Citrus Sinensis ID: 045766

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660---

MSLPLTPSKRPHDDDNHTEPNGKEKSQKLAGDYSENQPSKSFPGGIMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETVSGSDERLVVIEASDNKKETSENLEASIERSENNGREEASVADESDNKKEDSVNEGSVLMDGLNSEKETSKVQKALLLVFERMVEVEPETEVADQENTKSSKFVLRLLVLSTQVGCLLGKGGCVIKQIDKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLPDHSVSSQGAPYATGHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIARAIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRDAFPSINRPLNPTFLDQVSPFPSFIGRRELSPPGMYSNFGPSFHKFDAVGGPPPPGSFHPHDDHSAFMHHIHRPGMPPHMPDMKPWGPQGLMEVGGPMGFPDFVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGTPEQTHAAQSLIQAFVMSETETT

cccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEcccccHHHHHHHHHHcccEEEccccccccccEEEEEcccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEcccccEEEcccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEccccHHHHHHHHHHcccEEEccccccccccEEEEEcccccccccccHHHHHHHHHHcccccccccccccEEEEEEEEcccccEEEcccccHHHHHHHHHccEEEEccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccEEcccccHHHHHHHHcccEEEEEccccccccEEEEEEccHHHHHHHHHHHHHHHHHccccc

ccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccEEEEEccccHHHHHHHHHcccEEEEcccccccccEEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEccccEEEEEcccccHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEccccHHHHHHHHcccEEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccEEEEEccccHHHHHHHHHcccEEEEEccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEccccHHHHHHHHHcccEEEEEccccccccEEEEEEccHHHHHHHHHHHHHHHHHHcccc

mslpltpskrphdddnhtepngkeksqklagdysenqpsksfpggimfrvlcpvskidgvigkdgemMSQISQDTGVTIRVEETVSGSDERLVVIEAsdnkketsENLEASIERSenngreeasvadesdnkkedsvnegsvlmdglnsekETSKVQKALLLVFERMVevepetevadqentkssKFVLRLLVLSTQVgcllgkggcvikqidklptcalasdEVVQITGEVDTVRKALKLISHQlldnsprdhesipgnptgpshplpdhsvssqgapyatghrdvadihlpmppsipkfhesgvldrpkpspeiLTFRLLChdervggvigkGGAIIRSLKQetgcdikvmeavsgtedrlivisgpahpddrisapqDAVLRVQTRIAraipdnreQTVMTRLLVASNQIgcllgkggSIIAEMRKLSGAYIRILgkdqipkcaseneevVLINGEFEAVQEALFQITTRLRHhffrdafpsinrplnptfldqvspfpsfigrrelsppgmysnfgpsfhkfdavggppppgsfhphddhsafmhhihrpgmpphmpdmkpwgpqglmevggpmgfpdfvgpphrrvpvvvprslvpiiqgedgaCLKQIRQISdakititdpkpgateTVIIISGTPEQTHAAQSLIQAFVMSETETT

mslpltpskrphdddnhtepngkeksqklAGDYSENQPSKSFPGGIMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEetvsgsderlvvieasdnkketsenleasiersenngreeasvadesdnkkedsvnEGSVlmdglnseketSKVQKALLLVFERMVEVepetevadqentksskFVLRLLVLSTQVGCLLGKGGCVIKQIDKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLPDHSVSSQGAPYATGHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISGpahpddrisapqDAVLRVQTRIaraipdnreqTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRDAFPSINRPLNPTFLDQVSPFPSFIGRRELSPPGMYSNFGPSFHKFDAVGGPPPPGSFHPHDDHSAFMHHIHRPGMPPHMPDMKPWGPQGLMEVGGPMGFPDFVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDakititdpkpgATETVIIISGTPEQTHAAQSLIQAFVMSETETT

MSLPLTPSKRPHDDDNHTEPNGKEKSQKLAGDYSENQPSKSFPGGIMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETVSGSDERLVVIEASDNKKETSENLEASIERSENNGREEASVADESDNKKEDSVNEGSVLMDGLNSEKETSKVQKALLLVFERMVEVEPETEVADQENTKSSKFVLRLLVLSTQVGCLLGKGGCVIKQIDKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLPDHSVSSQGAPYATGHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERvggvigkggaiiRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIARAIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRDAFPSINRPLNPTFLDQVSPFPSFIGRRELSPPGMYSNFGPSFHKFDAVggppppgSFHPHDDHSAFMHHIHRPGMPPHMPDMKPWGPQGLMEVGGPMGFPDFvgpphrrvpvvvprslvpIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGTPEQTHAAQSLIQAFVMSETETT

*******************************************GGIMFRVLCPVSKIDGVIGKD************VTI******************************************************************************KALLLVFERMVEV***************KFVLRLLVLSTQVGCLLGKGGCVIKQIDKLPTCALASDEVVQITGEVDTVRKALKLISHQL********************************************************************EILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISG************DAVLRVQTRIARAIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRDAFPSINRPLNPTFLDQVSPFPSFIG*******************************************************************VGGPMGFPDFVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGT*********LI***********

***********************************************FRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETV*GSDERLVVIEASDNKKETSENLEASIERSENNGREEASVADE**************************KVQKALLLVFERM*******************FVLRLLVLSTQVGCLLGKGGCVIKQIDK*******SDEVVQITGEVDTVRKALKLISHQLLDNSP*********PTGPSHPL****VSSQGAPYATGHR******************************ILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRV***************VMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHF*************************************************************************H***MPP***********************DFVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDA***********TETVIIISGTPEQTHAAQSLIQA**MS*****

*************************************PSKSFPGGIMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETVSGSDERLVVIEAS****************************************EGSVLMDGLNSEKETSKVQKALLLVFERMVEV**********NTKSSKFVLRLLVLSTQVGCLLGKGGCVIKQIDKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLPDHSVSSQGAPYATGHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIARAIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRDAFPSINRPLNPTFLDQVSPFPSFIGRRELSPPGMYSNFGPSFHKFDAVGGPPPPGSFHPHDDHSAFMHHIHRPGMPPHMPDMKPWGPQGLMEVGGPMGFPDFVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGTPEQTHAAQSLIQAFVMSETETT

*****************************************FPGGIMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETVSGSDERLVVIEASDNKKETSENLEASIERSEN**************KKED*V************EKETSKVQKALLLVFERMVEVE************SSKFVLRLLVLSTQVGCLLGKGGCVIKQIDKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLPDHSVSSQGAPYATGHR****************************PEILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIARAIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRD*****NRPLNPTFLDQVSPFPSFIGRRELSPPGMYSNFGPSFHKFDAVGGPPPPGSFHPHDDHSAFMHHIH*PGMPP****************************PHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGTPEQTHAAQSLIQAFVMSE****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSLPLTPSKRPHDDDNHTEPNGKEKSQKLAGDYSENQPSKSFPGGIMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETVSGSDERLVVIEAxxxxxxxxxxxxxxxxxxxxxGREEASVADESDNKKEDSVNEGSVLMDGLNSEKETSKVQKALLLVFERMVEVEPETEVADQENTKSSKFVLRLLVLSTQVGCLLGKGGCVIKQIDKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLPDHSVSSQGAPYATGHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIARAIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRDAFPSINRPLNPTFLDQVSPFPSFIGRRELSPPGMYSNFGPSFHKFDAVGGPPPPGSFHPHDDHSAFMHHIHRPGMPPHMPDMKPWGPQGLMEVGGPMGFPDFVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGTPEQTHAAQSLIQAFVMSETETT

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		663	2.2.26 [Sep-21-2011]
P58223		606	KH domain-containing prot	no	no	0.764	0.836	0.267	2e-41
P57722		371	Poly(rC)-binding protein	yes	no	0.452	0.808	0.290	2e-21
P57721		371	Poly(rC)-binding protein	yes	no	0.452	0.808	0.290	2e-21
Q15366		365	Poly(rC)-binding protein	no	no	0.482	0.876	0.262	3e-18
O19048		356	Poly(rC)-binding protein	no	no	0.473	0.882	0.251	7e-17
P60335		356	Poly(rC)-binding protein	no	no	0.473	0.882	0.251	7e-17
Q15365		356	Poly(rC)-binding protein	no	no	0.473	0.882	0.251	7e-17
Q5E9A3		356	Poly(rC)-binding protein	yes	no	0.473	0.882	0.251	7e-17
Q9CPN8		579	Insulin-like growth facto	no	no	0.541	0.620	0.233	4e-12
O00425		579	Insulin-like growth facto	no	no	0.529	0.606	0.244	6e-12

>sp\|P58223\|Y4837_ARATH KH domain-containing protein At4g18375 OS=Arabidopsis thaliana GN=At4g18375 PE=2 SV=1	Back alignment and function desciption

 Score =  171 bits (433), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 181/676 (26%), Positives = 294/676 (43%), Gaps = 169/676 (25%)

Query: 46  IMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETVSGSDERLVVIEASDNKKETS 105
           +++R+LCP+  + GVIGK G++++ I  +T   I+V + + G  +R++ I  S  +K+  
Sbjct: 36  VVYRILCPIDVVGGVIGKSGKVINAIRHNTKAKIKVFDQLHGCSQRVITIYCSVKEKQE- 94

Query: 106 ENLEASIERSENNGREEASVADESDNKKEDSVNEGSVLMDGLNSEKETSKVQKALLLVFE 165
              E    +SEN   E    A                              Q ALL V++
Sbjct: 95  ---EIGFTKSEN---EPLCCA------------------------------QDALLKVYD 118

Query: 166 RMVEVEPETEV---ADQENTKSSKFVLRLLVLSTQVGCLLGKGGCVIKQI---------- 212
            +V  + E       D+++ K      RLLV  +Q   L+GK G  IK+I          
Sbjct: 119 AIVASDEENNTKTNVDRDDNKE----CRLLVPFSQSSSLIGKAGENIKRIRRRTRASVKV 174

Query: 213 ------DKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSH 266
                 D    CA+  D VV I+GE ++V++AL  +S  +   +PR  E+IP + T    
Sbjct: 175 VSKDVSDPSHVCAMEYDNVVVISGEPESVKQALFAVSAIMYKINPR--ENIPLDSTSQDV 232

Query: 267 PLPD--------HSVSSQGAPYAT------------------------GHRDVADIHLPM 294
           P           +SV  Q   Y+                         G+ + A   +P+
Sbjct: 233 PAASVIVPSDLSNSVYPQTGFYSNQDHILQQGAGVPSYFNALSVSDFQGYAETAANPVPV 292

Query: 295 -PPSIPKFHESGVLDRPKPSPEILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVM 353
              S+P  H  G   R     E L F++LC    +  VIGKGG+ I+ +++ +G  I+V 
Sbjct: 293 FASSLPVTHGFGGSSRS----EELVFKVLCPLCNIMRVIGKGGSTIKRIREASGSCIEVN 348

Query: 354 EAVS--GTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIARAIPDNREQTVMTRLLVASN 411
           ++ +  G ++ +I+++    PDD  S   +AVL +Q      I D   + V  +LLV+S 
Sbjct: 349 DSRTKCGDDECVIIVTATESPDDMKSMAVEAVLLLQ----EYINDEDAENVKMQLLVSSK 404

Query: 412 QIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQIT 471
            IGC++GK GS+I E+RK + A I I           + +++V ++GE  +V++AL QI 
Sbjct: 405 VIGCVIGKSGSVINEIRKRTNANICI--------SKGKKDDLVEVSGEVSSVRDALIQIV 456

Query: 472 TRLRHHFF--RDAFPSIN---RPLNPTFLDQVS----PFPSFIGRRELSPPGMYSNFGPS 522
            RLR      +D+  +     R  N +FL   S      PSF+         M S  G  
Sbjct: 457 LRLREDVLGDKDSVATRKPPARTDNCSFLSGSSNAGYTLPSFM-------SSMASTSG-- 507

Query: 523 FHKFDAVGGPPPPGSFHPHDDHSAFMHHIHRPGMPPHMPDMKPWGPQGLMEVGGPMGFPD 582
           FH +         GSF   D+                           ++   GP  +  
Sbjct: 508 FHGY---------GSFPAGDN---------------------------VLGSTGPYSYGR 531

Query: 583 FVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGTP 642
              P    + +++P   +  + G+ G  L+ IR+IS A I I+  K    + + ++SGT 
Sbjct: 532 L--PSSSALEILIPAHAMSKVMGKGGGNLENIRRISGAMIEISASKTSHGDHIALLSGTL 589

Query: 643 EQTHAAQSLIQAFVMS 658
           EQ   A++L+QAFVMS
Sbjct: 590 EQMRCAENLVQAFVMS 605

Arabidopsis thaliana (taxid: 3702)

>sp\|P57722\|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=2 SV=3	Back alignment and function description

>sp\|P57721\|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2	Back alignment and function description

>sp\|Q15366\|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1	Back alignment and function description

>sp\|O19048\|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1	Back alignment and function description

>sp\|P60335\|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1	Back alignment and function description

>sp\|Q15365\|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2	Back alignment and function description

>sp\|Q5E9A3\|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1	Back alignment and function description

>sp\|Q9CPN8\|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus GN=Igf2bp3 PE=1 SV=1	Back alignment and function description

>sp\|O00425\|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		663
224067136		680	predicted protein [Populus trichocarpa]	0.957	0.933	0.596	0.0
225458964		701	PREDICTED: KH domain-containing protein	0.981	0.928	0.614	0.0
302142130		672	unnamed protein product [Vitis vinifera]	0.941	0.928	0.609	0.0
255537898		679	Poly(rC)-binding protein, putative [Rici	0.948	0.926	0.591	0.0
147845094		709	hypothetical protein VITISV_026793 [Viti	0.912	0.853	0.593	0.0
356507955		678	PREDICTED: KH domain-containing protein	0.956	0.935	0.533	0.0
356518382		676	PREDICTED: KH domain-containing protein	0.960	0.942	0.534	0.0
449436912		693	PREDICTED: KH domain-containing protein	0.980	0.937	0.526	0.0
357466759		662	Poly(rC)-binding protein [Medicago trunc	0.939	0.941	0.507	1e-172
357128987		729	PREDICTED: KH domain-containing protein	0.945	0.860	0.381	1e-118

>gi\|224067136\|ref\|XP_002302373.1\| predicted protein [Populus trichocarpa] gi\|222844099\|gb\|EEE81646.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/708 (59%), Positives = 504/708 (71%), Gaps = 73/708 (10%)

Query: 1   MSLPLTPSKRPHDDDNHTEPNGKEKSQKLAGDYSENQPSKSFPGGIMFRVLCPVSKIDGV 60
           MS  LTPSKR HD  + TE NGK K Q  AG  S NQP KS P  ++FR+LCP  KI  V
Sbjct: 1   MSTALTPSKRLHDSKS-TETNGKGKRQNTAGTNSPNQPLKSSPAAVVFRILCPAPKIGTV 59

Query: 61  IGKDGEMMSQISQDTGVTIRVEETVSGSDERLVVIEASDNKKETSENLEASIERSENNGR 120
            G+ G ++SQI Q+TG  + VEE + G DE+++VI  SD      E  E SIE+S+ +G 
Sbjct: 60  TGEGGAVISQIRQETGAKVIVEENIPGCDEQIIVITGSD------EKTEVSIEQSKKDGD 113

Query: 121 EEASVADESDNKKEDSVNEG---SVLMDGLNSEKETSKVQKALLLVFERMVEVEPETEVA 177
           EEA+VA+ESDNK + +  E     V ++   + KETS +QKALLLV  +M E +P T+  
Sbjct: 114 EEANVAEESDNKNDGNEKEEEKEGVPVEDSGTVKETSSMQKALLLVSGKMFEADPVTDGG 173

Query: 178 DQENTKSSKFVLRLLVLSTQVGCLLGKGGCVIKQI-------------DKLPTCALASDE 224
           D+EN K S F+LRLLVLS+QVGCLLGKGG VIKQ+             D+LP C+  SDE
Sbjct: 174 DEENNKPSTFILRLLVLSSQVGCLLGKGGSVIKQMSAESGAQIRISPRDRLPICSSVSDE 233

Query: 225 VVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTG------------PSHPLPDHS 272
           +V+ITGE+D VRKAL+ +S QLL+N PRDH+S P NP+G            P   L  HS
Sbjct: 234 LVEITGEIDAVRKALQSVSKQLLENPPRDHDSFPANPSGTSSHSSGHSHPRPEAYLQRHS 293

Query: 273 VSSQGAPYATGHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERVGGVI 332
            S +G PYA   RD               HES + D+ KP P++LTFRLLCH+ERVGGVI
Sbjct: 294 FSGRGKPYAVRSRD--------------RHESVIQDQMKPVPDVLTFRLLCHNERVGGVI 339

Query: 333 GKGGAIIRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIAR 392
           GKGG II+ LKQETGCDIKVME VS +EDR+IVISG AHPDDRISAPQDAV+RVQTRIA 
Sbjct: 340 GKGGTIIKILKQETGCDIKVMEGVSDSEDRVIVISGLAHPDDRISAPQDAVIRVQTRIAM 399

Query: 393 AIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEE 452
           AI  N+E+ ++ RLLV+SNQIGCLLGKGG+I++EMRK SGAYIRILGKDQIP CASE+E 
Sbjct: 400 AI-SNKEKAIIARLLVSSNQIGCLLGKGGAIMSEMRKSSGAYIRILGKDQIPNCASESEG 458

Query: 453 VVLINGEFEAVQEALFQITTRLRHHFFRDAFPSINRPLNPTFLDQVSPFPSFIGRRELSP 512
           VV INGEFE V+EAL QITTRLRHHFF++ FPS++   NP FLDQV PFP ++GR+ELSP
Sbjct: 459 VVQINGEFEVVKEALLQITTRLRHHFFQNLFPSMDHLSNPAFLDQVPPFPPYMGRKELSP 518

Query: 513 PGMYSNFGPSFHKFDAVGGPPPPGSFHPHDDHSAFMHHIHRPGMPPHMPDMKPWGPQGLM 572
           P        SF  FD + G PP  SF PHDDH  FMH+IHRPGMPPH+ + KPWGPQG +
Sbjct: 519 PFH------SFPNFDGMVGAPPHVSFPPHDDHPPFMHNIHRPGMPPHIAERKPWGPQGFV 572

Query: 573 EVGGPMGFPDFVGPPHRRVP-----------------VVVPRSLVPIIQGEDGACLKQIR 615
           E GGPMG PDF GPP RR+                  V+VPR++VP+I GEDGACLKQIR
Sbjct: 573 EGGGPMGLPDFAGPPQRRISGFGGVSHPAIITSTTIEVIVPRTIVPVIYGEDGACLKQIR 632

Query: 616 QISDAKITITDPKPGATETVIIISGTPEQTHAAQSLIQAFVMSETETT 663
           QISDAKITI +PKPGA+ETVIIISGTPEQTHAAQSLIQAFVMSE E++
Sbjct: 633 QISDAKITINEPKPGASETVIIISGTPEQTHAAQSLIQAFVMSERESS 680

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225458964\|ref\|XP_002283591.1\| PREDICTED: KH domain-containing protein At4g18375-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|302142130\|emb\|CBI19333.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255537898\|ref\|XP_002510014.1\| Poly(rC)-binding protein, putative [Ricinus communis] gi\|223550715\|gb\|EEF52201.1\| Poly(rC)-binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|147845094\|emb\|CAN78473.1\| hypothetical protein VITISV_026793 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356507955\|ref\|XP_003522728.1\| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max]	Back alignment and taxonomy information

>gi\|356518382\|ref\|XP_003527858.1\| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max]	Back alignment and taxonomy information

>gi\|449436912\|ref\|XP_004136236.1\| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] gi\|449522219\|ref\|XP_004168125.1\| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357466759\|ref\|XP_003603664.1\| Poly(rC)-binding protein [Medicago truncatula] gi\|355492712\|gb\|AES73915.1\| Poly(rC)-binding protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357128987\|ref\|XP_003566150.1\| PREDICTED: KH domain-containing protein At4g18375-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		663
TAIR\|locus:2017612		621	AT1G51580 "AT1G51580" [Arabido	0.873	0.932	0.322	3.3e-63
TAIR\|locus:2150956		548	AT5G15270 "AT5G15270" [Arabido	0.497	0.602	0.355	3.5e-52
TAIR\|locus:2168367		652	RCF3 "AT5G53060" [Arabidopsis	0.402	0.409	0.323	7.1e-51
TAIR\|locus:2161413		644	AT5G46190 "AT5G46190" [Arabido	0.333	0.343	0.317	5.4e-41
TAIR\|locus:2035807		479	AT1G14170 "AT1G14170" [Arabido	0.493	0.682	0.294	1.2e-34
TAIR\|locus:2831364		606	AT4G18375 "AT4G18375" [Arabido	0.340	0.372	0.281	3.2e-32
TAIR\|locus:2066020		632	AT2G22600 "AT2G22600" [Arabido	0.600	0.629	0.264	2.4e-25
TAIR\|locus:2084908		577	FLK "AT3G04610" [Arabidopsis t	0.497	0.571	0.258	1.4e-21
TAIR\|locus:2120755		495	PEP "AT4G26000" [Arabidopsis t	0.203	0.272	0.375	3.4e-18
UNIPROTKB\|J3QT27		322	PCBP3 "Poly(rC)-binding protei	0.285	0.586	0.273	9.1e-16

TAIR\|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 645 (232.1 bits), Expect = 3.3e-63, P = 3.3e-63
 Identities = 204/632 (32%), Positives = 305/632 (48%)

Query:    46 IMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEETVS-GSDERLVVIEASDNKKET 104
             + FR+LCP ++   +IGK G ++  +   TG  IRV + +   S+ER+V+I A   KK+ 
Sbjct:    19 VHFRLLCPATRTGAIIGKGGSVIRHLQSVTGSKIRVIDDIPVPSEERVVLIIAPSGKKKD 78

Query:   105 SENLEASIERSENNGREEASVADESDNKKEDSVNEGSVLMDGLNSEKETSKVQKALLLVF 164
                 E+++  SEN G EE          K++  +E +    G + E+  S  Q ALL VF
Sbjct:    79 ----ESNVCDSENPGSEEP---------KQEKGSECAGTSGG-DDEEAPSSAQMALLRVF 124

Query:   165 ERMVEVEPETEVADQENTKS-SKFVLRLLVLSTQVGCLLGKGGCVIKQI----------- 212
             ER+V  +    V   E  K  S+ + R++V   QV  L+ KGG +I++I           
Sbjct:   125 ERIVFGDDAATVDGDELDKGESEGLCRMIVRGNQVDYLMSKGGKMIQKIREDSGAIVRIS 184

Query:   213 --DKLPTCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLPD 270
               D++P CA   D V+Q+ G+  +V+KAL L+++ L ++        P  PT    P P 
Sbjct:   185 STDQIPPCAFPGDVVIQMNGKFSSVKKALLLVTNCLQESGA------P--PTWDECPFPQ 236

Query:   271 HSVSSQGAPYATGHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERXXX 330
                  +   ++  +    D H   PP  P   + G  +RP    E+  FRLLC  ++   
Sbjct:   237 PGYPPEY--HSMEYHPQWD-H---PPPNPMPEDVGPFNRPVVEEEV-AFRLLCPADKVGS 289

Query:   331 XXXXXXXXXRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRI 390
                      R+L+ E+G  IKV +    +E+R+IVIS   + + R S  QD V+RV  RI
Sbjct:   290 LIGKGGAVVRALQNESGASIKVSDPTHDSEERIIVISARENLERRHSLAQDGVMRVHNRI 349

Query:   391 ARAIPDNREQTVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASEN 450
                I       V+ RLLV S  IG LLGKGG +I+EMR+ +GA IR+  KDQ  K  S++
Sbjct:   350 VE-IGFEPSAAVVARLLVHSPYIGRLLGKGGHLISEMRRATGASIRVFAKDQATKYESQH 408

Query:   451 EEVVLINGEFEAVQEALFQITTRLRHHFF--RDAFPSINRPLNPTFLDQVSPFPSFIGRR 508
             +E+V + G  + VQ+ALFQI  RLR   F  R  F  +  P  P       P P F G R
Sbjct:   409 DEIVQVIGNLKTVQDALFQILCRLREAMFPGRLPFQGMGGPPPPFMGPYPEPPPPF-GPR 467

Query:   509 EL--SPPGMYSNFGPSFHKFDAVXXXXXXXSFHPHDDHSAFMHHIHRPGMPPHMPDMKPW 566
             +   SP   +S  GP FH+                D   + M    +PG+  H   M P 
Sbjct:   468 QYPASPDRYHSPVGP-FHERHCHGPGFDRPPGPGFDRPPSPMSWTPQPGIDGHPGGMVPP 526

Query:   567 GPQ-GLMEVGGPMGFPDFXXXXXXXXXXXXXXXXXXIIQGEDGACLKQIRQISDAKITIT 625
                 G      P+G  +                   +  GE+ + L  I+Q+S A + + 
Sbjct:   527 DVNHGFALRNEPIGSENPVMTSANVEIVIPQAYLGHVY-GENCSNLNYIKQVSGANVVVH 585

Query:   626 DPKPGATETVIIISGTPEQTHAAQSLIQAFVM 657
             DPK G TE ++++SGT +Q H AQSL+ AF++
Sbjct:   586 DPKAGTTEGLVVVSGTSDQAHFAQSLLHAFIL 617

GO:0003676 "nucleic acid binding" evidence=ISS

GO:0003723 "RNA binding" evidence=IEA

TAIR\|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2168367 RCF3 "AT5G53060" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2035807 AT1G14170 "AT1G14170" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2831364 AT4G18375 "AT4G18375" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2066020 AT2G22600 "AT2G22600" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2084908 FLK "AT3G04610" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2120755 PEP "AT4G26000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|J3QT27 PCBP3 "Poly(rC)-binding protein 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00021041	hypothetical protein (681 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		663
cd02396		65	cd02396, PCBP_like_KH, K homology RNA-binding doma	9e-19
cd02396		65	cd02396, PCBP_like_KH, K homology RNA-binding doma	2e-14
cd00105		64	cd00105, KH-I, K homology RNA-binding domain, type	3e-12
cd02396		65	cd02396, PCBP_like_KH, K homology RNA-binding doma	7e-12
cd00105		64	cd00105, KH-I, K homology RNA-binding domain, type	5e-11
cd02396		65	cd02396, PCBP_like_KH, K homology RNA-binding doma	6e-11
cd00105		64	cd00105, KH-I, K homology RNA-binding domain, type	2e-10
pfam00013		59	pfam00013, KH_1, KH domain	3e-10
pfam13014		42	pfam13014, KH_3, KH domain	6e-10
smart00322		68	smart00322, KH, K homology RNA-binding domain	1e-09
pfam00013		59	pfam00013, KH_1, KH domain	2e-09
smart00322		68	smart00322, KH, K homology RNA-binding domain	9e-09
cd00105		64	cd00105, KH-I, K homology RNA-binding domain, type	1e-08
pfam00013		59	pfam00013, KH_1, KH domain	1e-07
pfam00013		59	pfam00013, KH_1, KH domain	8e-07
pfam13014		42	pfam13014, KH_3, KH domain	4e-06
pfam13014		42	pfam13014, KH_3, KH domain	6e-06
cd00105		64	cd00105, KH-I, K homology RNA-binding domain, type	1e-05
smart00322		68	smart00322, KH, K homology RNA-binding domain	1e-05
cd02396		65	cd02396, PCBP_like_KH, K homology RNA-binding doma	3e-05
smart00322		68	smart00322, KH, K homology RNA-binding domain	4e-05
cd02394		62	cd02394, vigilin_like_KH, K homology RNA-binding d	5e-05
pfam00013		59	pfam00013, KH_1, KH domain	8e-05
cd02394		62	cd02394, vigilin_like_KH, K homology RNA-binding d	2e-04
pfam13014		42	pfam13014, KH_3, KH domain	3e-04
smart00322		68	smart00322, KH, K homology RNA-binding domain	0.002
COG0195		190	COG0195, NusA, Transcription elongation factor [Tr	0.003

>gnl\|CDD\|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like	Back alignment and domain information

 Score = 80.2 bits (199), Expect = 9e-19
 Identities = 30/67 (44%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 405 RLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQ 464
           RLLV S+Q G ++GKGGS I E+R+ +GA IR+             E VV I+G+  AVQ
Sbjct: 3   RLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVL----PGSTERVVTISGKPSAVQ 58

Query: 465 EALFQIT 471
           +AL  I 
Sbjct: 59  KALLLIL 65

Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65

>gnl\|CDD\|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like	Back alignment and domain information

>gnl\|CDD\|238053 cd00105, KH-I, K homology RNA-binding domain, type I	Back alignment and domain information

>gnl\|CDD\|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like	Back alignment and domain information

>gnl\|CDD\|238053 cd00105, KH-I, K homology RNA-binding domain, type I	Back alignment and domain information

>gnl\|CDD\|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like	Back alignment and domain information

>gnl\|CDD\|238053 cd00105, KH-I, K homology RNA-binding domain, type I	Back alignment and domain information

>gnl\|CDD\|215657 pfam00013, KH_1, KH domain	Back alignment and domain information

>gnl\|CDD\|221895 pfam13014, KH_3, KH domain	Back alignment and domain information

>gnl\|CDD\|197652 smart00322, KH, K homology RNA-binding domain	Back alignment and domain information

>gnl\|CDD\|215657 pfam00013, KH_1, KH domain	Back alignment and domain information

>gnl\|CDD\|197652 smart00322, KH, K homology RNA-binding domain	Back alignment and domain information

>gnl\|CDD\|238053 cd00105, KH-I, K homology RNA-binding domain, type I	Back alignment and domain information

>gnl\|CDD\|215657 pfam00013, KH_1, KH domain	Back alignment and domain information

>gnl\|CDD\|215657 pfam00013, KH_1, KH domain	Back alignment and domain information

>gnl\|CDD\|221895 pfam13014, KH_3, KH domain	Back alignment and domain information

>gnl\|CDD\|221895 pfam13014, KH_3, KH domain	Back alignment and domain information

>gnl\|CDD\|238053 cd00105, KH-I, K homology RNA-binding domain, type I	Back alignment and domain information

>gnl\|CDD\|197652 smart00322, KH, K homology RNA-binding domain	Back alignment and domain information

>gnl\|CDD\|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like	Back alignment and domain information

>gnl\|CDD\|197652 smart00322, KH, K homology RNA-binding domain	Back alignment and domain information

>gnl\|CDD\|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like	Back alignment and domain information

>gnl\|CDD\|215657 pfam00013, KH_1, KH domain	Back alignment and domain information

>gnl\|CDD\|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like	Back alignment and domain information

>gnl\|CDD\|221895 pfam13014, KH_3, KH domain	Back alignment and domain information

>gnl\|CDD\|197652 smart00322, KH, K homology RNA-binding domain	Back alignment and domain information

>gnl\|CDD\|223273 COG0195, NusA, Transcription elongation factor [Transcription]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		663
KOG2193		584	consensus IGF-II mRNA-binding protein IMP, contain	100.0
KOG1676		600	consensus K-homology type RNA binding proteins [RN	100.0
KOG2190		485	consensus PolyC-binding proteins alphaCP-1 and rel	100.0
KOG1676		600	consensus K-homology type RNA binding proteins [RN	100.0
KOG2192		390	consensus PolyC-binding hnRNP-K protein HRB57A/hnR	100.0
KOG2193		584	consensus IGF-II mRNA-binding protein IMP, contain	100.0
KOG2192		390	consensus PolyC-binding hnRNP-K protein HRB57A/hnR	99.97
KOG2190		485	consensus PolyC-binding proteins alphaCP-1 and rel	99.96
KOG2191		402	consensus RNA-binding protein NOVA1/PASILLA and re	99.93
KOG2191		402	consensus RNA-binding protein NOVA1/PASILLA and re	99.92
TIGR03665		172	arCOG04150 arCOG04150 universal archaeal KH domain	99.6
PRK13763		180	putative RNA-processing protein; Provisional	99.54
TIGR03665		172	arCOG04150 arCOG04150 universal archaeal KH domain	99.53
PRK13763		180	putative RNA-processing protein; Provisional	99.49
KOG2208		753	consensus Vigilin [Lipid transport and metabolism]	99.4
cd02396		65	PCBP_like_KH K homology RNA-binding domain, PCBP_l	99.35
KOG2208		753	consensus Vigilin [Lipid transport and metabolism]	99.31
cd02394		62	vigilin_like_KH K homology RNA-binding domain_vigi	99.28
cd02396		65	PCBP_like_KH K homology RNA-binding domain, PCBP_l	99.23
PF00013		60	KH_1: KH domain syndrome, contains KH motifs.; Int	99.21
cd00105		64	KH-I K homology RNA-binding domain, type I. KH bin	99.2
cd02393		61	PNPase_KH Polynucleotide phosphorylase (PNPase) K	99.2
KOG2279		608	consensus Kinase anchor protein AKAP149, contains	99.14
cd02393		61	PNPase_KH Polynucleotide phosphorylase (PNPase) K	99.07
KOG2279		608	consensus Kinase anchor protein AKAP149, contains	99.06
cd02394		62	vigilin_like_KH K homology RNA-binding domain_vigi	99.06
PF00013		60	KH_1: KH domain syndrome, contains KH motifs.; Int	99.0
cd00105		64	KH-I K homology RNA-binding domain, type I. KH bin	98.94
PF13014		43	KH_3: KH domain	98.87
PF13014		43	KH_3: KH domain	98.86
smart00322		69	KH K homology RNA-binding domain.	98.81
COG1094		194	Predicted RNA-binding protein (contains KH domains	98.64
smart00322		69	KH K homology RNA-binding domain.	98.62
COG1094		194	Predicted RNA-binding protein (contains KH domains	98.5
cd02395		120	SF1_like-KH Splicing factor 1 (SF1) K homology RNA	98.12
cd02395		120	SF1_like-KH Splicing factor 1 (SF1) K homology RNA	98.09
KOG2113		394	consensus Predicted RNA binding protein, contains	98.06
KOG2113		394	consensus Predicted RNA binding protein, contains	97.77
TIGR02696		719	pppGpp_PNP guanosine pentaphosphate synthetase I/p	97.71
PRK08406		140	transcription elongation factor NusA-like protein;	97.66
TIGR03591		684	polynuc_phos polyribonucleotide nucleotidyltransfe	97.39
PRK08406		140	transcription elongation factor NusA-like protein;	97.39
TIGR02696		719	pppGpp_PNP guanosine pentaphosphate synthetase I/p	97.36
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	97.16
TIGR01952		141	nusA_arch NusA family KH domain protein, archaeal.	97.12
PLN00207		891	polyribonucleotide nucleotidyltransferase; Provisi	97.08
COG1185		692	Pnp Polyribonucleotide nucleotidyltransferase (pol	97.06
KOG0119		554	consensus Splicing factor 1/branch point binding p	96.92
TIGR03591		684	polynuc_phos polyribonucleotide nucleotidyltransfe	96.74
TIGR01952		141	nusA_arch NusA family KH domain protein, archaeal.	96.7
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	96.48
KOG1588		259	consensus RNA-binding protein Sam68 and related KH	96.44
PRK11824		693	polynucleotide phosphorylase/polyadenylase; Provis	96.35
COG0195		190	NusA Transcription elongation factor [Transcriptio	96.35
cd02134		61	NusA_KH NusA_K homology RNA-binding domain (KH). N	96.27
KOG0119		554	consensus Splicing factor 1/branch point binding p	96.05
cd02134		61	NusA_KH NusA_K homology RNA-binding domain (KH). N	96.0
COG1185		692	Pnp Polyribonucleotide nucleotidyltransferase (pol	95.78
KOG2814		345	consensus Transcription coactivator complex, P50 c	95.72
PLN00207		891	polyribonucleotide nucleotidyltransferase; Provisi	95.57
PRK04163		235	exosome complex RNA-binding protein Rrp4; Provisio	95.47
PF14611		210	SLS: Mitochondrial inner-membrane-bound regulator	95.44
PRK00468		75	hypothetical protein; Provisional	95.43
KOG1588		259	consensus RNA-binding protein Sam68 and related KH	95.4
PF14611		210	SLS: Mitochondrial inner-membrane-bound regulator	95.37
PRK04163		235	exosome complex RNA-binding protein Rrp4; Provisio	95.32
PRK12328		374	nusA transcription elongation factor NusA; Provisi	95.23
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	95.14
PRK00106		535	hypothetical protein; Provisional	95.11
TIGR01953		341	NusA transcription termination factor NusA. This m	95.1
PRK02821		77	hypothetical protein; Provisional	95.09
PRK00106		535	hypothetical protein; Provisional	95.07
KOG2814		345	consensus Transcription coactivator complex, P50 c	95.04
PRK12704		520	phosphodiesterase; Provisional	95.01
COG1837		76	Predicted RNA-binding protein (contains KH domain)	95.0
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	94.97
PRK12704		520	phosphodiesterase; Provisional	94.89
PRK01064		78	hypothetical protein; Provisional	94.61
PRK12327		362	nusA transcription elongation factor NusA; Provisi	94.5
COG0195		190	NusA Transcription elongation factor [Transcriptio	94.48
COG5176		269	MSL5 Splicing factor (branch point binding protein	94.47
COG5176		269	MSL5 Splicing factor (branch point binding protein	94.32
KOG4369		2131	consensus RTK signaling protein MASK/UNC-44 [Signa	94.21
PRK00468		75	hypothetical protein; Provisional	94.17
PRK12329		449	nusA transcription elongation factor NusA; Provisi	94.11
PRK09202		470	nusA transcription elongation factor NusA; Validat	93.98
PRK12328		374	nusA transcription elongation factor NusA; Provisi	93.75
PRK02821		77	hypothetical protein; Provisional	93.55
TIGR01953		341	NusA transcription termination factor NusA. This m	93.4
PRK11824		693	polynucleotide phosphorylase/polyadenylase; Provis	93.29
PRK01064		78	hypothetical protein; Provisional	93.25
COG1837		76	Predicted RNA-binding protein (contains KH domain)	93.22
PRK12329		449	nusA transcription elongation factor NusA; Provisi	92.68
KOG1067		760	consensus Predicted RNA-binding polyribonucleotide	92.4
PRK09202		470	nusA transcription elongation factor NusA; Validat	92.37
PRK12327		362	nusA transcription elongation factor NusA; Provisi	92.14
PRK12705		508	hypothetical protein; Provisional	88.8
PF13083		73	KH_4: KH domain; PDB: 3GKU_B.	88.35
PRK12705		508	hypothetical protein; Provisional	88.35
cd02409		68	KH-II KH-II (K homology RNA-binding domain, type I	87.32
PF13184		69	KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW	86.28
COG5166		657	Uncharacterized conserved protein [Function unknow	84.86
PF13083		73	KH_4: KH domain; PDB: 3GKU_B.	84.76
KOG2874		356	consensus rRNA processing protein [Translation, ri	84.7
KOG3273		252	consensus Predicted RNA-binding protein Pno1p inte	83.37
KOG3273		252	consensus Predicted RNA-binding protein Pno1p inte	83.36
COG1097		239	RRP4 RNA-binding protein Rrp4 and related proteins	82.33
cd02409		68	KH-II KH-II (K homology RNA-binding domain, type I	82.13
COG1097		239	RRP4 RNA-binding protein Rrp4 and related proteins	82.12
PF13184		69	KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW	81.83
KOG4369		2131	consensus RTK signaling protein MASK/UNC-44 [Signa	81.68
PRK13764		602	ATPase; Provisional	81.27
COG5166		657	Uncharacterized conserved protein [Function unknow	81.2
COG1855		604	ATPase (PilT family) [General function prediction	80.51

>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=4.5e-42  Score=346.46  Aligned_cols=354  Identities=23%  Similarity=0.381  Sum_probs=261.2

Q ss_pred             CCCceEEEEEeeccceeeeecCCCccccchhhccCCeEEEcC-CCCCCCceEEEEEeCCCcccchhhhhhhhhhhccCcc
Q 045766           42 FPGGIMFRVLCPVSKIDGVIGKDGEMMSQISQDTGVTIRVEE-TVSGSDERLVVIEASDNKKETSENLEASIERSENNGR  120 (663)
Q Consensus        42 ~~~~~~~rilvp~~~vg~IIGk~G~~I~~i~~etga~I~v~~-~~~g~~ervi~I~G~~e~~~~a~~~~~~~~~~~~~~~  120 (663)
                      ...++++|+|||..++|.||||.|.|||.|...|.|||+|.+ ...|..||+|+|.|++|.+                  
T Consensus       195 q~~D~PlR~lVptqyvgaIIGkeG~TIknItkqTqsriD~hrken~Gaaek~itvh~tpEg~------------------  256 (584)
T KOG2193|consen  195 QLKDWPLRLLVPTQYVGAIIGKEGATIKNITKQTQSRIDVHRKENAGAAEKIITVHSTPEGT------------------  256 (584)
T ss_pred             cccCcceeeeeccceeEEEecCCCccccCcchhhhheeeeeecccCCcccCceEEecCccch------------------
Confidence            367899999999999999999999999999999999999986 4679999999999999988                  


Q ss_pred             ccccccccccccccCCccccchhccccCccccchHHHHHHHHHHhhhhccCCCcccccccCCCCCceEEEEEEcCCceeE
Q 045766          121 EEASVADESDNKKEDSVNEGSVLMDGLNSEKETSKVQKALLLVFERMVEVEPETEVADQENTKSSKFVLRLLVLSTQVGC  200 (663)
Q Consensus       121 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~llVP~~~vG~  200 (663)
                                                          -+|..+++|-|.....+++       ....+.++++.++++||+
T Consensus       257 ------------------------------------s~Ac~~ILeimqkEA~~~k-------~~~e~pLk~lAHN~lvGR  293 (584)
T KOG2193|consen  257 ------------------------------------SKACKMILEIMQKEAVDDK-------VAEEIPLKILAHNNLVGR  293 (584)
T ss_pred             ------------------------------------HHHHHHHHHHHHHhhhccc-------hhhhcchhhhhhcchhhh
Confidence                                                2455556666653222111       125688999999999999


Q ss_pred             EecCcchhhhcccCCC-----------CCCCCCccEEEEEcCHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCC
Q 045766          201 LLGKGGCVIKQIDKLP-----------TCALASDEVVQITGEVDTVRKALKLISHQLLDNSPRDHESIPGNPTGPSHPLP  269 (663)
Q Consensus       201 IIGkgG~~Ik~I~~~p-----------~~~~~~dr~V~I~G~~~~V~~A~~~I~~~l~~~~~~~~~~~~~~~~~~~~~~p  269 (663)
                      ||||.|.+||+|+.-.           ......||+++++|+.|+|.+|..+|..+|++++++|.....-.     ..+|
T Consensus       294 LIGKeGrnlKkIeq~TgTkITis~lqels~ynpERTItVkGsiEac~~AE~eImkKlre~yEnDl~a~s~q-----~~l~  368 (584)
T KOG2193|consen  294 LIGKEGRNLKKIEQDTGTKITISKLQELSLYNPERTITVKGSIEACVQAEAEIMKKLRECYENDLAAMSLQ-----CHLP  368 (584)
T ss_pred             hhhhccccHHHHHhhcCCceeeeehhhhcccCccceEEecccHHHHHHHHHHHHHHHHHHHhhhHHHhhcc-----CCCC
Confidence            9999999999994311           12346799999999999999999999999999998884311110     1111


Q ss_pred             CCCCCCCCCCCCC----CCCCCcCCCCCCCCCCCCCCCCCCCCCCCCCCcceEEEEEeeccccceeeccCchhHHhHHhH
Q 045766          270 DHSVSSQGAPYAT----GHRDVADIHLPMPPSIPKFHESGVLDRPKPSPEILTFRLLCHDERVGGVIGKGGAIIRSLKQE  345 (663)
Q Consensus       270 ~~~~~~~g~~y~~----~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~v~vp~~~vg~IIGk~G~~Ik~I~~~  345 (663)
                      |..+.+.-++|..    .++.++..+....+++|.|+.+         ++...++++||...+|.|||++|.+||+|.+.
T Consensus       369 P~l~~~~l~~f~ssS~~~~Ph~~Ps~v~~a~p~~~~hq~---------pe~e~V~~fiP~~~vGAiIGkkG~hIKql~Rf  439 (584)
T KOG2193|consen  369 PGLNLPALGLFPSSSAVSPPHFPPSPVTFASPYPLFHQN---------PEQEQVRMFIPAQAVGAIIGKKGQHIKQLSRF  439 (584)
T ss_pred             cccCccccCCCCcccccCCCCCCCCccccCCCchhhhcC---------cchhheeeeccHHHHHHHHhhcchhHHHHHHh
Confidence            1111111000110    0000000011111233444332         25668899999999999999999999999999


Q ss_pred             hCCeEEEecc-CCCCCceEEEEeCCCCCCCCCChHHHHHHHHHHHHhhcCCC--CCCcceEEEEEecccceeEEEcCCch
Q 045766          346 TGCDIKVMEA-VSGTEDRLIVISGPAHPDDRISAPQDAVLRVQTRIARAIPD--NREQTVMTRLLVASNQIGCLLGKGGS  422 (663)
Q Consensus       346 tga~I~i~~~-~~~~~er~v~I~G~~~~~~~v~~a~~ai~~i~~~i~~~~~~--~~~~~~~~~l~Vp~~~vg~IIGk~G~  422 (663)
                      +|++|+|..+ .++..+|.|+|+|++   +   +..+|--.++.+|.+..-.  ..+-....++.||...+|+||||||.
T Consensus       440 agASiKIappE~pdvseRMViItGpp---e---aqfKAQgrifgKikEenf~~PkeevklethirVPs~~aGRvIGKGGk  513 (584)
T KOG2193|consen  440 AGASIKIAPPEIPDVSERMVIITGPP---E---AQFKAQGRIFGKIKEENFFLPKEEVKLETHIRVPSSAAGRVIGKGGK  513 (584)
T ss_pred             ccceeeecCCCCCCcceeEEEecCCh---H---HHHhhhhhhhhhhhhhccCCchhhheeeeeeeccchhhhhhhccccc
Confidence            9999999853 477889999999998   1   1123333344444433211  12345678899999999999999999


Q ss_pred             HHHHHHHHhCceEEEecCCCCCCCCCCCCcEEEEEecHHHHHHHHHHHHHHHhhccc
Q 045766          423 IIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFF  479 (663)
Q Consensus       423 ~Ik~I~~~tGa~I~i~~~~~~p~~~~~~~~~v~I~G~~~~v~~A~~~I~~~l~~~~~  479 (663)
                      ++++|+..|+|.|.| ++++.|+.  .+..+|.|.|...+.+.|.+.|.+++.+...
T Consensus       514 tVnELQnlt~AeV~v-PrdqtpdE--nd~vivriiGhfyatq~aQrki~~iv~qvkq  567 (584)
T KOG2193|consen  514 TVNELQNLTSAEVVV-PRDQTPDE--NDQVIVRIIGHFYATQNAQRKIAHIVNQVKQ  567 (584)
T ss_pred             cHHHHhccccceEEc-cccCCCCc--cceeeeeeechhhcchHHHHHHHHHHHHHHH
Confidence            999999999999999 77776652  3455689999999999999999999998543

>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only]	Back alignment and domain information

>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein	Back alignment and domain information

>PRK13763 putative RNA-processing protein; Provisional	Back alignment and domain information

>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein	Back alignment and domain information

>PRK13763 putative RNA-processing protein; Provisional	Back alignment and domain information

>KOG2208 consensus Vigilin [Lipid transport and metabolism]	Back alignment and domain information

>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like	Back alignment and domain information

>KOG2208 consensus Vigilin [Lipid transport and metabolism]	Back alignment and domain information

>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like	Back alignment and domain information

>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like	Back alignment and domain information

>PF00013 KH_1: KH domain syndrome, contains KH motifs	Back alignment and domain information

>cd00105 KH-I K homology RNA-binding domain, type I	Back alignment and domain information

>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH)	Back alignment and domain information

>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH)	Back alignment and domain information

>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like	Back alignment and domain information

>PF00013 KH_1: KH domain syndrome, contains KH motifs	Back alignment and domain information

>cd00105 KH-I K homology RNA-binding domain, type I	Back alignment and domain information

>PF13014 KH_3: KH domain	Back alignment and domain information

>PF13014 KH_3: KH domain	Back alignment and domain information

>smart00322 KH K homology RNA-binding domain	Back alignment and domain information

>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only]	Back alignment and domain information

>smart00322 KH K homology RNA-binding domain	Back alignment and domain information

>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only]	Back alignment and domain information

>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH)	Back alignment and domain information

>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH)	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase	Back alignment and domain information

>PRK08406 transcription elongation factor NusA-like protein; Validated	Back alignment and domain information

>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase	Back alignment and domain information

>PRK08406 transcription elongation factor NusA-like protein; Validated	Back alignment and domain information

>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01952 nusA_arch NusA family KH domain protein, archaeal	Back alignment and domain information

>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional	Back alignment and domain information

>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase	Back alignment and domain information

>TIGR01952 nusA_arch NusA family KH domain protein, archaeal	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification]	Back alignment and domain information

>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional	Back alignment and domain information

>COG0195 NusA Transcription elongation factor [Transcription]	Back alignment and domain information

>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH)	Back alignment and domain information

>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH)	Back alignment and domain information

>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription]	Back alignment and domain information

>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional	Back alignment and domain information

>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional	Back alignment and domain information

>PF14611 SLS: Mitochondrial inner-membrane-bound regulator	Back alignment and domain information

>PRK00468 hypothetical protein; Provisional	Back alignment and domain information

>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification]	Back alignment and domain information

>PF14611 SLS: Mitochondrial inner-membrane-bound regulator	Back alignment and domain information

>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional	Back alignment and domain information

>PRK12328 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01953 NusA transcription termination factor NusA	Back alignment and domain information

>PRK02821 hypothetical protein; Provisional	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription]	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only]	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PRK01064 hypothetical protein; Provisional	Back alignment and domain information

>PRK12327 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>COG0195 NusA Transcription elongation factor [Transcription]	Back alignment and domain information

>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification]	Back alignment and domain information

>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification]	Back alignment and domain information

>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]	Back alignment and domain information

>PRK00468 hypothetical protein; Provisional	Back alignment and domain information

>PRK12329 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>PRK09202 nusA transcription elongation factor NusA; Validated	Back alignment and domain information

>PRK12328 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>PRK02821 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01953 NusA transcription termination factor NusA	Back alignment and domain information

>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional	Back alignment and domain information

>PRK01064 hypothetical protein; Provisional	Back alignment and domain information

>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only]	Back alignment and domain information

>PRK12329 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only]	Back alignment and domain information

>PRK09202 nusA transcription elongation factor NusA; Validated	Back alignment and domain information

>PRK12327 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>PRK12705 hypothetical protein; Provisional	Back alignment and domain information

>PF13083 KH_4: KH domain; PDB: 3GKU_B	Back alignment and domain information

>PRK12705 hypothetical protein; Provisional	Back alignment and domain information

>cd02409 KH-II KH-II (K homology RNA-binding domain, type II)	Back alignment and domain information

>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A	Back alignment and domain information

>COG5166 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13083 KH_4: KH domain; PDB: 3GKU_B	Back alignment and domain information

>KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02409 KH-II KH-II (K homology RNA-binding domain, type II)	Back alignment and domain information

>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A	Back alignment and domain information

>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms]	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>COG5166 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		663
2jzx_A		160	Pcbp2 Kh1-Kh2 Domains Length = 160		1e-06

>pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160

Back alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 41/157 (26%), Positives = 81/157 (51%), Gaps = 11/157 (7%) Query: 317 LTFRLLCHDERXXXXXXXXXXXXRSLKQETGCDIKVMEAVSGTEDRLIVISGPAHPDDRI 376 LT RLL H + + +++E+G I + E +R+I ++GP + + Sbjct: 5 LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEG--NCPERIITLAGPTNAIFK- 61 Query: 377 SAPQDAVLRVQTRIARAIPDNREQT---VMTRLLVASNQIGCLLGKGGSIIAEMRKLSGA 433 A + +++ I+ ++ ++ + V RL+V ++Q G L+GKGG I E+R+ +GA Sbjct: 62 -AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGA 120 Query: 434 YIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQI 470 +++ G D +P + E + I G +++ E + QI Sbjct: 121 QVQVAG-DMLP---NSTERAITIAGIPQSIIECVKQI 153

PyMOL of 2jzx

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		663
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	6e-39
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	2e-22
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	6e-18
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	9e-11
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	6e-09
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	1e-07
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	4e-05
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	7e-37
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	9e-14
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	4e-10
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	1e-08
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	2e-08
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	3e-05
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	5e-05
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	3e-36
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	2e-20
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	3e-17
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	9e-10
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	1e-09
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	2e-07
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	2e-06
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	2e-35
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	8e-22
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	1e-19
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	6e-11
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	7e-10
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	5e-09
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	4e-07
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	1e-31
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	8e-19
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	1e-17
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	4e-12
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	6e-10
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	2e-07
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	6e-07
1j5k_A		89	Heterogeneous nuclear ribonucleoprotein K; single-	8e-20
1j5k_A		89	Heterogeneous nuclear ribonucleoprotein K; single-	3e-15
1j5k_A		89	Heterogeneous nuclear ribonucleoprotein K; single-	5e-12
1j5k_A		89	Heterogeneous nuclear ribonucleoprotein K; single-	3e-09
1j5k_A		89	Heterogeneous nuclear ribonucleoprotein K; single-	5e-06
2p2r_A		76	Poly(RC)-binding protein 2; protein-DNA complex, R	1e-19
2p2r_A		76	Poly(RC)-binding protein 2; protein-DNA complex, R	9e-14
2p2r_A		76	Poly(RC)-binding protein 2; protein-DNA complex, R	1e-12
2p2r_A		76	Poly(RC)-binding protein 2; protein-DNA complex, R	5e-08
2p2r_A		76	Poly(RC)-binding protein 2; protein-DNA complex, R	3e-07
1zzk_A		82	Heterogeneous nuclear ribonucleoprotein K; KH domi	7e-19
1zzk_A		82	Heterogeneous nuclear ribonucleoprotein K; KH domi	5e-15
1zzk_A		82	Heterogeneous nuclear ribonucleoprotein K; KH domi	3e-12
1zzk_A		82	Heterogeneous nuclear ribonucleoprotein K; KH domi	4e-10
1zzk_A		82	Heterogeneous nuclear ribonucleoprotein K; KH domi	5e-06
1wvn_A		82	Poly(RC)-binding protein 1; KH domain, RNA binding	8e-19
1wvn_A		82	Poly(RC)-binding protein 1; KH domain, RNA binding	5e-14
1wvn_A		82	Poly(RC)-binding protein 1; KH domain, RNA binding	1e-12
1wvn_A		82	Poly(RC)-binding protein 1; KH domain, RNA binding	1e-08
1wvn_A		82	Poly(RC)-binding protein 1; KH domain, RNA binding	5e-06
1x4n_A		92	FAR upstream element binding protein 1; KH domain,	1e-17
1x4n_A		92	FAR upstream element binding protein 1; KH domain,	5e-12
1x4n_A		92	FAR upstream element binding protein 1; KH domain,	3e-09
1x4n_A		92	FAR upstream element binding protein 1; KH domain,	4e-07
1dtj_A		76	RNA-binding neurooncological ventral antigen 2; KH	1e-15
1dtj_A		76	RNA-binding neurooncological ventral antigen 2; KH	2e-12
1dtj_A		76	RNA-binding neurooncological ventral antigen 2; KH	6e-12
1dtj_A		76	RNA-binding neurooncological ventral antigen 2; KH	8e-07
1dtj_A		76	RNA-binding neurooncological ventral antigen 2; KH	9e-07
2axy_A		73	Poly(RC)-binding protein 2; protein-DNA complex, D	2e-15
2axy_A		73	Poly(RC)-binding protein 2; protein-DNA complex, D	3e-13
2axy_A		73	Poly(RC)-binding protein 2; protein-DNA complex, D	1e-10
2axy_A		73	Poly(RC)-binding protein 2; protein-DNA complex, D	4e-09
2axy_A		73	Poly(RC)-binding protein 2; protein-DNA complex, D	1e-07
1ec6_A		87	RNA-binding protein NOVA-2; KH domain, alpha-beta	6e-15
1ec6_A		87	RNA-binding protein NOVA-2; KH domain, alpha-beta	5e-12
1ec6_A		87	RNA-binding protein NOVA-2; KH domain, alpha-beta	1e-11
1ec6_A		87	RNA-binding protein NOVA-2; KH domain, alpha-beta	2e-06
1ec6_A		87	RNA-binding protein NOVA-2; KH domain, alpha-beta	6e-06
2qnd_A		144	FMR1 protein; KH domain, eukaryotic KH domains, ta	8e-13
2hh3_A		106	KH-type splicing regulatory protein; KH-RNA bindin	1e-12
2hh3_A		106	KH-type splicing regulatory protein; KH-RNA bindin	3e-11
2hh3_A		106	KH-type splicing regulatory protein; KH-RNA bindin	6e-08
2hh3_A		106	KH-type splicing regulatory protein; KH-RNA bindin	1e-06
2hh3_A		106	KH-type splicing regulatory protein; KH-RNA bindin	1e-05
1x4m_A		94	FAR upstream element binding protein 1; KH domain,	6e-12
1x4m_A		94	FAR upstream element binding protein 1; KH domain,	2e-11
1x4m_A		94	FAR upstream element binding protein 1; KH domain,	2e-09
1x4m_A		94	FAR upstream element binding protein 1; KH domain,	1e-06
1x4m_A		94	FAR upstream element binding protein 1; KH domain,	7e-06
2opv_A		85	KHSRP protein; KH domain, RNA binding protein, KSR	6e-12
2opv_A		85	KHSRP protein; KH domain, RNA binding protein, KSR	3e-11
2opv_A		85	KHSRP protein; KH domain, RNA binding protein, KSR	1e-09
2opv_A		85	KHSRP protein; KH domain, RNA binding protein, KSR	2e-07
2opv_A		85	KHSRP protein; KH domain, RNA binding protein, KSR	2e-05
2hh2_A		107	KH-type splicing regulatory protein; KH-RNA bindin	6e-11
2hh2_A		107	KH-type splicing regulatory protein; KH-RNA bindin	4e-10
2hh2_A		107	KH-type splicing regulatory protein; KH-RNA bindin	7e-08
2hh2_A		107	KH-type splicing regulatory protein; KH-RNA bindin	6e-06
2hh2_A		107	KH-type splicing regulatory protein; KH-RNA bindin	4e-05
1we8_A		104	Tudor and KH domain containing protein; structural	2e-10
1we8_A		104	Tudor and KH domain containing protein; structural	2e-09
1we8_A		104	Tudor and KH domain containing protein; structural	7e-08
1we8_A		104	Tudor and KH domain containing protein; structural	8e-05
1we8_A		104	Tudor and KH domain containing protein; structural	3e-04
2cte_A		94	Vigilin; K homology type I domain, RNA-binding, ce	1e-09
2cte_A		94	Vigilin; K homology type I domain, RNA-binding, ce	3e-06
2cte_A		94	Vigilin; K homology type I domain, RNA-binding, ce	3e-06
2dgr_A		83	Ring finger and KH domain-containing protein 1; st	9e-09
2dgr_A		83	Ring finger and KH domain-containing protein 1; st	2e-04
2e3u_A		219	PH-DIM2P, hypothetical protein PH1566; PRE-ribosom	2e-08
1tua_A		191	Hypothetical protein APE0754; structural genomics,	1e-07
2ctl_A		97	Vigilin; K homology type I domain, RNA-binding, ce	4e-07
2ctl_A		97	Vigilin; K homology type I domain, RNA-binding, ce	7e-05
2ctl_A		97	Vigilin; K homology type I domain, RNA-binding, ce	4e-04
2ctk_A		104	Vigilin; K homology type I domain, RNA-binding, ce	4e-07
2ctk_A		104	Vigilin; K homology type I domain, RNA-binding, ce	1e-04
1vig_A		71	Vigilin; RNA-binding protein, ribonucleoprotein; N	5e-07
1vig_A		71	Vigilin; RNA-binding protein, ribonucleoprotein; N	2e-04
1vig_A		71	Vigilin; RNA-binding protein, ribonucleoprotein; N	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-07
2ctj_A		95	Vigilin; K homology type I domain, RNA-binding, ce	2e-04
2ctm_A		95	Vigilin; K homology type I domain, RNA-binding, ce	3e-04
3u1k_A		630	Polyribonucleotide nucleotidyltransferase 1, MITO;	4e-04
4aid_A		726	Polyribonucleotide nucleotidyltransferase; transfe	7e-04

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178	Back alignment and structure

 Score =  140 bits (355), Expect = 6e-39
 Identities = 41/177 (23%), Positives = 84/177 (47%), Gaps = 16/177 (9%)

Query: 312 PSPEILTFRLLCHDERVGGVIGKGGAIIRSLKQETGCDIKVM---EAVSGTEDRLIVISG 368
           P       ++L      G +IGKGG  I  L++ETG  IK+    +   GT +R+ +I G
Sbjct: 1   PLGSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQG 60

Query: 369 PAHPDDRISAP-QDAVLRVQTRIARAIP---------DNREQTVMTRLLVASNQIGCLLG 418
                + +     + +  +   +A+  P          N ++    +++V ++  G ++G
Sbjct: 61  TIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIG 120

Query: 419 KGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLR 475
           KGG+ +  + + SGA++++    Q P   +    VV ++GE E  ++A+  I  +++
Sbjct: 121 KGGATVKAIMEQSGAWVQL---SQKPDGINLQNRVVTVSGEPEQNRKAVELIIQKIQ 174

PyMOL of 2anr

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178	Back alignment and structure

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178	Back alignment and structure

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178	Back alignment and structure

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178	Back alignment and structure

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178	Back alignment and structure

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164	Back alignment and structure

>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89	Back alignment and structure

>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89	Back alignment and structure

>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89	Back alignment and structure

>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89	Back alignment and structure

>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89	Back alignment and structure

>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76	Back alignment and structure

>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76	Back alignment and structure

>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76	Back alignment and structure

>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76	Back alignment and structure

>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76	Back alignment and structure

>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82	Back alignment and structure

>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82	Back alignment and structure

>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82	Back alignment and structure

>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82	Back alignment and structure

>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82	Back alignment and structure

>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82	Back alignment and structure

>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82	Back alignment and structure

>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82	Back alignment and structure

>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82	Back alignment and structure

>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82	Back alignment and structure

>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92	Back alignment and structure

>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92	Back alignment and structure

>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92	Back alignment and structure

>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92	Back alignment and structure

>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76	Back alignment and structure

>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76	Back alignment and structure

>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76	Back alignment and structure

>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76	Back alignment and structure

>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76	Back alignment and structure

>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73	Back alignment and structure

>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73	Back alignment and structure

>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73	Back alignment and structure

>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73	Back alignment and structure

>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73	Back alignment and structure

>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87	Back alignment and structure

>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87	Back alignment and structure

>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87	Back alignment and structure

>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87	Back alignment and structure

>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87	Back alignment and structure

>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144	Back alignment and structure

>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106	Back alignment and structure

>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106	Back alignment and structure

>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106	Back alignment and structure

>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106	Back alignment and structure

>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106	Back alignment and structure

>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107	Back alignment and structure

>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107	Back alignment and structure

>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107	Back alignment and structure

>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107	Back alignment and structure

>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107	Back alignment and structure

>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104	Back alignment and structure

>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104	Back alignment and structure

>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104	Back alignment and structure

>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104	Back alignment and structure

>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104	Back alignment and structure

>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94	Back alignment and structure

>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219	Back alignment and structure

>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191	Back alignment and structure

>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97	Back alignment and structure

>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97	Back alignment and structure

>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97	Back alignment and structure

>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104	Back alignment and structure

>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104	Back alignment and structure

>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71	Back alignment and structure

>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71	Back alignment and structure

>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95	Back alignment and structure

>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95	Back alignment and structure

>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630	Back alignment and structure

>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		663
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	99.91
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	99.9
3krm_A		163	Insulin-like growth factor 2 mRNA-binding protein	99.89
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	99.89
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	99.89
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	99.88
3n89_A		376	Defective in GERM LINE development protein 3, ISO;	99.88
2anr_A		178	Neuro-oncological ventral antigen 1; protein-RNA c	99.88
2jzx_A		160	Poly(RC)-binding protein 2; PCBP2, KH domains, RNA	99.88
1j4w_A		174	FUSE binding protein; single-stranded DNA binding	99.88
3n89_A		376	Defective in GERM LINE development protein 3, ISO;	99.86
2jvz_A		164	KH type-splicing, FAR upstream element-binding pro	99.85
2qnd_A		144	FMR1 protein; KH domain, eukaryotic KH domains, ta	99.71
2qnd_A		144	FMR1 protein; KH domain, eukaryotic KH domains, ta	99.71
2e3u_A		219	PH-DIM2P, hypothetical protein PH1566; PRE-ribosom	99.57
2p2r_A		76	Poly(RC)-binding protein 2; protein-DNA complex, R	99.54
1zzk_A		82	Heterogeneous nuclear ribonucleoprotein K; KH domi	99.53
2e3u_A		219	PH-DIM2P, hypothetical protein PH1566; PRE-ribosom	99.52
1wvn_A		82	Poly(RC)-binding protein 1; KH domain, RNA binding	99.52
1j5k_A		89	Heterogeneous nuclear ribonucleoprotein K; single-	99.49
1dtj_A		76	RNA-binding neurooncological ventral antigen 2; KH	99.48
1x4n_A		92	FAR upstream element binding protein 1; KH domain,	99.47
2axy_A		73	Poly(RC)-binding protein 2; protein-DNA complex, D	99.44
2hh3_A		106	KH-type splicing regulatory protein; KH-RNA bindin	99.43
2opv_A		85	KHSRP protein; KH domain, RNA binding protein, KSR	99.42
1ec6_A		87	RNA-binding protein NOVA-2; KH domain, alpha-beta	99.41
1tua_A		191	Hypothetical protein APE0754; structural genomics,	99.41
2hh2_A		107	KH-type splicing regulatory protein; KH-RNA bindin	99.39
2dgr_A		83	Ring finger and KH domain-containing protein 1; st	99.38
1we8_A		104	Tudor and KH domain containing protein; structural	99.38
1x4m_A		94	FAR upstream element binding protein 1; KH domain,	99.37
2axy_A		73	Poly(RC)-binding protein 2; protein-DNA complex, D	99.37
1x4n_A		92	FAR upstream element binding protein 1; KH domain,	99.36
1tua_A		191	Hypothetical protein APE0754; structural genomics,	99.34
1wvn_A		82	Poly(RC)-binding protein 1; KH domain, RNA binding	99.34
1dtj_A		76	RNA-binding neurooncological ventral antigen 2; KH	99.34
2p2r_A		76	Poly(RC)-binding protein 2; protein-DNA complex, R	99.32
1zzk_A		82	Heterogeneous nuclear ribonucleoprotein K; KH domi	99.3
1vig_A		71	Vigilin; RNA-binding protein, ribonucleoprotein; N	99.3
2ctl_A		97	Vigilin; K homology type I domain, RNA-binding, ce	99.29
2dgr_A		83	Ring finger and KH domain-containing protein 1; st	99.29
2opv_A		85	KHSRP protein; KH domain, RNA binding protein, KSR	99.28
2ctm_A		95	Vigilin; K homology type I domain, RNA-binding, ce	99.28
1x4m_A		94	FAR upstream element binding protein 1; KH domain,	99.28
2cte_A		94	Vigilin; K homology type I domain, RNA-binding, ce	99.26
1ec6_A		87	RNA-binding protein NOVA-2; KH domain, alpha-beta	99.25
2hh2_A		107	KH-type splicing regulatory protein; KH-RNA bindin	99.25
1j5k_A		89	Heterogeneous nuclear ribonucleoprotein K; single-	99.24
1we8_A		104	Tudor and KH domain containing protein; structural	99.2
2ctk_A		104	Vigilin; K homology type I domain, RNA-binding, ce	99.18
2hh3_A		106	KH-type splicing regulatory protein; KH-RNA bindin	99.18
2ctm_A		95	Vigilin; K homology type I domain, RNA-binding, ce	99.16
2ctl_A		97	Vigilin; K homology type I domain, RNA-binding, ce	99.16
1vig_A		71	Vigilin; RNA-binding protein, ribonucleoprotein; N	99.14
2cte_A		94	Vigilin; K homology type I domain, RNA-binding, ce	99.14
2ctf_A		102	Vigilin; K homology type I domain, RNA-binding, ce	99.12
2ctj_A		95	Vigilin; K homology type I domain, RNA-binding, ce	99.09
2ctf_A		102	Vigilin; K homology type I domain, RNA-binding, ce	99.08
2ctk_A		104	Vigilin; K homology type I domain, RNA-binding, ce	99.04
2ctj_A		95	Vigilin; K homology type I domain, RNA-binding, ce	98.95
2cpq_A		91	FragIle X mental retardation syndrome related prot	98.73
2cpq_A		91	FragIle X mental retardation syndrome related prot	98.58
1k1g_A		131	SF1-BO isoform; splicing, branch point sequence, p	98.32
2yqr_A		119	KIAA0907 protein; structure genomics, KH domain, s	98.26
1k1g_A		131	SF1-BO isoform; splicing, branch point sequence, p	98.25
2yqr_A		119	KIAA0907 protein; structure genomics, KH domain, s	98.15
3u1k_A		630	Polyribonucleotide nucleotidyltransferase 1, MITO;	97.84
2bl5_A		140	MGC83862 protein, quaking protein; STAR proteins,	97.76
2bl5_A		140	MGC83862 protein, quaking protein; STAR proteins,	97.72
3v69_A		140	Protein filia; RNA-binding, embryogenesis, KH doma	97.72
3u1k_A		630	Polyribonucleotide nucleotidyltransferase 1, MITO;	97.35
3v69_A		140	Protein filia; RNA-binding, embryogenesis, KH doma	97.24
4aid_A		726	Polyribonucleotide nucleotidyltransferase; transfe	97.24
2cxc_A		144	NUSA; transcription termination, RNA binding prote	96.89
2cxc_A		144	NUSA; transcription termination, RNA binding prote	96.47
4aid_A		726	Polyribonucleotide nucleotidyltransferase; transfe	96.41
3cdi_A		723	Polynucleotide phosphorylase; mRNA turnover, RNAse	94.77
2asb_A		251	Transcription elongation protein NUSA; protein-RNA	94.0
1k0r_A		366	NUSA; two component arrangement, S1 domain, two K-	93.9
1e3p_A		757	Guanosine pentaphosphate synthetase; polyribonucle	92.81
3cdi_A		723	Polynucleotide phosphorylase; mRNA turnover, RNAse	91.58
1k0r_A		366	NUSA; two component arrangement, S1 domain, two K-	91.46
2asb_A		251	Transcription elongation protein NUSA; protein-RNA	91.18
1hh2_P		344	NUSA, N utilization substance protein A; transcrip	91.0
1e3p_A		757	Guanosine pentaphosphate synthetase; polyribonucle	84.07

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens}	Back alignment and structure

Probab=99.91  E-value=8.5e-24  Score=200.74  Aligned_cols=159  Identities=21%  Similarity=0.371  Sum_probs=128.2

Q ss_pred             eEEEEEecccceeEEEcCCchHHHHHHHHhCceEEEecCCCCCCCCCCCCcEEEEEecHHHHHHHHHHHHHHHhhccccC
Q 045766          402 VMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEFEAVQEALFQITTRLRHHFFRD  481 (663)
Q Consensus       402 ~~~~l~Vp~~~vg~IIGk~G~~Ik~I~~~tGa~I~i~~~~~~p~~~~~~~~~v~I~G~~~~v~~A~~~I~~~l~~~~~~~  481 (663)
                      ++.+|+||.+++|.|||++|++|++|+++|||+|++.++...   ....++.|+|+|++++|.+|+.+|.+++.+.....
T Consensus         2 ~~~~~~Vp~~~~g~iIGk~G~~Ik~i~~~tg~~I~i~~~~~~---~~~~~r~v~I~G~~~~v~~A~~~I~~ii~e~~~~~   78 (164)
T 2jvz_A            2 TVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQ---NTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGG   78 (164)
T ss_dssp             EEEEEEECTTCHHHHTCTTTHHHHHHHHTSCSEEEECCCTTS---SSSSCEEEEEEECHHHHHHHHHHHHHHTTCSSSCC
T ss_pred             eEEEEEechhheeEEECCChHHHHHHHHHhCCeEEEecCCCC---CCCCceEEEEEcCHHHHHHHHHHHHHHHHhccCCC
Confidence            578999999999999999999999999999999999443222   23568899999999999999999999987632100


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCccccCCCCCCCCCCCC
Q 045766          482 AFPSINRPLNPTFLDQVSPFPSFIGRRELSPPGMYSNFGPSFHKFDAVGGPPPPGSFHPHDDHSAFMHHIHRPGMPPHMP  561 (663)
Q Consensus       482 ~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~  561 (663)
                                  |.                                            +.   .                
T Consensus        79 ------------~~--------------------------------------------~~---~----------------   83 (164)
T 2jvz_A           79 ------------FG--------------------------------------------DR---N----------------   83 (164)
T ss_dssp             ------------CS--------------------------------------------SC---S----------------
T ss_pred             ------------CC--------------------------------------------Cc---c----------------
Confidence                        00                                            00   0                


Q ss_pred             CCCCCCCCCccccCCCCCCCCCCCCCcceEEEEecCCCcCeeecCCChhHHHHHHHcCCEEEEeCCCCCCcceEEEEEcC
Q 045766          562 DMKPWGPQGLMEVGGPMGFPDFVGPPHRRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGT  641 (663)
Q Consensus       562 ~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~v~IP~~~vg~IIGkgG~~I~~I~~~sGa~I~i~~~~~~~~~r~v~IsGt  641 (663)
                         .|+..                 ...+++|.||.+++|+||||+|++|++|++.|||+|+|++..+...++.|+|+|+
T Consensus        84 ---~~~~~-----------------~~~~~~i~vp~~~~g~iIGk~G~~I~~i~~~tg~~I~i~~~~~~~~~~~v~I~G~  143 (164)
T 2jvz_A           84 ---EYGSR-----------------IGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGP  143 (164)
T ss_dssp             ---SCTTS-----------------CSSSBCCEEETTTHHHHHCSSSHHHHHHHHHTCCEEEECCCCTTSSEEEEEEESC
T ss_pred             ---ccCCC-----------------CCceEEEEEChhhccccCCCCcHhHHHHHHHHCCeEEEeCCCCCCCcEEEEEEcC
Confidence               00000                 0123568999999999999999999999999999999998766566899999999


Q ss_pred             HHHHHHHHHHHHHHHhc
Q 045766          642 PEQTHAAQSLIQAFVMS  658 (663)
Q Consensus       642 ~e~v~~A~~lI~~~v~~  658 (663)
                      +++|+.|+.+|+++|..
T Consensus       144 ~~~v~~A~~~I~~~i~~  160 (164)
T 2jvz_A          144 PDRCEHAARIINDLLQS  160 (164)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            99999999999998865

PyMOL of 2jvz

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens}	Back alignment and structure

>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens}	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A*	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1	Back alignment and structure

>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans}	Back alignment and structure

>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A*	Back alignment and structure

>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1	Back alignment and structure

>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans}	Back alignment and structure

>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens}	Back alignment and structure

>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A	Back alignment and structure

>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A	Back alignment and structure

>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B	Back alignment and structure

>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens}	Back alignment and structure

>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A	Back alignment and structure

>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B	Back alignment and structure

>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A	Back alignment and structure

>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A	Back alignment and structure

>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A	Back alignment and structure

>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A*	Back alignment and structure

>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens}	Back alignment and structure

>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1	Back alignment and structure

>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1	Back alignment and structure

>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1	Back alignment and structure

>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A*	Back alignment and structure

>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A	Back alignment and structure

>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1	Back alignment and structure

>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A	Back alignment and structure

>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens}	Back alignment and structure

>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A	Back alignment and structure

>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A	Back alignment and structure

>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens}	Back alignment and structure

>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1	Back alignment and structure

>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A	Back alignment and structure

>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1	Back alignment and structure

>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A	Back alignment and structure

>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1	Back alignment and structure

>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens}	Back alignment and structure

>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1	Back alignment and structure

>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1	Back alignment and structure

>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus}	Back alignment and structure

>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens}	Back alignment and structure

>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus}	Back alignment and structure

>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A	Back alignment and structure

>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A	Back alignment and structure

>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A	Back alignment and structure

>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A	Back alignment and structure

>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A	Back alignment and structure

>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A	Back alignment and structure

>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1	Back alignment and structure

>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A	Back alignment and structure

>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A	Back alignment and structure

>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1	Back alignment and structure

>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A	Back alignment and structure

>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A	Back alignment and structure

>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		663
d2axya1		71	d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum	8e-14
d2axya1		71	d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum	6e-12
d2axya1		71	d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum	4e-10
d2axya1		71	d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum	5e-09
d2axya1		71	d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum	4e-08
d1wvna1		70	d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma	2e-13
d1wvna1		70	d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma	4e-12
d1wvna1		70	d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma	3e-11
d1wvna1		70	d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma	5e-08
d1wvna1		70	d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma	1e-07
d1x4na1		79	d.51.1.1 (A:8-86) Far upstream binding element, FB	3e-13
d1x4na1		79	d.51.1.1 (A:8-86) Far upstream binding element, FB	4e-11
d1x4na1		79	d.51.1.1 (A:8-86) Far upstream binding element, FB	4e-11
d1x4na1		79	d.51.1.1 (A:8-86) Far upstream binding element, FB	4e-08
d1x4na1		79	d.51.1.1 (A:8-86) Far upstream binding element, FB	3e-06
d1zzka1		75	d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie	4e-13
d1zzka1		75	d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie	3e-11
d1zzka1		75	d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie	6e-09
d1zzka1		75	d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie	1e-06
d1zzka1		75	d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie	2e-05
d1dtja_		74	d.51.1.1 (A:) Neuro-oncological ventral antigen 2,	6e-13
d1dtja_		74	d.51.1.1 (A:) Neuro-oncological ventral antigen 2,	4e-12
d1dtja_		74	d.51.1.1 (A:) Neuro-oncological ventral antigen 2,	2e-09
d1dtja_		74	d.51.1.1 (A:) Neuro-oncological ventral antigen 2,	2e-08
d1dtja_		74	d.51.1.1 (A:) Neuro-oncological ventral antigen 2,	2e-07
d1j4wa1		74	d.51.1.1 (A:1-74) Far upstream binding element, FB	7e-13
d1j4wa1		74	d.51.1.1 (A:1-74) Far upstream binding element, FB	2e-09
d1j4wa1		74	d.51.1.1 (A:1-74) Far upstream binding element, FB	4e-09
d1j4wa1		74	d.51.1.1 (A:1-74) Far upstream binding element, FB	5e-08
d1j4wa1		74	d.51.1.1 (A:1-74) Far upstream binding element, FB	1e-06
d1j4wa2		71	d.51.1.1 (A:104-174) Far upstream binding element,	6e-12
d1j4wa2		71	d.51.1.1 (A:104-174) Far upstream binding element,	2e-10
d1j4wa2		71	d.51.1.1 (A:104-174) Far upstream binding element,	1e-08
d1j4wa2		71	d.51.1.1 (A:104-174) Far upstream binding element,	2e-06
d1j4wa2		71	d.51.1.1 (A:104-174) Far upstream binding element,	2e-06
d1we8a_		104	d.51.1.1 (A:) Tudor and KH domain containing prote	8e-12
d1we8a_		104	d.51.1.1 (A:) Tudor and KH domain containing prote	5e-10
d1we8a_		104	d.51.1.1 (A:) Tudor and KH domain containing prote	1e-07
d1we8a_		104	d.51.1.1 (A:) Tudor and KH domain containing prote	2e-06
d1we8a_		104	d.51.1.1 (A:) Tudor and KH domain containing prote	3e-06
d1x4ma1		81	d.51.1.1 (A:8-88) Far upstream binding element, FB	6e-11
d1x4ma1		81	d.51.1.1 (A:8-88) Far upstream binding element, FB	4e-10
d1x4ma1		81	d.51.1.1 (A:8-88) Far upstream binding element, FB	1e-07
d1x4ma1		81	d.51.1.1 (A:8-88) Far upstream binding element, FB	7e-07
d1x4ma1		81	d.51.1.1 (A:8-88) Far upstream binding element, FB	1e-06
d2ctea1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	9e-11
d2ctea1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	1e-07
d2ctea1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	1e-06
d2ctea1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	2e-04
d2ctea1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	0.002
d2ctka1		91	d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T	2e-10
d2ctka1		91	d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T	1e-07
d2ctka1		91	d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T	7e-06
d2ctka1		91	d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T	5e-05
d2ctla1		84	d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T	3e-09
d2ctla1		84	d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T	3e-07
d2ctla1		84	d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T	1e-05
d2ctla1		84	d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T	3e-04
d2ctla1		84	d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T	0.002
d1viga_		71	d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId	7e-09
d1viga_		71	d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId	9e-07
d1viga_		71	d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId	1e-04
d2ctma1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	4e-07
d2ctma1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	5e-07
d2ctma1		81	d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T	0.003
d1e3ha4		54	d.52.3.1 (A:579-632) Polynucleotide phosphorylase/	5e-07
d1e3ha4		54	d.52.3.1 (A:579-632) Polynucleotide phosphorylase/	2e-06
d1e3ha4		54	d.52.3.1 (A:579-632) Polynucleotide phosphorylase/	0.003
d2ctja1		82	d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T	5e-07
d2ctja1		82	d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T	9e-05
d2ctja1		82	d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T	0.003
d2ba0a3		84	d.51.1.1 (A:136-219) Exosome complex RNA-binding p	2e-06
d2ba0a3		84	d.51.1.1 (A:136-219) Exosome complex RNA-binding p	5e-05
d2ba0a3		84	d.51.1.1 (A:136-219) Exosome complex RNA-binding p	8e-05
d2ba0a3		84	d.51.1.1 (A:136-219) Exosome complex RNA-binding p	8e-04
d2cpqa1		78	d.51.1.1 (A:212-289) Fragile X mental retardation	2e-05
d1tuaa1		84	d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae	4e-05
d1tuaa1		84	d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae	5e-04
d1tuaa1		84	d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae	0.001
d2z0sa2		87	d.51.1.1 (A:148-234) Exosome complex RNA-binding p	9e-05
d2z0sa2		87	d.51.1.1 (A:148-234) Exosome complex RNA-binding p	2e-04
d2je6i3		69	d.51.1.1 (I:153-221) Exosome complex RNA-binding p	1e-04
d2je6i3		69	d.51.1.1 (I:153-221) Exosome complex RNA-binding p	3e-04
d2je6i3		69	d.51.1.1 (I:153-221) Exosome complex RNA-binding p	4e-04
d1tuaa2		104	d.51.1.1 (A:85-188) Hypothetical protein APE0754 {	0.002

>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Poly(RC)-binding protein 2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.4 bits (157), Expect = 8e-14
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 401 TVMTRLLVASNQIGCLLGKGGSIIAEMRKLSGAYIRILGKDQIPKCASENEEVVLINGEF 460
           T+  RLL+   ++G ++GK G  + +MR+ SGA I I   +         E ++ + G  
Sbjct: 3   TLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGN-------CPERIITLAGPT 55

Query: 461 EAVQEALFQITTRLR 475
            A+ +A   I  +L 
Sbjct: 56  NAIFKAFAMIIDKLE 70

PyMOL of d2axya1

>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70	Back information, alignment and structure

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70	Back information, alignment and structure

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70	Back information, alignment and structure

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70	Back information, alignment and structure

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70	Back information, alignment and structure

>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79	Back information, alignment and structure

>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79	Back information, alignment and structure

>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79	Back information, alignment and structure

>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79	Back information, alignment and structure

>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79	Back information, alignment and structure

>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74	Back information, alignment and structure

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81	Back information, alignment and structure

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81	Back information, alignment and structure

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81	Back information, alignment and structure

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81	Back information, alignment and structure

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81	Back information, alignment and structure

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71	Back information, alignment and structure

>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54	Back information, alignment and structure

>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54	Back information, alignment and structure

>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54	Back information, alignment and structure

>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84	Back information, alignment and structure

>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84	Back information, alignment and structure

>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84	Back information, alignment and structure

>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84	Back information, alignment and structure

>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78	Back information, alignment and structure

>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84	Back information, alignment and structure

>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84	Back information, alignment and structure

>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84	Back information, alignment and structure

>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87	Back information, alignment and structure

>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87	Back information, alignment and structure

>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69	Back information, alignment and structure

>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69	Back information, alignment and structure

>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69	Back information, alignment and structure

>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		663
d1wvna1		70	Poly(RC)-binding protein 1 {Human (Homo sapiens) [	99.59
d1zzka1		75	HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]}	99.58
d1j4wa1		74	Far upstream binding element, FBP {Human (Homo sap	99.55
d1j4wa2		71	Far upstream binding element, FBP {Human (Homo sap	99.52
d1dtja_		74	Neuro-oncological ventral antigen 2, nova-2, KH3 {	99.5
d1x4na1		79	Far upstream binding element, FBP {Mouse (Mus musc	99.49
d2axya1		71	Poly(RC)-binding protein 2 {Human (Homo sapiens) [	99.45
d1x4ma1		81	Far upstream binding element, FBP {Mouse (Mus musc	99.45
d2axya1		71	Poly(RC)-binding protein 2 {Human (Homo sapiens) [	99.42
d1we8a_		104	Tudor and KH domain containing protein, Tdrkh {Mou	99.41
d1j4wa2		71	Far upstream binding element, FBP {Human (Homo sap	99.41
d1dtja_		74	Neuro-oncological ventral antigen 2, nova-2, KH3 {	99.4
d2ctea1		81	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.4
d2ctla1		84	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.39
d2ctma1		81	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.39
d1x4ma1		81	Far upstream binding element, FBP {Mouse (Mus musc	99.39
d1viga_		71	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.39
d1j4wa1		74	Far upstream binding element, FBP {Human (Homo sap	99.38
d1zzka1		75	HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]}	99.38
d1wvna1		70	Poly(RC)-binding protein 1 {Human (Homo sapiens) [	99.38
d2ctja1		82	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.36
d1we8a_		104	Tudor and KH domain containing protein, Tdrkh {Mou	99.33
d2ctma1		81	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.31
d1x4na1		79	Far upstream binding element, FBP {Mouse (Mus musc	99.31
d2ctla1		84	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.27
d2ctka1		91	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.26
d2ctea1		81	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.25
d1viga_		71	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.23
d2ctja1		82	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.2
d2ba0a3		84	Exosome complex RNA-binding protein 1, ECR1 {Archa	99.18
d2ctka1		91	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.17
d2cpqa1		78	Fragile X mental retardation syndrome related prot	99.17
d2ctfa1		90	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.17
d2ctfa1		90	Vigilin {Human (Homo sapiens) [TaxId: 9606]}	99.04
d2ba0a3		84	Exosome complex RNA-binding protein 1, ECR1 {Archa	99.03
d2cpqa1		78	Fragile X mental retardation syndrome related prot	98.97
d1tuaa1		84	Hypothetical protein APE0754 {Aeropyrum pernix [Ta	98.87
d2je6i3		69	Exosome complex RNA-binding protein 1, ECR1 {Sulfo	98.73
d2z0sa2		87	Exosome complex RNA-binding protein 1, ECR1 {Aerop	98.66
d2je6i3		69	Exosome complex RNA-binding protein 1, ECR1 {Sulfo	98.65
d2z0sa2		87	Exosome complex RNA-binding protein 1, ECR1 {Aerop	98.57
d1e3ha4		54	Polynucleotide phosphorylase/guanosine pentaphosph	98.54
d1tuaa1		84	Hypothetical protein APE0754 {Aeropyrum pernix [Ta	98.52
d1tuaa2		104	Hypothetical protein APE0754 {Aeropyrum pernix [Ta	98.4
d1tuaa2		104	Hypothetical protein APE0754 {Aeropyrum pernix [Ta	98.32
d1e3ha4		54	Polynucleotide phosphorylase/guanosine pentaphosph	98.32
d1k1ga_		122	RNA splicing factor 1 {Human (Homo sapiens) [TaxId	97.81
d1k1ga_		122	RNA splicing factor 1 {Human (Homo sapiens) [TaxId	97.46
d2bl5a1		134	Quaking protein A (Xqua) {African clawed frog (Xen	97.29
d2bl5a1		134	Quaking protein A (Xqua) {African clawed frog (Xen	97.01
d1hh2p3		68	Transcription factor NusA, C-terminal domains {The	94.33
d2asba3		67	Transcription factor NusA, C-terminal domains {Myc	93.84
d2asba3		67	Transcription factor NusA, C-terminal domains {Myc	93.0
d1hh2p3		68	Transcription factor NusA, C-terminal domains {The	91.88
d2ja9a2		85	Ribosomal RNA-processing protein 40, RRP40 {Saccha	86.24
d2ja9a2		85	Ribosomal RNA-processing protein 40, RRP40 {Saccha	81.06

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Poly(RC)-binding protein 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.59  E-value=4.2e-16  Score=123.17  Aligned_cols=69  Identities=32%  Similarity=0.517  Sum_probs=65.3

Q ss_pred             ceEEEEecCCCcCeeecCCChhHHHHHHHcCCEEEEeCCCCCCcceEEEEEcCHHHHHHHHHHHHHHHh
Q 045766          589 RRVPVVVPRSLVPIIQGEDGACLKQIRQISDAKITITDPKPGATETVIIISGTPEQTHAAQSLIQAFVM  657 (663)
Q Consensus       589 ~~~~v~IP~~~vg~IIGkgG~~I~~I~~~sGa~I~i~~~~~~~~~r~v~IsGt~e~v~~A~~lI~~~v~  657 (663)
                      .+.++.||.+++|+||||+|++|++|++.|||+|+|+++.+++.+|.|+|+|++++|+.|+.||+++|+
T Consensus         2 ~T~~i~VP~~~vg~iIGk~G~~I~~I~~~tga~I~i~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~is   70 (70)
T d1wvna1           2 TTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLS   70 (70)
T ss_dssp             EEEEEEEEGGGHHHHHCGGGHHHHHHHHHHCCEEEECCCCTTCSEEEEEEEECHHHHHHHHHHHHHHTC
T ss_pred             eEEEEEEChHhcceeECCCChHHHHHHHHcCcEEEEcCCCCCCCcEEEEEEeCHHHHHHHHHHHHHHcC
Confidence            567899999999999999999999999999999999988888889999999999999999999999874

PyMOL of d1wvna1

>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}	Back information, alignment and structure

>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}	Back information, alignment and structure

>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]}	Back information, alignment and structure

>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]}	Back information, alignment and structure