Citrus Sinensis ID: 045617

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLDYDETVDQLKNTGSKL
cccHHHHcccHHHHHHHHHHHccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccc
cEEEEEccccHHHHHHHHHHcccccHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccEEccccccc
malieckvgnptARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRkwdghvyaQNRVVVLREVLDHLDYDETVDQLKNTGSKL
malieckvgnptarrEMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELvnrkwdghvyaQNRVVVLREVLDhldydetvdqlkntgskl
MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLDYDETVDQLKNTGSKL
****************MVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLDYDET***********
*ALIE**VGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLD***************
MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLDYDETVDQLKNTGSKL
MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLDYDETV**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLDYDETVDQLKNTGSKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
147854693 241 hypothetical protein VITISV_029255 [Viti 1.0 0.402 0.536 4e-23
147854692 241 hypothetical protein VITISV_029254 [Viti 1.0 0.402 0.536 5e-23
225449581 241 PREDICTED: carnitinyl-CoA dehydratase-li 1.0 0.402 0.525 9e-23
225449583 240 PREDICTED: fatty acid oxidation complex 0.989 0.4 0.536 9e-22
297841079 240 enoyl-CoA hydratase/isomerase family pro 1.0 0.404 0.555 2e-21
255575181 246 carnitine racemase, putative [Ricinus co 0.989 0.390 0.546 5e-21
255575088 240 carnitine racemase, putative [Ricinus co 0.896 0.362 0.574 6e-21
15218713 240 delta(3), delta(2)-enoyl CoA isomerase 1 1.0 0.404 0.525 5e-20
110738037 239 hypothetical protein [Arabidopsis thalia 1.0 0.405 0.525 5e-20
224112807 235 predicted protein [Populus trichocarpa] 0.969 0.4 0.536 2e-19
>gi|147854693|emb|CAN82362.1| hypothetical protein VITISV_029255 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 77/97 (79%)

Query: 1   MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRK 60
           +ALI  K+G P ++RE++L+AAKL A +A+  GIID+A++S EETV+AA++LGEELV RK
Sbjct: 145 VALIRSKIGAPRSQRELMLRAAKLTAHDALNWGIIDSAHNSTEETVRAAIRLGEELVGRK 204

Query: 61  WDGHVYAQNRVVVLREVLDHLDYDETVDQLKNTGSKL 97
           WDGHVYAQ R+ +L +V D +  DE+V ++ +T ++L
Sbjct: 205 WDGHVYAQIRMRMLADVFDKVGCDESVGEVSHTRTRL 241

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147854692|emb|CAN82361.1| hypothetical protein VITISV_029254 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449581|ref|XP_002283937.1| PREDICTED: carnitinyl-CoA dehydratase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449583|ref|XP_002279179.1| PREDICTED: fatty acid oxidation complex subunit alpha [Vitis vinifera] gi|296086262|emb|CBI31703.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297841079|ref|XP_002888421.1| enoyl-CoA hydratase/isomerase family protein [Arabidopsis lyrata subsp. lyrata] gi|297334262|gb|EFH64680.1| enoyl-CoA hydratase/isomerase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255575181|ref|XP_002528495.1| carnitine racemase, putative [Ricinus communis] gi|223532104|gb|EEF33912.1| carnitine racemase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255575088|ref|XP_002528449.1| carnitine racemase, putative [Ricinus communis] gi|223532125|gb|EEF33932.1| carnitine racemase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15218713|ref|NP_176730.1| delta(3), delta(2)-enoyl CoA isomerase 1 [Arabidopsis thaliana] gi|2190542|gb|AAB60906.1| F5I14.5 gene product [Arabidopsis thaliana] gi|38454116|gb|AAR20752.1| At1g65520 [Arabidopsis thaliana] gi|46402478|gb|AAS92341.1| At1g65520 [Arabidopsis thaliana] gi|332196271|gb|AEE34392.1| delta(3), delta(2)-enoyl CoA isomerase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110738037|dbj|BAF00953.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224112807|ref|XP_002316298.1| predicted protein [Populus trichocarpa] gi|222865338|gb|EEF02469.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
TAIR|locus:2034178240 ECI1 ""delta(3), delta(2)-enoy 1.0 0.404 0.525 4.9e-21
TAIR|locus:2129740238 HCD1 "3-hydroxyacyl-CoA dehydr 0.835 0.340 0.487 1.6e-13
TAIR|locus:2129730240 IBR10 "indole-3-butyric acid r 0.886 0.358 0.448 2.1e-13
TAIR|locus:2034178 ECI1 ""delta(3), delta(2)-enoyl CoA isomerase 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 4.9e-21, P = 4.9e-21
 Identities = 52/99 (52%), Positives = 72/99 (72%)

Query:     1 MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRK 60
             MA+I  K+G+P ARR+++L AAK+ A   V+ GI+D+AY SA ETV+AA+KLGEE+V R 
Sbjct:   142 MAVIRGKIGSPAARRDVMLTAAKVTADVGVKMGIVDSAYGSAAETVEAAIKLGEEIVQRG 201

Query:    61 WDGHVYAQNRVVVLREVLDHL--DYDETVDQLKNTGSKL 97
              DGHVY + R  +LREVL H   +Y+     +++TGSKL
Sbjct:   202 GDGHVYGKMRESLLREVLIHTIGEYESGSSVVRSTGSKL 240
GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0008809 "carnitine racemase activity" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0004165 "dodecenoyl-CoA delta-isomerase activity" evidence=IGI
GO:0009062 "fatty acid catabolic process" evidence=IMP
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0015824 "proline transport" evidence=RCA
TAIR|locus:2129740 HCD1 "3-hydroxyacyl-CoA dehydratase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129730 IBR10 "indole-3-butyric acid response 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
PLN02267239 PLN02267, PLN02267, enoyl-CoA hydratase/isomerase 1e-42
>gnl|CDD|215151 PLN02267, PLN02267, enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information 
 Score =  138 bits (349), Expect = 1e-42
 Identities = 57/97 (58%), Positives = 75/97 (77%), Gaps = 1/97 (1%)

Query: 1   MALIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRK 60
           MAL+  K+G+P ARR+++L+AAKL A+EAVE GI+D+A+DSAEETV+AAV+LGEEL  RK
Sbjct: 144 MALLRAKIGSPAARRDVLLRAAKLTAEEAVEMGIVDSAHDSAEETVEAAVRLGEELAARK 203

Query: 61  WDGHVYAQNRVVVLREVLDHLDYDETVDQLKNTGSKL 97
           W+G VYA  R  +L EV   L  DE V++  +T SKL
Sbjct: 204 WNGEVYASIRKSLLPEVCGKLGLDEEVEE-SHTTSKL 239

Length = 239

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 97
PLN02267239 enoyl-CoA hydratase/isomerase family protein 99.71
PRK06213229 enoyl-CoA hydratase; Provisional 99.44
PRK05869222 enoyl-CoA hydratase; Validated 99.43
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 99.43
PRK06144262 enoyl-CoA hydratase; Provisional 99.42
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 99.42
PRK08150255 enoyl-CoA hydratase; Provisional 99.42
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 99.42
PLN02888265 enoyl-CoA hydratase 99.42
PLN02600251 enoyl-CoA hydratase 99.42
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 99.41
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 99.41
PRK08140262 enoyl-CoA hydratase; Provisional 99.41
PRK08252254 enoyl-CoA hydratase; Provisional 99.41
PRK08259254 enoyl-CoA hydratase; Provisional 99.41
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 99.41
PRK06143256 enoyl-CoA hydratase; Provisional 99.41
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 99.4
PRK06190258 enoyl-CoA hydratase; Provisional 99.4
PRK07938249 enoyl-CoA hydratase; Provisional 99.4
PRK07260255 enoyl-CoA hydratase; Provisional 99.4
PRK05864276 enoyl-CoA hydratase; Provisional 99.4
PRK07799263 enoyl-CoA hydratase; Provisional 99.4
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 99.39
PRK08258277 enoyl-CoA hydratase; Provisional 99.39
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 99.39
PRK08139266 enoyl-CoA hydratase; Validated 99.39
PRK05980260 enoyl-CoA hydratase; Provisional 99.39
PRK06494259 enoyl-CoA hydratase; Provisional 99.39
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 99.39
PRK06563255 enoyl-CoA hydratase; Provisional 99.39
PRK07327268 enoyl-CoA hydratase; Provisional 99.39
PRK05995262 enoyl-CoA hydratase; Provisional 99.38
PRK08138261 enoyl-CoA hydratase; Provisional 99.38
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 99.37
PRK09076258 enoyl-CoA hydratase; Provisional 99.37
PRK06142272 enoyl-CoA hydratase; Provisional 99.37
PRK03580261 carnitinyl-CoA dehydratase; Provisional 99.37
PRK05981266 enoyl-CoA hydratase; Provisional 99.37
PRK09245266 enoyl-CoA hydratase; Provisional 99.37
PRK06127269 enoyl-CoA hydratase; Provisional 99.37
PRK06495257 enoyl-CoA hydratase; Provisional 99.37
PRK07511260 enoyl-CoA hydratase; Provisional 99.36
PRK05862257 enoyl-CoA hydratase; Provisional 99.36
PRK12478298 enoyl-CoA hydratase; Provisional 99.36
PLN02921327 naphthoate synthase 99.36
PRK08272302 enoyl-CoA hydratase; Provisional 99.36
PRK08321302 naphthoate synthase; Validated 99.36
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 99.36
PRK07658257 enoyl-CoA hydratase; Provisional 99.36
PRK06210272 enoyl-CoA hydratase; Provisional 99.36
PRK08290288 enoyl-CoA hydratase; Provisional 99.35
PRK07657260 enoyl-CoA hydratase; Provisional 99.34
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 99.34
PRK06023251 enoyl-CoA hydratase; Provisional 99.34
PRK08260296 enoyl-CoA hydratase; Provisional 99.34
PRK05870249 enoyl-CoA hydratase; Provisional 99.34
PRK07659260 enoyl-CoA hydratase; Provisional 99.33
PRK06688259 enoyl-CoA hydratase; Provisional 99.31
PRK07468262 enoyl-CoA hydratase; Provisional 99.31
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 99.29
PRK08788287 enoyl-CoA hydratase; Validated 99.27
PRK07509262 enoyl-CoA hydratase; Provisional 99.24
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 99.19
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 99.18
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 99.16
PRK07854243 enoyl-CoA hydratase; Provisional 99.14
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.13
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 99.13
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 99.11
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.11
PRK07827260 enoyl-CoA hydratase; Provisional 99.05
PRK06072248 enoyl-CoA hydratase; Provisional 99.02
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 98.96
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 98.83
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 98.82
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.82
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.82
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.77
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 98.77
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 98.76
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.74
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 98.7
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 98.67
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 98.66
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 98.46
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.45
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 98.43
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 98.42
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 98.17
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 97.83
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 97.13
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 96.53
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 96.12
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 95.56
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 95.29
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 94.88
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 94.67
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 94.36
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 94.36
PRK10949618 protease 4; Provisional 93.77
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 93.77
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 93.43
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 93.1
PRK11778330 putative inner membrane peptidase; Provisional 92.9
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 92.58
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 91.69
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 91.39
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 90.58
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 90.49
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 90.39
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 90.34
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 90.09
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 90.06
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 89.89
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 88.79
smart0025038 PLEC Plectin repeat. 86.06
PF0068145 Plectin: Plectin repeat; InterPro: IPR001101 Plect 86.05
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 85.01
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 82.52
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 81.64
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 80.95
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information 
Probab=99.71  E-value=5.6e-17  Score=119.59  Aligned_cols=93  Identities=57%  Similarity=0.814  Sum_probs=83.0

Q ss_pred             hhhhhhCcHHHH-HHHHhcccCCCHHHHHHccchhhhcCChHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHhHHHHHhc
Q 045617            3 LIECKVGNPTAR-REMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHL   81 (97)
Q Consensus         3 l~r~kig~~~~a-~el~ltGrr~tA~EA~~~GlVd~v~~~~~~ll~~A~~lA~~la~~~~~~~a~~~~K~~l~~~~l~~~   81 (97)
                      .+..++| +.++ ++++|||++|+|+||+++||||+++|+.+++++.|.++|++++.+++++.++..+|+.+|+++|+++
T Consensus       146 ~l~~~vG-~~~a~~~llltG~~~~a~eA~~~Glv~~vv~~~~~l~~~a~~~A~~ia~~~~~~~~~~~~k~~~~~~~~~~~  224 (239)
T PLN02267        146 LLRAKIG-SPAARRDVLLRAAKLTAEEAVEMGIVDSAHDSAEETVEAAVRLGEELAARKWNGEVYASIRKSLLPEVCGKL  224 (239)
T ss_pred             HHHHHcC-hHHHHHHHHHcCCcCCHHHHHHCCCcceecCCHHHHHHHHHHHHHHHhhccCcccHHHHHHHHHHHHHHHHh
Confidence            4677898 6666 6999999999999999999999999865789999999999999988889999999999999999999


Q ss_pred             cCchhhhhhhhccCCC
Q 045617           82 DYDETVDQLKNTGSKL   97 (97)
Q Consensus        82 ~~~~~~~~~~~~~~~~   97 (97)
                      ..++++.+-. |-|||
T Consensus       225 ~~~~~~~~~~-~~~~~  239 (239)
T PLN02267        225 GLDEEVEESH-TTSKL  239 (239)
T ss_pred             cchhhhhhhh-cccCC
Confidence            9999998864 44554

>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>smart00250 PLEC Plectin repeat Back     alignment and domain information
>PF00681 Plectin: Plectin repeat; InterPro: IPR001101 Plectin may have a role in cross-linking intermediate filaments, in inter-linking intermediate filaments with microtubules and microfilaments and in anchoring intermediate filaments to the plasma and nuclear membranes Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 2e-04
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
 Score = 37.2 bits (87), Expect = 2e-04
 Identities = 13/49 (26%), Positives = 26/49 (53%)

Query: 8   VGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEEL 56
           +GN +   E+   A K+MA EA++ G++   +   +  + AA  L  ++
Sbjct: 163 IGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADI 211

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 99.47
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 99.46
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 99.43
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 99.43
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 99.43
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 99.43
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 99.42
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 99.42
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 99.42
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 99.42
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 99.42
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 99.41
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 99.41
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 99.41
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 99.41
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 99.41
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 99.41
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 99.4
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 99.4
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 99.4
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 99.4
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 99.4
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 99.4
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 99.4
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 99.4
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 99.4
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 99.4
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 99.39
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 99.39
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 99.39
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 99.39
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 99.39
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 99.39
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 99.39
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 99.39
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 99.39
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 99.39
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 99.38
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 99.38
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 99.38
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 99.38
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 99.37
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 99.37
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 99.37
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 99.37
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 99.37
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 99.37
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 99.36
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 99.36
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 99.36
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 99.35
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 99.35
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 99.35
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 99.35
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 99.35
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 99.35
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 99.35
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 99.34
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 99.34
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 99.34
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 99.34
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 99.32
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 99.31
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 99.28
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 99.27
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 99.27
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 99.25
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 99.2
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 99.19
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 98.97
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 98.94
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 98.91
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.83
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 98.81
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 98.8
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.79
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.73
3viv_A230 441AA long hypothetical NFED protein; protein-pept 97.58
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 97.56
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 97.14
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 96.69
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 96.59
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 94.37
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 93.29
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 92.64
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 92.51
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 92.45
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 92.25
2f6i_A215 ATP-dependent CLP protease, putative; structural g 90.68
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 89.59
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 89.29
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 85.52
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
Probab=99.47  E-value=6.7e-14  Score=101.34  Aligned_cols=73  Identities=21%  Similarity=0.265  Sum_probs=66.0

Q ss_pred             hhhhhhCcHHHHHHHHhcccCCCHHHHHHccchhhhcCChHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHhHHHHH
Q 045617            3 LIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLD   79 (97)
Q Consensus         3 l~r~kig~~~~a~el~ltGrr~tA~EA~~~GlVd~v~~~~~~ll~~A~~lA~~la~~~~~~~a~~~~K~~l~~~~l~   79 (97)
                      .+..++| +..+++++|||++|+|+||+++||||+++|+ ++++++|.++|++++.+  +|.++..+|+.++...-.
T Consensus       146 ~l~~~ig-~~~a~~l~ltg~~i~A~eA~~~GLv~~vv~~-~~l~~~a~~~a~~la~~--~~~a~~~~K~~l~~~~~~  218 (232)
T 3ot6_A          146 LARDRLR-KSAFNRSVINAEMFDPEGAMAAGFLDKVVSV-EELQGAALAVAAQLKKI--NMNAHKKTKLKVRKGLLD  218 (232)
T ss_dssp             HHHHHSC-HHHHHHHHTSCCEECHHHHHHHTSCSEEECT-TTHHHHHHHHHHHHTTS--CHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhC-HHHHHHHHHcCCccCHHHHHHCCCCCEecCH-HHHHHHHHHHHHHHHcC--CHHHHHHHHHHHHHHhHh
Confidence            3567898 8889999999999999999999999999986 79999999999999998  689999999999876533
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 99.47
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 99.43
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.41
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 99.41
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 99.4
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 99.39
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 99.33
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 99.32
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 99.29
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 99.29
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 99.27
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.17
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 99.0
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.92
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 92.12
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 91.04
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 90.16
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 89.46
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 88.59
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Carbapenem biosynthes protein CarB
species: Pectobacterium carotovorum [TaxId: 554]

Probab=99.47  E-value=4.8e-14  Score=99.90  Aligned_cols=76  Identities=13%  Similarity=0.274  Sum_probs=68.1

Q ss_pred             hhhhhhCcHHHHHHHHhcccCCCHHHHHHccchhhhcCChHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHhHHHHHhcc
Q 045617            3 LIECKVGNPTARREMVLKAAKLMAKEAVERGIIDAAYDSAEETVKAAVKLGEELVNRKWDGHVYAQNRVVVLREVLDHLD   82 (97)
Q Consensus         3 l~r~kig~~~~a~el~ltGrr~tA~EA~~~GlVd~v~~~~~~ll~~A~~lA~~la~~~~~~~a~~~~K~~l~~~~l~~~~   82 (97)
                      .+...+| +..+++++|||++|+|+||+++||||+++|+ +++++++.++|+++++.  +|.++..+|+.+++.....+.
T Consensus       144 ~l~~~iG-~~~a~~l~l~g~~~~a~eA~~~Glv~~vv~~-~~l~~~a~~~a~~ia~~--~~~a~~~~K~~l~~~~~~~l~  219 (230)
T d2a7ka1         144 ILGFTHG-FSTMQEIIYQCQSLDAPRCVDYRLVNQVVES-SALLDAAITQAHVMASY--PASAFINTKRAVNKPFIHLLE  219 (230)
T ss_dssp             HHHHHHC-HHHHHHHHHHCCCBCHHHHHHHTCCSEEECH-HHHHHHHHHHHHHHHTS--CHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccccc-cccccccccccccchHHHHHHhhhcccCCCh-HHHHHHHHHHHHHHHcC--CHHHHHHHHHHHHHHHhccHH
Confidence            3667899 8889999999999999999999999999985 89999999999999988  689999999999887655554
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure