Citrus Sinensis ID: 045880


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQPSSLIPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI
ccHHHHHHHHHHHcHHHEEEccccccEEEEEEEEEcccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHccHHHEEcccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHEEEEEHHHHHHHHHHHHccc
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDvfenhqpsslipgatLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTtvsgvlnedygrpilLEEIAFHIFAISLLVYLCFLGTTLI
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQPSSLIPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQPSSLIPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI
**VIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQPSSLIPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTT**
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQ*************YEIKWYKEHFTK***********WLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQPSSLIPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQPSSLIPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHi
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTDVFENHQPSSLIPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
147864056 537 hypothetical protein VITISV_019046 [Viti 0.985 0.260 0.453 6e-27
359495447 733 PREDICTED: uncharacterized protein LOC10 0.964 0.186 0.393 2e-25
147841950 714 hypothetical protein VITISV_026950 [Viti 0.992 0.197 0.385 3e-25
359476634 969 PREDICTED: uncharacterized protein LOC10 0.964 0.141 0.383 6e-25
297743742 351 unnamed protein product [Vitis vinifera] 0.950 0.384 0.407 7e-25
147776365 800 hypothetical protein VITISV_007268 [Viti 0.950 0.168 0.407 1e-24
359484885 1020 PREDICTED: uncharacterized protein LOC10 0.950 0.132 0.407 2e-24
359479721 749 PREDICTED: uncharacterized protein LOC10 0.950 0.180 0.408 2e-24
359484881 741 PREDICTED: uncharacterized protein LOC10 0.950 0.182 0.393 4e-24
224066419 360 predicted protein [Populus trichocarpa] 0.964 0.380 0.379 4e-24
>gi|147864056|emb|CAN83220.1| hypothetical protein VITISV_019046 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 93/161 (57%), Gaps = 21/161 (13%)

Query: 3   VIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTD--------VFENHQPSSL--------- 45
           V E+V+ IL+ F VAI + +   KN+VLLA  +        V +N   S+L         
Sbjct: 286 VKEMVDSILEEFPVAIHDRNKEKKNVVLLAVENRQPEVVFGVVDNEGNSALHLGATLGDY 345

Query: 46  ----IPGATLQMQYEIKWYKEHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAAS 101
               IPGA LQMQ+EIKWYK  FT  H +L  RG KWL  TS +C V A LIA VAFA S
Sbjct: 346 QPWHIPGAALQMQWEIKWYKRIFTNHHTELVSRGGKWLNDTSSSCSVVATLIATVAFATS 405

Query: 102 TTVSGVLNEDYGRPILLEEIAFHIFAISLLVYLCFLGTTLI 142
           TT+ G    + GR  L  + AF++FAIS L+ LCF  TT++
Sbjct: 406 TTIPGSFKNNNGRRNLEHQAAFNLFAISSLIALCFSVTTMV 446




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359495447|ref|XP_002274376.2| PREDICTED: uncharacterized protein LOC100254555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147841950|emb|CAN67508.1| hypothetical protein VITISV_026950 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476634|ref|XP_002273692.2| PREDICTED: uncharacterized protein LOC100246246 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743742|emb|CBI36625.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147776365|emb|CAN76466.1| hypothetical protein VITISV_007268 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484885|ref|XP_003633180.1| PREDICTED: uncharacterized protein LOC100854873 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479721|ref|XP_002272096.2| PREDICTED: uncharacterized protein LOC100255529 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484881|ref|XP_002270267.2| PREDICTED: uncharacterized protein LOC100245091 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224066419|ref|XP_002302098.1| predicted protein [Populus trichocarpa] gi|222843824|gb|EEE81371.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
TAIR|locus:2175413 669 AT5G04700 "AT5G04700" [Arabido 0.563 0.119 0.378 1.2e-11
TAIR|locus:2165174 347 AT5G35810 "AT5G35810" [Arabido 0.556 0.227 0.369 1.5e-11
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.563 0.128 0.365 2.2e-11
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.535 0.126 0.342 4.5e-10
TAIR|locus:2080240 574 AT3G54070 "AT3G54070" [Arabido 0.457 0.113 0.383 1.1e-08
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 126 (49.4 bits), Expect = 1.2e-11, Sum P(2) = 1.2e-11
 Identities = 31/82 (37%), Positives = 45/82 (54%)

Query:    62 EHFTKTHKKLGKRGSKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNEDY-GRPILLEE 120
             E FTK H+ L +   KW+  T+ +C + A LI  V FAA  TV G  +++  G+P  L +
Sbjct:   488 EIFTKEHQGLRQEAEKWMKDTAMSCSLVAALIVTVTFAAVFTVPGGTDDNSKGKPFHLRD 547

Query:   121 IAFHIFAISLLVYLCFLGTTLI 142
               F IF +S L+  CF   T +
Sbjct:   548 RRFIIFIVSDLIS-CFASCTSV 568


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023793001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (644 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
pfam13962114 pfam13962, PGG, Domain of unknown function 3e-07
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score = 45.6 bits (109), Expect = 3e-07
 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 76  SKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNED-----YGRPILLEEI-AFHIFAIS 129
           S+WL KT  +  V A LIA V FAA  T  G   +D      G PIL  +   F  F +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
PF13962113 PGG: Domain of unknown function 99.88
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 97.67
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 97.26
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 96.73
PHA02876 682 ankyrin repeat protein; Provisional 96.47
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 96.17
KOG4412226 consensus 26S proteasome regulatory complex, subun 95.11
PHA02741169 hypothetical protein; Provisional 94.74
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 94.6
KOG4412226 consensus 26S proteasome regulatory complex, subun 94.52
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 93.95
PHA02741169 hypothetical protein; Provisional 93.94
PHA02736154 Viral ankyrin protein; Provisional 93.72
PHA02743166 Viral ankyrin protein; Provisional 93.36
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 93.26
PHA02874 434 ankyrin repeat protein; Provisional 93.11
PLN03192 823 Voltage-dependent potassium channel; Provisional 92.58
PHA02875 413 ankyrin repeat protein; Provisional 92.56
PHA02878 477 ankyrin repeat protein; Provisional 92.53
PHA02878 477 ankyrin repeat protein; Provisional 92.43
PHA02743166 Viral ankyrin protein; Provisional 92.42
PHA02946 446 ankyin-like protein; Provisional 92.4
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 92.38
PHA02859209 ankyrin repeat protein; Provisional 91.9
PHA02791284 ankyrin-like protein; Provisional 91.75
PHA02859209 ankyrin repeat protein; Provisional 91.62
PHA02875 413 ankyrin repeat protein; Provisional 91.52
PHA03100 480 ankyrin repeat protein; Provisional 91.41
PLN03192823 Voltage-dependent potassium channel; Provisional 91.37
PHA02946 446 ankyin-like protein; Provisional 91.35
PF1360630 Ank_3: Ankyrin repeat 91.06
PHA02874 434 ankyrin repeat protein; Provisional 90.86
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 90.54
PHA02795437 ankyrin-like protein; Provisional 90.39
PHA02791284 ankyrin-like protein; Provisional 90.27
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 89.92
PHA02736154 Viral ankyrin protein; Provisional 89.82
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 89.46
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 89.23
PHA02798 489 ankyrin-like protein; Provisional 88.74
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 88.25
PHA02989 494 ankyrin repeat protein; Provisional 88.18
PHA02798 489 ankyrin-like protein; Provisional 88.15
PHA03100 480 ankyrin repeat protein; Provisional 88.08
PHA03095 471 ankyrin-like protein; Provisional 88.08
PHA02795437 ankyrin-like protein; Provisional 87.62
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 86.4
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 85.89
PHA02989 494 ankyrin repeat protein; Provisional 85.8
PHA02876 682 ankyrin repeat protein; Provisional 85.59
KOG0514452 consensus Ankyrin repeat protein [General function 85.26
PHA02730 672 ankyrin-like protein; Provisional 84.45
PHA02884 300 ankyrin repeat protein; Provisional 84.41
TIGR00870 743 trp transient-receptor-potential calcium channel p 84.39
KOG0512228 consensus Fetal globin-inducing factor (contains a 83.98
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 83.85
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 83.02
KOG0510 929 consensus Ankyrin repeat protein [General function 83.02
PHA03095 471 ankyrin-like protein; Provisional 82.38
PHA02917 661 ankyrin-like protein; Provisional 81.48
PHA02884300 ankyrin repeat protein; Provisional 80.35
KOG0514452 consensus Ankyrin repeat protein [General function 80.07
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
Probab=99.88  E-value=5.7e-23  Score=149.02  Aligned_cols=67  Identities=36%  Similarity=0.462  Sum_probs=62.2

Q ss_pred             hHHHHhhhhhhHHHHHHHHHHHHHhhhccCCcccCC---CCcccccccc-hhhHHHHHHHHHHHHHhhhcC
Q 045880           76 SKWLIKTSKACFVFAMLIANVAFAASTTVSGVLNED---YGRPILLEEI-AFHIFAISLLVYLCFLGTTLI  142 (142)
Q Consensus        76 ~~~~k~~~~s~~vvA~LIATvtFaAaftvPGG~~~~---~G~~~l~~~~-~F~~F~i~~~~a~~~S~~av~  142 (142)
                      +||+++++|+++|||+|||||||+|+||+||||+++   .|+|++.+++ .|++|+++|++||++|+++++
T Consensus         1 ~~~~~~~~~~llVvAtLIATvtF~A~~tpPGG~~~~~~~~G~~il~~~~~~f~~F~~~nt~af~~S~~~i~   71 (113)
T PF13962_consen    1 KKWLEDTRNSLLVVATLIATVTFQAAFTPPGGYWQDDDDAGTPILAKKPSAFKAFLISNTIAFFSSLAAIF   71 (113)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCccccccCCCCchhccccchhhhHHHHHHHHHHHHHHHHH
Confidence            589999999999999999999999999999999654   7999998888 999999999999999998763



>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 96.76
3v30_A172 DNA-binding protein rfxank; structural genomics co 96.76
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 96.66
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 96.65
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 96.65
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 96.51
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 96.5
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 96.46
4gpm_A169 Engineered protein OR264; de novo protein, structu 96.42
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 96.39
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 96.27
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 96.17
3hra_A201 Ankyrin repeat family protein; structural protein; 96.15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 96.14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 96.14
2rfa_A232 Transient receptor potential cation channel subfa 96.14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 96.09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 96.05
3hra_A201 Ankyrin repeat family protein; structural protein; 96.04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 95.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 95.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 95.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 95.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 95.89
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 95.88
2pnn_A273 Transient receptor potential cation channel subfa 95.88
2etb_A256 Transient receptor potential cation channel subfam 95.87
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 95.84
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 95.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 95.81
4gpm_A169 Engineered protein OR264; de novo protein, structu 95.81
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 95.81
3v31_A167 Ankyrin repeat family A protein 2; structural geno 95.76
2rfa_A232 Transient receptor potential cation channel subfa 95.75
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 95.72
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 95.72
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 95.69
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 95.69
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 95.67
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 95.59
3deo_A183 Signal recognition particle 43 kDa protein; chloro 95.57
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 95.56
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 95.53
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 95.49
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 95.48
1awc_B153 Protein (GA binding protein beta 1); complex (tran 95.46
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 95.44
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 95.42
1awc_B153 Protein (GA binding protein beta 1); complex (tran 95.42
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 95.41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 95.4
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 95.37
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 95.33
3v30_A172 DNA-binding protein rfxank; structural genomics co 95.33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 95.32
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 95.25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 95.22
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 95.16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 95.09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 95.06
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 95.06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 95.06
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 95.03
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 95.0
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 94.98
3v31_A167 Ankyrin repeat family A protein 2; structural geno 94.97
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 94.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 94.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 94.92
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 94.89
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 94.87
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 94.87
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 94.87
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 94.86
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 94.82
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 94.79
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 94.67
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 94.63
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 94.62
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 94.62
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 94.57
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 94.53
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 94.49
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 94.48
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 94.44
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 94.41
1sw6_A327 Regulatory protein SWI6; transcription regulation, 94.32
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 94.31
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 94.22
2etb_A256 Transient receptor potential cation channel subfam 94.22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 94.18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 94.15
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 94.13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 94.09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 94.08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 93.99
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 93.96
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 93.76
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 93.58
3jxi_A260 Vanilloid receptor-related osmotically activated p 93.41
2pnn_A273 Transient receptor potential cation channel subfa 93.02
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 92.8
1sw6_A327 Regulatory protein SWI6; transcription regulation, 92.8
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 92.72
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 92.53
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 92.52
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 92.52
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 92.48
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 92.38
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 92.1
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 91.41
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 91.35
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 89.68
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 80.14
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
Probab=96.76  E-value=0.00088  Score=46.87  Aligned_cols=33  Identities=21%  Similarity=0.323  Sum_probs=27.9

Q ss_pred             CChHHHHHHHHHhCcccceeccCCCCchhHHHHH
Q 045880            1 MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYT   34 (142)
Q Consensus         1 ~G~~eiV~~ll~~~P~~~~~~D~~g~niLHvAv~   34 (142)
                      +|+.++++.|+++..+ +...|.+|+|+||+|++
T Consensus        80 ~~~~~~v~~Ll~~g~~-~~~~~~~g~t~L~~A~~  112 (162)
T 1ihb_A           80 AGFLDTLQTLLEFQAD-VNIEDNEGNLPLHLAAK  112 (162)
T ss_dssp             HTCHHHHHHHHHTTCC-TTCCCTTSCCHHHHHHH
T ss_pred             cCCHHHHHHHHHcCCC-CCCcCCCCCCHHHHHHH
Confidence            3789999999998654 56789999999999994



>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 97.68
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 97.37
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 97.02
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 97.01
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 96.85
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 96.81
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 96.81
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 96.76
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 96.7
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 96.52
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 96.52
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 96.47
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 96.33
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 96.24
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 96.08
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 96.05
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 95.96
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 95.86
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 95.83
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 95.79
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 95.75
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 95.74
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 95.58
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 95.46
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 94.99
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 94.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 94.75
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 94.72
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 94.35
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 93.54
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 93.09
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 92.51
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 89.83
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 88.55
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 85.24
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.68  E-value=1.4e-05  Score=58.46  Aligned_cols=35  Identities=14%  Similarity=0.131  Sum_probs=33.0

Q ss_pred             CChHHHHHHHHHhCcccceeccCCCCchhHHHHHH
Q 045880            1 MGVIEIVEKILDAFLVAIQEEDTNGKNIVLLAYTD   35 (142)
Q Consensus         1 ~G~~eiV~~ll~~~P~~~~~~D~~g~niLHvAv~~   35 (142)
                      +|++|.|++++...|..+..+|++|+|+||+|+.+
T Consensus        13 ~G~~~~v~~~l~~~~~~~~~~D~~G~TpLh~Aa~~   47 (223)
T d1uoha_          13 SGKLEELKESILADKSLATRTDQDSRTALHWACSA   47 (223)
T ss_dssp             TTCHHHHHHHHHHCGGGGGCCCTTSCCHHHHHHHH
T ss_pred             hCCHHHHHHHHHhCCCcCcCcCCCCCCHHHHHHHh
Confidence            59999999999999999999999999999999943



>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure