109
TAIR|locus:2007116787 AT1G69350 "AT1G69350" [Arabido 0.819 0.936 0.318 4.4e-107
TAIR|locus:2039817836 AT2G39620 "AT2G39620" [Arabido 0.834 0.897 0.316 4e-106
TAIR|locus:20952891028 AT3G09040 "AT3G09040" [Arabido 0.798 0.698 0.316 4.6e-105
TAIR|locus:2178188 995 MEF7 "AT5G09950" [Arabidopsis 0.890 0.805 0.318 2e-104
TAIR|locus:2141171857 AT4G21300 [Arabidopsis thalian 0.822 0.862 0.311 5.3e-104
TAIR|locus:505006130 970 AT1G18485 [Arabidopsis thalian 0.822 0.761 0.308 8.6e-104
TAIR|locus:2019130895 OTP87 "organelle transcript pr 0.956 0.960 0.301 8.6e-104
TAIR|locus:2122551834 AT4G39530 [Arabidopsis thalian 0.825 0.889 0.313 1.4e-103
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1093 (389.8 bits), Expect = 1.1e-110, P = 1.1e-110
 Identities = 249/800 (31%), Positives = 424/800 (53%)

Query:   100 ALSSFPIIKKPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSS 159
             A   F  + +  +F  N MI+ L++  L  ++  ++++        ++ TF  +++AC  
Sbjct:   139 AFKVFDEMPERTIFTWNKMIKELASRNLIGEVFGLFVRMVSENVTPNEGTFSGVLEACRG 198

Query:   160 LS-DLRIGREIHCVIFRTGYHQNLVIQTALVDFYAKKGEMLTARLLFDQIPLADLVSCNT 218
              S    +  +IH  I   G   + V+   L+D Y++ G +  AR +FD + L D  S   
Sbjct:   199 GSVAFDVVEQIHARILYQGLRDSTVVCNPLIDLYSRNGFVDLARRVFDGLRLKDHSSWVA 258

Query:   219 LMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIKSG 278
             +++G S N  + EA+  F  +  +G+ P    FSSV+  C ++     G+ LHG  +K G
Sbjct:   259 MISGLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIESLEIGEQLHGLVLKLG 318

Query:   279 YLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFR 338
             +  D ++  AL+S+Y    +L +A  +F ++ +++A  +N +I+  +Q     +A E+F+
Sbjct:   319 FSSDTYVCNALVSLYFHLGNLISAEHIFSNMSQRDAVTYNTLINGLSQCGYGEKAMELFK 378

Query:   339 QMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLG 398
             +M    ++PD  T  S++ +C    +   G+ L A   K G  +   +  ALL++YAK  
Sbjct:   379 RMHLDGLEPDSNTLASLVVACSADGTLFRGQQLHAYTTKLGFASNNKIEGALLNLYAKCA 438

Query:   399 NIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISVLS 458
             +I++A   F +    N++ WN M+ AY        S  +FRQMQ   + P+  +  S+L 
Sbjct:   439 DIETALDYFLETEVENVVLWNVMLVAYGLLDDLRNSFRIFRQMQIEEIVPNQYTYPSILK 498

Query:   459 GCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSSVS 518
              C +L D+ LG+  H+  ++     N  V + L+  Y+  G+   A+ +  R + +  VS
Sbjct:   499 TCIRLGDLELGEQIHSQIIKTNFQLNAYVCSVLIDMYAKLGKLDTAWDILIRFAGKDVVS 558

Query:   519 WNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAI 578
             W T+I+   Q    ++A+   ++M   G+  D V L + +        +K+G  IH  A 
Sbjct:   559 WTTMIAGYTQYNFDDKALTTFRQMLDRGIRSDEVGLTNAVSACAGLQALKEGQQIHAQAC 618

Query:   579 KTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQ 638
              +G  +D+ F NAL+T+Y  CG   +  L     + GD   I+ WNA++S + Q+   ++
Sbjct:   619 VSGFSSDLPFQNALVTLYSRCGKIEESYLAFEQTEAGDN--IA-WNALVSGFQQSGNNEE 675

Query:   639 AVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMD 698
             A+  F  +   G++ +N T  S + A     ++     + A + + G D    V NAL+ 
Sbjct:   676 ALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQVHAVITKTGYDSETEVCNALIS 735

Query:   699 SYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEIT 758
              Y +CG+IS A K F  +  K+  SW+ +IN Y  +G G  AL+ F QM  S VRPN +T
Sbjct:   736 MYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGFGSEALDSFDQMIHSNVRPNHVT 795

Query:   759 YLGVLSACSHAGLVEQSKMVFKSM-VEHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKL 817
              +GVLSACSH GLV++    F+SM  E+G+S K EHY C+VD+L R G L+ A  F++++
Sbjct:   796 LVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHYVCVVDMLTRAGLLSRAKEFIQEM 855

Query:   818 PCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAY 877
             P KP   +  +LL AC +H N+E+GE  +  L E++PE+  +YV+L N+YA + +W+   
Sbjct:   856 PIKPDALVWRTLLSACVVHKNMEIGEFAAHHLLELEPEDSATYVLLSNLYAVSKKWDARD 915

Query:   878 RVRSCMKRSRLKKVPGFSLV 897
               R  MK   +KK PG S +
Sbjct:   916 LTRQKMKEKGVKKEPGQSWI 935
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2064828 AT2G40720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007116 AT1G69350 "AT1G69350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039817 AT2G39620 "AT2G39620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095289 AT3G09040 "AT3G09040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141171 AT4G21300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019130 OTP87 "organelle transcript processing 87" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00019483001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (1008 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query899
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-139
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-85
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-80
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-78
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-44
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-44
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-40
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-34
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-27
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-07
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
pfam0153531 pfam01535, PPR, PPR repeat 6e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-05
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information 
 Score =  435 bits (1121), Expect = e-139
 Identities = 223/683 (32%), Positives = 379/683 (55%), Gaps = 8/683 (1%)

Query: 217 NTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGKSLHGFTIK 276
           N+ +     +G  ++AL+    +  + +  +   + ++  +C        G  +    + 
Sbjct: 55  NSQLRALCSHGQLEQALKLLESMQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALS 114

Query: 277 SGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEI 336
           S       L  A++SM+    +L  A  +F  + E++   WN ++  Y ++  F EA  +
Sbjct: 115 SHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCL 174

Query: 337 FRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAK 396
           + +M+ A ++PD+ TF  ++ +C        G  + A V++ G      V+ AL++MY K
Sbjct: 175 YHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVK 234

Query: 397 LGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRNRFWDASLAVFRQMQFAGLNPDAVSIISV 456
            G++ SA+ +FD++P R+ + WNAM+S Y  N      L +F  M+   ++PD ++I SV
Sbjct: 235 CGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSV 294

Query: 457 LSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFHRMSTRSS 516
           +S C  L D  LG+  H + ++ G   ++ V N+L+  Y   G +  A  +F RM T+ +
Sbjct: 295 ISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDA 354

Query: 517 VSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGY 576
           VSW  +IS   +NG  ++A+     M+++ V  D +T+ S L      G++  G+ +H  
Sbjct: 355 VSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHEL 414

Query: 577 AIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLF-QMGDKREISLWNAIISVYVQTNK 635
           A + G ++ V   NALI MY  C   +     L +F  + +K  IS W +II+     N+
Sbjct: 415 AERKGLISYVVVANALIEMYSKCKCIDKA---LEVFHNIPEKDVIS-WTSIIAGLRLNNR 470

Query: 636 AKQAVAFFTELLGAGLEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNA 695
             +A+ FF ++L   L+P++VT+++ +SA   I +L     + A V+R G+     + NA
Sbjct: 471 CFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNA 529

Query: 696 LMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPN 755
           L+D YVRCG ++ A   F +   KD  SW++++ GY  +G G  A+ELF +M  SGV P+
Sbjct: 530 LLDLYVRCGRMNYAWNQF-NSHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPD 588

Query: 756 EITYLGVLSACSHAGLVEQSKMVFKSM-VEHGISQKMEHYACMVDLLGRTGHLNEAFIFV 814
           E+T++ +L ACS +G+V Q    F SM  ++ I+  ++HYAC+VDLLGR G L EA+ F+
Sbjct: 589 EVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFI 648

Query: 815 KKLPCKPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWE 874
            K+P  P  ++  +LL ACRIH +VELGE+ +  +FE+DP + G Y++L N+YA AG+W+
Sbjct: 649 NKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWD 708

Query: 875 DAYRVRSCMKRSRLKKVPGFSLV 897
           +  RVR  M+ + L   PG S V
Sbjct: 709 EVARVRKTMRENGLTVDPGCSWV 731

Length = 857
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 899
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.87
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.83
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.79
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
PRK11788389 tetratricopeptide repeat protein; Provisional 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
KOG2076895 consensus RNA polymerase III transcription factor 99.76
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.76
KOG2076895 consensus RNA polymerase III transcription factor 99.76
PRK14574 822 hmsH outer membrane protein; Provisional 99.76
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.76
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.69
PRK14574 822 hmsH outer membrane protein; Provisional 99.69
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.66
KOG2003 840 consensus TPR repeat-containing protein [General f 99.64
KOG0547606 consensus Translocase of outer mitochondrial membr 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
KOG1915677 consensus Cell cycle control protein (crooked neck 99.49
KOG1126638 consensus DNA-binding cell division cycle control 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.43
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.42
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.42
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.42
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.41
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.41
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.41
KOG1915677 consensus Cell cycle control protein (crooked neck 99.41
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.41
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.39
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.38
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.38
KOG2003 840 consensus TPR repeat-containing protein [General f 99.37
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.34
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.33
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.32
KOG0547606 consensus Translocase of outer mitochondrial membr 99.31
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.3
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.29
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.28
PF1304150 PPR_2: PPR repeat family 99.27
PF1304150 PPR_2: PPR repeat family 99.25
KOG1129478 consensus TPR repeat-containing protein [General f 99.21
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.21
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.2
PRK12370553 invasion protein regulator; Provisional 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.19
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.18
PRK11189296 lipoprotein NlpI; Provisional 99.18
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.18
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.18
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.18
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.16
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.16
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.15
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.14
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.13
PRK12370553 invasion protein regulator; Provisional 99.09
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.07
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.07
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.06
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.06
KOG2376652 consensus Signal recognition particle, subunit Srp 99.04
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.03
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.01
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.96
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.96
PRK11189296 lipoprotein NlpI; Provisional 98.94
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.92
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.91
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.88
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.86
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.86
KOG1129478 consensus TPR repeat-containing protein [General f 98.83
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.82
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.82
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.79
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.77
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.75
KOG1125579 consensus TPR repeat-containing protein [General f 98.71
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.71
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.69
PRK10370198 formate-dependent nitrite reductase complex subuni 98.66
PRK15359144 type III secretion system chaperone protein SscB; 98.6
PLN02789320 farnesyltranstransferase 98.6
PF1285434 PPR_1: PPR repeat 98.6
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.58
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.57
PRK04841 903 transcriptional regulator MalT; Provisional 98.56
PLN02789320 farnesyltranstransferase 98.54
PRK15359144 type III secretion system chaperone protein SscB; 98.51
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.5
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.46
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.4
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.38
KOG1125579 consensus TPR repeat-containing protein [General f 98.38
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.38
PF1285434 PPR_1: PPR repeat 98.37
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.36
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.34
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.33
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.32
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.32
PRK04841903 transcriptional regulator MalT; Provisional 98.31
PRK10370198 formate-dependent nitrite reductase complex subuni 98.3
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.25
KOG1128777 consensus Uncharacterized conserved protein, conta 98.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.21
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.18
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.18
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.15
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.14
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.13
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.13
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.11
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.09
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.02
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.02
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.01
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.0
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.96
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.96
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.95
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.95
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.93
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.92
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.92
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.91
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.89
KOG0553304 consensus TPR repeat-containing protein [General f 97.87
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.86
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.84
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.84
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.72
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.71
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.67
PRK15331165 chaperone protein SicA; Provisional 97.66
COG4700251 Uncharacterized protein conserved in bacteria cont 97.66
KOG0553 304 consensus TPR repeat-containing protein [General f 97.64
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.63
PF1337173 TPR_9: Tetratricopeptide repeat 97.61
PF1343134 TPR_17: Tetratricopeptide repeat 97.51
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.51
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.5
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.47
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.43
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.39
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.39
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.39
PRK10803263 tol-pal system protein YbgF; Provisional 97.38
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.3
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.29
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.26
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.26
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.25
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.22
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.21
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.2
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.18
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.13
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.13
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.12
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.11
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.09
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.09
PF12688120 TPR_5: Tetratrico peptide repeat 97.05
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.03
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.01
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.01
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.0
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.0
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.0
KOG20411189 consensus WD40 repeat protein [General function pr 96.98
COG4700251 Uncharacterized protein conserved in bacteria cont 96.91
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.89
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.87
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.85
KOG20411189 consensus WD40 repeat protein [General function pr 96.8
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.79
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.77
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.76
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.75
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.74
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.72
PF1342844 TPR_14: Tetratricopeptide repeat 96.7
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.68
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.68
PF13512142 TPR_18: Tetratricopeptide repeat 96.64
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.63
PRK10803263 tol-pal system protein YbgF; Provisional 96.6
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.5
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.47
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.44
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.41
PF1337173 TPR_9: Tetratricopeptide repeat 96.33
PF12688120 TPR_5: Tetratrico peptide repeat 96.32
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.3
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.28
KOG4555175 consensus TPR repeat-containing protein [Function 96.24
KOG1585308 consensus Protein required for fusion of vesicles 96.22
PRK11906458 transcriptional regulator; Provisional 96.12
KOG4234271 consensus TPR repeat-containing protein [General f 96.05
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.04
PRK11906458 transcriptional regulator; Provisional 95.88
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.87
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.81
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.76
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.65
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.56
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.47
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.4
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.35
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.33
KOG4555175 consensus TPR repeat-containing protein [Function 95.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.02
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.99
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.93
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.89
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.62
PRK11619 644 lytic murein transglycosylase; Provisional 94.59
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.55
KOG1258577 consensus mRNA processing protein [RNA processing 94.42
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.4
KOG1258 577 consensus mRNA processing protein [RNA processing 94.25
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.19
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.13
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.05
smart00299140 CLH Clathrin heavy chain repeat homology. 93.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.9
PF1342844 TPR_14: Tetratricopeptide repeat 93.89
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.89
PRK15331165 chaperone protein SicA; Provisional 93.8
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.73
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.72
PF13512142 TPR_18: Tetratricopeptide repeat 93.62
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.62
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 93.54
KOG3941 406 consensus Intermediate in Toll signal transduction 93.52
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.51
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.32
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.19
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.16
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.98
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.93
smart00299140 CLH Clathrin heavy chain repeat homology. 92.9
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.76
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 92.64
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.23
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.99
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.98
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.96
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.93
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 91.85
KOG3941406 consensus Intermediate in Toll signal transduction 91.79
KOG4234271 consensus TPR repeat-containing protein [General f 91.75
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.4
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.37
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.26
COG3629280 DnrI DNA-binding transcriptional activator of the 91.12
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.11
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.04
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.97
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.7
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.68
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 90.29
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.99
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.95
PRK09687280 putative lyase; Provisional 89.92
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.92
KOG1586288 consensus Protein required for fusion of vesicles 89.86
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 89.76
PF06552186 TOM20_plant: Plant specific mitochondrial import r 89.7
COG3947361 Response regulator containing CheY-like receiver a 89.54
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.35
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.34
COG3629280 DnrI DNA-binding transcriptional activator of the 89.25
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.95
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.82
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.49
KOG4570 418 consensus Uncharacterized conserved protein [Funct 88.45
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 88.15
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.13
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.34
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 86.91
KOG1585308 consensus Protein required for fusion of vesicles 86.77
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 86.69
KOG4648 536 consensus Uncharacterized conserved protein, conta 86.52
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.36
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.15
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.09
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 86.09
PRK11619 644 lytic murein transglycosylase; Provisional 85.56
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.39
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 85.27
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.23
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 84.07
COG4455 273 ImpE Protein of avirulence locus involved in tempe 83.94
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 83.84
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 83.67
KOG1550 552 consensus Extracellular protein SEL-1 and related 83.61
COG4105254 ComL DNA uptake lipoprotein [General function pred 83.15
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.04
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.0
PHA02875413 ankyrin repeat protein; Provisional 82.7
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 82.57
PF1343134 TPR_17: Tetratricopeptide repeat 82.47
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.17
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 81.98
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 81.74
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 81.65
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 81.64
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 80.69
PRK09687280 putative lyase; Provisional 80.45
PRK10941269 hypothetical protein; Provisional 80.44
KOG1550552 consensus Extracellular protein SEL-1 and related 80.14
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.9e-101  Score=919.65  Aligned_cols=685  Identities=33%  Similarity=0.600  Sum_probs=654.3

Q ss_pred             CCChhhHHHHHHHHhcCCChhhHHHHHHHHHhcCCCCCCCcHHHHHHHhccCCChhhhhHHHHHHHHhCCCCchhhhhHH
Q 045600          109 KPCVFLQNLMIRGLSNCGLHADLLHVYIKCRLSGCPSDDFTFPFLIKACSSLSDLRIGREIHCVIFRTGYHQNLVIQTAL  188 (899)
Q Consensus       109 ~~~~~~~n~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~l  188 (899)
                      +|+..++|.+|++|++.|++++|+.+|+.|...|+.|+..||..++++|.+.+.++.|.++|..+.+.|..+++.++|+|
T Consensus        48 ~~~~~~~n~~i~~l~~~g~~~~A~~l~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~l  127 (857)
T PLN03077         48 SSSTHDSNSQLRALCSHGQLEQALKLLESMQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAM  127 (857)
T ss_pred             ccchhhHHHHHHHHHhCCCHHHHHHHHHHHHhcCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHH
Confidence            56788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCChHHHHHHhccCCCCCceeHHHHHHHHHcCCCchHHHHHHHHHHHCCCCCCcchHHHHHHHhhccCChhhhh
Q 045600          189 VDFYAKKGEMLTARLLFDQIPLADLVSCNTLMAGYSFNGLDQEALETFRRILTVGLKPNVSTFSSVIPVCTRLGHFCFGK  268 (899)
Q Consensus       189 ~~~y~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~  268 (899)
                      +.+|+++|+++.|.++|++|++||+++||+||.+|++.|++++|+++|++|...|+.||..||+++|++|+..+++..+.
T Consensus       128 i~~~~~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~  207 (857)
T PLN03077        128 LSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGR  207 (857)
T ss_pred             HHHHHhCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCcchhhHHHHhhhcCCChhhHHHHHhhcCCCCcccHHHHHHHHHcCCChhHHHHHHHHHHHCCCCCC
Q 045600          269 SLHGFTIKSGYLFDDFLVPALISMYAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPD  348 (899)
Q Consensus       269 ~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~  348 (899)
                      ++|..+++.|+.||+.++|+||++|+++|+++.|.++|++|+++|+++||+||.+|++.|++++|+++|++|.+.|+.||
T Consensus       208 ~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd  287 (857)
T PLN03077        208 EVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPD  287 (857)
T ss_pred             HHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhHHHHHHHhhccCCcccchHHHHHHHHhCCCCchhHHHHHHHHHHhcCChHHHHHHHhcCCCCCcchHHHHHHHHHHC
Q 045600          349 LVTFVSIIPSCENYCSFQCGESLTACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNRNLLCWNAMMSAYVRN  428 (899)
Q Consensus       349 ~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~  428 (899)
                      ..||+++|.+|++.|+.+.|.+++..+.+.|+.||..+|++|+++|+++|++++|.++|++|.+||+++||++|.+|++.
T Consensus       288 ~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~  367 (857)
T PLN03077        288 LMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKN  367 (857)
T ss_pred             hhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CChhHHHHHHHHHHHcCCCCCHHHHHHHHHHhccCCChHHHHHHHHHHHHhCCCCcHhHHHHHHHHHHcCCChHHHHHHH
Q 045600          429 RFWDASLAVFRQMQFAGLNPDAVSIISVLSGCSKLDDVLLGKSAHAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLF  508 (899)
Q Consensus       429 g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~  508 (899)
                      |++++|+++|++|.+.|+.||..||++++.+|++.|+++.|.++++.+.+.|+.|+..++++||++|+++|++++|.++|
T Consensus       368 g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf  447 (857)
T PLN03077        368 GLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVF  447 (857)
T ss_pred             CCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhcCCChHHHHHHHHHHHHhCCCCChhH
Q 045600          509 HRMSTRSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVTF  588 (899)
Q Consensus       509 ~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~  588 (899)
                      ++|.++|+++||++|.+|+++|+.++|+++|++|.. +++||..||+.++.+|++.|++                     
T Consensus       448 ~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l---------------------  505 (857)
T PLN03077        448 HNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGAL---------------------  505 (857)
T ss_pred             HhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchH---------------------
Confidence            999999999999999999999999988888888865 3666666655555555444444                     


Q ss_pred             HHHHHHHHHhcCChhhhhhHHHHhhcCCCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHhHHHHHHHHhccc
Q 045600          589 LNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVLI  668 (899)
Q Consensus       589 ~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~  668 (899)
                                                                                                      
T Consensus       506 --------------------------------------------------------------------------------  505 (857)
T PLN03077        506 --------------------------------------------------------------------------------  505 (857)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCHHHHHHHHHHHHHhCCCCChhHHHHHHHHhHhcCCHHHHHHHHHhcCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHH
Q 045600          669 NSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLIYKDAFSWSVMINGYGLYGDGEAALELFKQMQ  748 (899)
Q Consensus       669 ~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~  748 (899)
                         +.+.+++..+.+.|+.++..++++|+++|+++|++++|.++|+.+ .+|..+||++|.+|+++|+.++|+++|++|.
T Consensus       506 ---~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~  581 (857)
T PLN03077        506 ---MCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMV  581 (857)
T ss_pred             ---HHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence               444444444444455556777799999999999999999999999 8999999999999999999999999999999


Q ss_pred             HcCCCCChhHHHHHHHHHHccCCHHHHHHHHHHHH-HcCCccCcchHHHHHHHHhhcCChHHHHHHHHhCCCCCCHHHHH
Q 045600          749 LSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMV-EHGISQKMEHYACMVDLLGRTGHLNEAFIFVKKLPCKPSVSILE  827 (899)
Q Consensus       749 ~~g~~p~~~t~~~l~~~~~~~g~~~~A~~~~~~m~-~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~p~~~~~~  827 (899)
                      +.|+.||..||+.++.+|++.|++++|.++|++|. +.|+.|+..+|+.++++|.+.|++++|.+++++|+.+||..+|.
T Consensus       582 ~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~  661 (857)
T PLN03077        582 ESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWG  661 (857)
T ss_pred             HcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHH
Confidence            99999999999999999999999999999999999 88999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhCCHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhcCChHHHHHHHHHHHhCCCccCCCcccccC
Q 045600          828 SLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGRWEDAYRVRSCMKRSRLKKVPGFSLVGD  899 (899)
Q Consensus       828 ~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~y~~~g~~~eA~~~~~~~~~~~~~~~~~~~~~~~  899 (899)
                      +|+.+|..+|+.+.++...+++++++|+++..|..|+++|.+.|+|++|.++++.|+++|++|+||+||||+
T Consensus       662 aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~  733 (857)
T PLN03077        662 ALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEV  733 (857)
T ss_pred             HHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999984

>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query899
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 9e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 69.8 bits (169), Expect = 3e-12
 Identities = 22/195 (11%), Positives = 55/195 (28%), Gaps = 11/195 (5%)

Query: 653 PDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKL 712
           P    +  ++       SL++  +      +  L        A     +    + +A  L
Sbjct: 90  PWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHL 149

Query: 713 FGSL-------IYKDAFSWSVMINGYGLYGDGEAALELFKQMQLSGVRPNEITYLGVLSA 765
                             ++ ++ G+   G  +  + +   ++ +G+ P+ ++Y   L  
Sbjct: 150 LVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQC 209

Query: 766 CSHAGLVEQS-KMVFKSMVEHGISQKMEHYACMVDLLGRTGHLNEA---FIFVKKLPCKP 821
                    + +   + M + G+  +    A ++    R   L             P  P
Sbjct: 210 MGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLP 269

Query: 822 SVSILESLLGACRIH 836
                  LL      
Sbjct: 270 PPVNTSKLLRDVYAK 284
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query899
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.88
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.88
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.74
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.72
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.65
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.59
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.57
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.57
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.55
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.52
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.5
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.49
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.46
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.46
3u4t_A272 TPR repeat-containing protein; structural genomics 99.44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.43
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.43
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.43
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.41
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.41
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.4
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.38
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.38
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.38
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.34
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.33
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.31
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.25
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.23
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.22
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.2
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.19
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.19
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.17
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.06
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.02
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.99
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.98
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.98
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.98
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.98
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.97
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.95
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.94
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.93
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.91
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.89
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.88
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.87
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.87
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.86
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.85
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.84
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.82
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.81
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.81
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.78
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.75
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.75
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.74
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.74
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.73
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.69
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.68
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.67
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.67
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.63
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.59
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.56
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.56
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.53
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.53
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.52
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.52
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.51
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.5
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.5
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.5
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.45
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.44
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.43
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.43
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.4
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.39
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.37
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.35
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.33
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.33
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.32
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.32
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.3
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.29
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.29
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.27
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.26
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.25
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.23
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.21
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.21
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.2
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.2
3k9i_A117 BH0479 protein; putative protein binding protein, 98.17
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.17
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.14
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.14
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.14
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.09
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.08
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.03
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.03
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.02
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.0
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.99
3k9i_A117 BH0479 protein; putative protein binding protein, 97.94
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.93
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.91
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.91
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.9
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.9
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.86
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.83
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.82
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.81
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.81
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.8
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.8
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.78
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.77
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.75
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.72
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.71
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.68
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.53
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.29
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.28
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.27
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.16
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.1
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.09
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.07
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.03
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.83
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.8
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.77
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.77
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.61
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.56
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.42
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.42
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.3
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.1
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.95
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.87
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.55
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.44
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.27
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.23
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.18
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.71
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.67
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.15
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.98
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.94
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.58
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 91.88
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.1
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.72
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 88.69
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.43
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.41
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 88.29
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 86.97
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 86.7
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.59
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.56
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 86.02
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 85.89
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.75
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 85.44
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.08
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 81.77
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 81.06
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=7e-38  Score=364.48  Aligned_cols=496  Identities=8%  Similarity=-0.011  Sum_probs=334.3

Q ss_pred             hhcCCChhhHHHHHhhcCCCCcccHHHHHHHHHcCCChhHHHHHHHHHHHCCCCCCHhhHHHHHHHhhccCCcccchHHH
Q 045600          293 YAGDLDLSTARKLFDSLLEKNASVWNAMISAYTQSKKFFEAFEIFRQMIRAEMQPDLVTFVSIIPSCENYCSFQCGESLT  372 (899)
Q Consensus       293 ~~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~~~  372 (899)
                      +.+.|....+...|+.++.+++..|+.++..|.+.|++++|+.+|++|.+  ..|+..++..+..+|...|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            55678888899999999989999999999999999999999999999985  4678899999999999999999999999


Q ss_pred             HHHHHhCCCCchhHHHHHHHHHHhcCChHHHHHHHhcCCCC-------------------CcchHHHHHHHHHHCCChhH
Q 045600          373 ACVIKNGLGNQPSVLTALLSMYAKLGNIDSAKFLFDQIPNR-------------------NLLCWNAMMSAYVRNRFWDA  433 (899)
Q Consensus       373 ~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~-------------------~~~~~~~li~~~~~~g~~~~  433 (899)
                      ..+...  +++..+++.++.+|.+.|++++|.++|+++...                   +..+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            987543  678899999999999999999999999965433                   37799999999999999999


Q ss_pred             HHHHHHHHHHcCCCCCHH-HHHHHHHHhccCCChHHH--HHH-HHHHHHhCCCCcHhHHHHHHHHHHcCCChHHHHHHHh
Q 045600          434 SLAVFRQMQFAGLNPDAV-SIISVLSGCSKLDDVLLG--KSA-HAFSLRKGIVSNLDVLNALLMFYSDGGQFSYAFTLFH  509 (899)
Q Consensus       434 A~~~~~~m~~~g~~p~~~-t~~~ll~~~~~~~~~~~a--~~~-~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~  509 (899)
                      |+++|++|.+.+  |+.. .+..+...+...+..+.+  ..+ +..+...+..+...+++.++..|.+.|++++|.++|+
T Consensus       219 A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~  296 (597)
T 2xpi_A          219 AKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLS  296 (597)
T ss_dssp             HHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHH
Confidence            999999998864  5443 344444433333222211  111 3444444445555566666777777777777777777


Q ss_pred             hcCC--CChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhcCCChHHHHHHHHHHHHhCCCCChh
Q 045600          510 RMST--RSSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVELDMVTLISFLPNLNKNGNIKQGMVIHGYAIKTGCVADVT  587 (899)
Q Consensus       510 ~~~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~  587 (899)
                      ++..  ++..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..++..++.++.+.|++++|..+++.+.+.       
T Consensus       297 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-------  368 (597)
T 2xpi_A          297 SINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDR-------  368 (597)
T ss_dssp             TSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHH-------
T ss_pred             HhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhh-------
Confidence            7766  567777777777777777777777777776532 113333444444444444444444333333211       


Q ss_pred             HHHHHHHHHHhcCChhhhhhHHHHhhcCCCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHhHHHHHHHHhcc
Q 045600          588 FLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAGLEPDNVTVLSIISAGVL  667 (899)
Q Consensus       588 ~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~  667 (899)
                                                  .+.+..+|+.++..|.+.|++++|.++|+++.+..  |+             
T Consensus       369 ----------------------------~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--~~-------------  405 (597)
T 2xpi_A          369 ----------------------------HPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD--PQ-------------  405 (597)
T ss_dssp             ----------------------------CTTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TT-------------
T ss_pred             ----------------------------CcccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC--CC-------------
Confidence                                        12234445555555555555555555555554421  11             


Q ss_pred             cCCHHHHHHHHHHHHHhCCCCChhHHHHHHHHhHhcCCHHHHHHHHHhcC---CCCHHHHHHHHHHHHhCCCHHHHHHHH
Q 045600          668 INSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLI---YKDAFSWSVMINGYGLYGDGEAALELF  744 (899)
Q Consensus       668 ~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~  744 (899)
                                           +..+|+.++..|.+.|++++|.++|+++.   ..+..+|+.++.+|.+.|++++|+++|
T Consensus       406 ---------------------~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~  464 (597)
T 2xpi_A          406 ---------------------FGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYL  464 (597)
T ss_dssp             ---------------------CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHH
T ss_pred             ---------------------CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHH
Confidence                                 44456666667777777777777776664   336667777777777777777777777


Q ss_pred             HHHHHcCCCC-ChhHHHHHHHHHHccCCHHHHHHHHHHHHHc----CCccC--cchHHHHHHHHhhcCChHHHHHHHHhC
Q 045600          745 KQMQLSGVRP-NEITYLGVLSACSHAGLVEQSKMVFKSMVEH----GISQK--MEHYACMVDLLGRTGHLNEAFIFVKKL  817 (899)
Q Consensus       745 ~~m~~~g~~p-~~~t~~~l~~~~~~~g~~~~A~~~~~~m~~~----~~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~~  817 (899)
                      +++.+.  .| +..+|..++..|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.+.++++
T Consensus       465 ~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~  542 (597)
T 2xpi_A          465 QSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQG  542 (597)
T ss_dssp             HHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHH
T ss_pred             HHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHH
Confidence            777763  34 5667777777777777777777777777644    55665  467777777787888888887777776


Q ss_pred             -CC-CCCHHHHHHHHHHHHhhCCHHHHHHHHHHHHhcCCCCchhHHHHHHHHH
Q 045600          818 -PC-KPSVSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYA  868 (899)
Q Consensus       818 -~~-~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~y~  868 (899)
                       .. +.+..+|..++..|...|+.++|...++++++++|+++.++..|+++|.
T Consensus       543 ~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~  595 (597)
T 2xpi_A          543 LLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALE  595 (597)
T ss_dssp             HHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC
T ss_pred             HHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHh
Confidence             22 3356777788888888888888888888888888888888888877764
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 899
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.7 bits (91), Expect = 0.001
 Identities = 31/195 (15%), Positives = 65/195 (33%), Gaps = 9/195 (4%)

Query: 688 KHVAVSNALMDSYVRCGNISMARKLFGSLI---YKDAFSWSVMINGYGLYGDGEAALELF 744
                 + L   +   G I +A   F   +        ++  + N        + A+  +
Sbjct: 167 NFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAY 226

Query: 745 KQM-QLSGVRPNEITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGR 803
            +   LS         L         GL++ +   ++  +E       + Y  + + L  
Sbjct: 227 LRALSLSPNHAVVHGNLAC--VYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKE 283

Query: 804 TGHLNEAFIFVKK-LPCKPSVSILESLLG-ACRIHGNVELGEIISGMLFEMDPENPGSYV 861
            G + EA       L   P+ +   + L    R  GN+E    +     E+ PE   ++ 
Sbjct: 284 KGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHS 343

Query: 862 MLHNIYASAGRWEDA 876
            L ++    G+ ++A
Sbjct: 344 NLASVLQQQGKLQEA 358

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query899
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.86
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.39
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.07
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.05
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.05
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.0
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.85
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.85
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.85
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.82
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.81
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.79
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.67
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.64
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.53
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.53
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.52
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.42
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.39
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.37
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.27
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.25
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.24
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.2
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.19
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.09
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.06
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.04
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.97
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.95
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.91
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.87
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.78
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.72
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.64
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.62
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.6
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.56
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.55
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.46
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.45
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.41
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.39
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.31
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.13
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.12
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.96
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.81
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.2
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.77
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.25
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.24
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.99
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.92
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 87.65
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=1.6e-19  Score=194.12  Aligned_cols=370  Identities=10%  Similarity=0.047  Sum_probs=269.1

Q ss_pred             HHcCCChHHHHHHHhhcCC--C-ChhhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHhcCCChHHH
Q 045600          495 YSDGGQFSYAFTLFHRMST--R-SSVSWNTLISRCVQNGAVEEAVILLQRMQKEGVEL-DMVTLISFLPNLNKNGNIKQG  570 (899)
Q Consensus       495 ~~~~g~~~~A~~~~~~~~~--~-~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p-~~~t~~~ll~~~~~~g~~~~a  570 (899)
                      +.+.|++++|.+.++++.+  | +...+..+...+.+.|++++|+..|++..+.  .| +..++..+...+...|++++|
T Consensus         9 ~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~--~p~~~~a~~~l~~~~~~~g~~~~A   86 (388)
T d1w3ba_           9 EYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ--NPLLAEAYSNLGNVYKERGQLQEA   86 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHhhhhcccccc
Confidence            4455666666666665533  2 4556666666666777777777777766653  33 345666666666777777777


Q ss_pred             HHHHHHHHHhCCCCChhHHHHHHHHHHhcCChhhhhhHHHHhhcCCCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHCC
Q 045600          571 MVIHGYAIKTGCVADVTFLNALITMYCNCGSTNDGRLCLLLFQMGDKREISLWNAIISVYVQTNKAKQAVAFFTELLGAG  650 (899)
Q Consensus       571 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g  650 (899)
                      ...+....+...... .............+....+............................+....+...+.+.....
T Consensus        87 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (388)
T d1w3ba_          87 IEHYRHALRLKPDFI-DGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ  165 (388)
T ss_dssp             HHHHHHHHHHCTTCH-HHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC
T ss_pred             ccccccccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccC
Confidence            777766666543322 2222333333333333333322223333333444455555666667777777777777776653


Q ss_pred             CCCCHhHHHHHHHHhcccCCHHHHHHHHHHHHHhCCCCChhHHHHHHHHhHhcCCHHHHHHHHHhcC---CCCHHHHHHH
Q 045600          651 LEPDNVTVLSIISAGVLINSLNLTHSLMAFVIRKGLDKHVAVSNALMDSYVRCGNISMARKLFGSLI---YKDAFSWSVM  727 (899)
Q Consensus       651 ~~p~~~t~~~ll~a~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~l  727 (899)
                       +-+...+..+...+...|+.+.|...++...+..+. +...+..+...+...|++++|.+.+++..   ..+...+..+
T Consensus       166 -~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l  243 (388)
T d1w3ba_         166 -PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNL  243 (388)
T ss_dssp             -TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred             -cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHH
Confidence             334556666677778888888888888888776543 56678888899999999999999998876   4567788889


Q ss_pred             HHHHHhCCCHHHHHHHHHHHHHcCCCCC-hhHHHHHHHHHHccCCHHHHHHHHHHHHHcCCccCcchHHHHHHHHhhcCC
Q 045600          728 INGYGLYGDGEAALELFKQMQLSGVRPN-EITYLGVLSACSHAGLVEQSKMVFKSMVEHGISQKMEHYACMVDLLGRTGH  806 (899)
Q Consensus       728 i~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~t~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~  806 (899)
                      ...+.+.|++++|++.|++..+  +.|+ ..++..+...+...|++++|.+.++...... +.+...+..++.++...|+
T Consensus       244 ~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~  320 (388)
T d1w3ba_         244 ACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIKREQGN  320 (388)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHHHHCCC
Confidence            9999999999999999999988  6774 5688888899999999999999999888543 3455788889999999999


Q ss_pred             hHHHHHHHHhC-CCCCC-HHHHHHHHHHHHhhCCHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhcCC
Q 045600          807 LNEAFIFVKKL-PCKPS-VSILESLLGACRIHGNVELGEIISGMLFEMDPENPGSYVMLHNIYASAGR  872 (899)
Q Consensus       807 ~~~A~~~~~~~-~~~p~-~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~y~~~g~  872 (899)
                      +++|.+.+++. ...|+ ...+..++..+...|++++|+..++++++++|+++.++..||.+|.+.|+
T Consensus       321 ~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         321 IEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            99999999986 55565 55788899999999999999999999999999999999999999998885
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure