Citrus Sinensis ID: 045917


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE
ccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHcHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHccc
MISRQIETLIQLSKTahhhhqlpalflktsldhntyIISRFILtslpislhFTRSlfnnvmpplfAYNTLIRAYAKTSCSIESIKLFDEMLktglrpdnltypfvvkasdqclligvggSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE
MISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE
MISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE
***********************ALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALF*****
*ISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE
MISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE
MISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMP*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q9LUJ2 842 Pentatricopeptide repeat- yes no 0.833 0.160 0.361 1e-19
Q9MA95 565 Putative pentatricopeptid no no 0.882 0.253 0.310 6e-19
Q9ZQA1 501 Pentatricopeptide repeat- no no 0.975 0.315 0.321 5e-18
A8MQA3 595 Pentatricopeptide repeat- no no 0.753 0.205 0.377 1e-17
Q9C6T2 606 Pentatricopeptide repeat- no no 0.765 0.204 0.304 2e-17
P0C8Q7 534 Pentatricopeptide repeat- no no 0.611 0.185 0.4 6e-17
Q9CA54 643 Pentatricopeptide repeat- no no 0.864 0.217 0.331 6e-17
Q9FHR3 550 Putative pentatricopeptid no no 0.969 0.285 0.329 2e-16
Q9FG16 622 Pentatricopeptide repeat- no no 0.845 0.220 0.308 6e-16
O64705 621 Pentatricopeptide repeat- no no 0.623 0.162 0.421 7e-16
>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 77/141 (54%), Gaps = 6/141 (4%)

Query: 28  KTSLDHNTYIISRFILTSLPI----SLHFTRSLFNNVMP--PLFAYNTLIRAYAKTSCSI 81
           K  LD++   I++ +  S  +    SL F + +F N       F YN+LIR YA +    
Sbjct: 57  KQGLDNDVSTITKLVARSCELGTRESLSFAKEVFENSESYGTCFMYNSLIRGYASSGLCN 116

Query: 82  ESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLL 141
           E+I LF  M+ +G+ PD  T+PF + A  +    G G  +H LI K+G   D ++ N+L+
Sbjct: 117 EAILLFLRMMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLV 176

Query: 142 RMYAACKEIDFAKALFDEMPE 162
             YA C E+D A+ +FDEM E
Sbjct: 177 HFYAECGELDSARKVFDEMSE 197





Arabidopsis thaliana (taxid: 3702)
>sp|Q9MA95|PP214_ARATH Putative pentatricopeptide repeat-containing protein At3g05240 OS=Arabidopsis thaliana GN=PCMP-E82 PE=3 SV=2 Back     alignment and function description
>sp|Q9ZQA1|PP188_ARATH Pentatricopeptide repeat-containing protein At2g36730 OS=Arabidopsis thaliana GN=PCMP-E44 PE=3 SV=1 Back     alignment and function description
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protein At1g31920 OS=Arabidopsis thaliana GN=PCMP-H11 PE=2 SV=1 Back     alignment and function description
>sp|P0C8Q7|PP369_ARATH Pentatricopeptide repeat-containing protein At5g08305 OS=Arabidopsis thaliana GN=PCMP-E105 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protein At1g74630 OS=Arabidopsis thaliana GN=PCMP-H71 PE=2 SV=1 Back     alignment and function description
>sp|Q9FHR3|PP403_ARATH Putative pentatricopeptide repeat-containing protein At5g37570 OS=Arabidopsis thaliana GN=PCMP-E37 PE=3 SV=1 Back     alignment and function description
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protein At2g34400 OS=Arabidopsis thaliana GN=PCMP-E23 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
225435652 461 PREDICTED: pentatricopeptide repeat-cont 0.981 0.344 0.503 7e-42
356528208 444 PREDICTED: pentatricopeptide repeat-cont 0.975 0.355 0.487 4e-32
224141397 505 predicted protein [Populus trichocarpa] 0.888 0.285 0.394 3e-20
356574121 548 PREDICTED: pentatricopeptide repeat-cont 0.993 0.293 0.351 2e-19
357487485 498 Pentatricopeptide repeat-containing prot 0.864 0.281 0.387 2e-19
449445234 542 PREDICTED: pentatricopeptide repeat-cont 0.962 0.287 0.386 6e-19
449507733 442 PREDICTED: pentatricopeptide repeat-cont 0.962 0.352 0.386 7e-19
225468727 558 PREDICTED: pentatricopeptide repeat-cont 0.876 0.254 0.406 2e-18
356529748 604 PREDICTED: pentatricopeptide repeat-cont 0.938 0.251 0.345 2e-18
255549842 546 pentatricopeptide repeat-containing prot 0.635 0.188 0.462 4e-18
>gi|225435652|ref|XP_002283361.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 116/161 (72%), Gaps = 2/161 (1%)

Query: 2   ISRQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPISLHFTRSLFNN-- 59
           +SRQI+ L+Q SKT  H  QL +L LKT+ DHN  +IS+FI +   +S+ F R +F+   
Sbjct: 1   MSRQIQILLQRSKTTTHLLQLHSLILKTAKDHNPDLISQFIFSISSVSIEFARLVFDRLP 60

Query: 60  VMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGG 119
           +  P+FA+N++IRAY K+S  IE++KLF +M + GL+PDN TYPFVVKA  + L++G GG
Sbjct: 61  IRAPIFAWNSIIRAYTKSSVPIEAVKLFSQMQRVGLKPDNFTYPFVVKACGRSLVVGAGG 120

Query: 120 SVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEM 160
           ++HS+I K G  SD+Y+GNTLLRMYA    +  A+ +F+EM
Sbjct: 121 AMHSIIVKAGFDSDRYVGNTLLRMYANLNAVGLARRVFNEM 161




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356528208|ref|XP_003532697.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Back     alignment and taxonomy information
>gi|224141397|ref|XP_002324059.1| predicted protein [Populus trichocarpa] gi|222867061|gb|EEF04192.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356574121|ref|XP_003555200.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like [Glycine max] Back     alignment and taxonomy information
>gi|357487485|ref|XP_003614030.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355515365|gb|AES96988.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449445234|ref|XP_004140378.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449507733|ref|XP_004163116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225468727|ref|XP_002271484.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356529748|ref|XP_003533450.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31920-like [Glycine max] Back     alignment and taxonomy information
>gi|255549842|ref|XP_002515972.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544877|gb|EEF46392.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2151694 550 AT5G37570 "AT5G37570" [Arabido 0.969 0.285 0.335 1.9e-22
TAIR|locus:2040565 501 AT2G36730 [Arabidopsis thalian 0.981 0.317 0.323 2.2e-17
TAIR|locus:2034456 606 AT1G31920 [Arabidopsis thalian 0.932 0.249 0.3 2.6e-17
TAIR|locus:4010713895 595 AT4G21065 "AT4G21065" [Arabido 0.753 0.205 0.377 3.2e-17
TAIR|locus:2019160 643 AT1G74630 [Arabidopsis thalian 0.944 0.237 0.322 2.1e-16
TAIR|locus:2056740 603 OTP85 "ORGANELLE TRANSCRIPT PR 0.876 0.235 0.294 3.7e-15
TAIR|locus:2144143 622 AT5G06540 [Arabidopsis thalian 0.827 0.215 0.314 1.3e-14
TAIR|locus:2117084 545 AT4G18840 "AT4G18840" [Arabido 0.962 0.286 0.298 1.3e-14
TAIR|locus:2077878 685 AT3G08820 "AT3G08820" [Arabido 0.981 0.232 0.291 1.6e-14
TAIR|locus:2094812 600 AT3G29230 "AT3G29230" [Arabido 0.987 0.266 0.345 5.6e-14
TAIR|locus:2151694 AT5G37570 "AT5G37570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 1.9e-22, Sum P(2) = 1.9e-22
 Identities = 54/161 (33%), Positives = 90/161 (55%)

Query:     6 IETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSLPIS--LHFTRSLFNNVMPP 63
             +ETL +L K+  H +Q+ A  ++  L+ +  +IS FI +S   S  L ++ S+F  V  P
Sbjct:    13 LETLFKLCKSEIHLNQIHARIIRKGLEQDQNLISIFISSSSSSSSSLSYSSSVFERVPSP 72

Query:    64 -LFAYNTLIRAYAKTSCSIESIKLFDEMLKTGL-RPDNLTYPFVVKASDQCLLIGVGGSV 121
               + +N LI+ Y+      E++ +   M++TGL RPD  T+P V+K       + VG SV
Sbjct:    73 GTYLWNHLIKGYSNKFLFFETVSILMRMMRTGLARPDEYTFPLVMKVCSNNGQVRVGSSV 132

Query:   122 HSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMPE 162
             H L+ ++G   D  +G + +  Y  CK++  A+ +F EMPE
Sbjct:   133 HGLVLRIGFDKDVVVGTSFVDFYGKCKDLFSARKVFGEMPE 173


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2040565 AT2G36730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034456 AT1G31920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019160 AT1G74630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056740 OTP85 "ORGANELLE TRANSCRIPT PROCESSING 85" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144143 AT5G06540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117084 AT4G18840 "AT4G18840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077878 AT3G08820 "AT3G08820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094812 AT3G29230 "AT3G29230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-13
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-12
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-08
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 9e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-04
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score = 67.2 bits (164), Expect = 1e-13
 Identities = 33/98 (33%), Positives = 53/98 (54%)

Query: 64  LFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHS 123
           LF++N L+  YAK     E++ L+  ML  G+RPD  T+P V++       +  G  VH+
Sbjct: 152 LFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHA 211

Query: 124 LIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDEMP 161
            + + G   D  + N L+ MY  C ++  A+ +FD MP
Sbjct: 212 HVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMP 249


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.98
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.98
PLN03218 1060 maturation of RBCL 1; Provisional 99.97
PLN03218 1060 maturation of RBCL 1; Provisional 99.97
PLN03077 857 Protein ECB2; Provisional 99.97
PLN03077 857 Protein ECB2; Provisional 99.97
PF1304150 PPR_2: PPR repeat family 99.72
PF1304150 PPR_2: PPR repeat family 99.61
PF1285434 PPR_1: PPR repeat 99.41
PRK11788389 tetratricopeptide repeat protein; Provisional 99.32
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.27
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.21
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.19
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.13
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.06
PF1285434 PPR_1: PPR repeat 99.04
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.99
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.9
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.85
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.74
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.74
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.62
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.59
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.55
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.54
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.54
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.54
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.52
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.48
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.48
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.47
PRK12370553 invasion protein regulator; Provisional 98.47
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.46
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.46
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.38
PRK12370553 invasion protein regulator; Provisional 98.34
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.33
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.27
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.23
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.22
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.2
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.18
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.16
PRK14574 822 hmsH outer membrane protein; Provisional 98.16
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.15
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.14
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.13
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.12
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.09
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.04
PRK14574 822 hmsH outer membrane protein; Provisional 97.98
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.96
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.96
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.93
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.93
PRK15359144 type III secretion system chaperone protein SscB; 97.91
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.88
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.8
PRK11189296 lipoprotein NlpI; Provisional 97.76
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.74
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.73
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.73
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.72
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.69
PRK15359144 type III secretion system chaperone protein SscB; 97.69
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.67
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.67
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.65
PRK10370198 formate-dependent nitrite reductase complex subuni 97.65
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.62
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 97.61
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.59
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.56
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.54
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.54
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.51
KOG1126638 consensus DNA-binding cell division cycle control 97.51
PRK11189 296 lipoprotein NlpI; Provisional 97.5
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.46
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.45
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.38
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.33
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.31
PRK10370198 formate-dependent nitrite reductase complex subuni 97.31
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.31
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.28
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.27
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.25
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.25
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.18
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.16
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.15
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.13
KOG1126 638 consensus DNA-binding cell division cycle control 97.13
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.12
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.08
KOG3941 406 consensus Intermediate in Toll signal transduction 97.08
KOG1129478 consensus TPR repeat-containing protein [General f 97.06
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.02
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.0
KOG2003 840 consensus TPR repeat-containing protein [General f 96.98
KOG2003 840 consensus TPR repeat-containing protein [General f 96.92
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.9
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.86
KOG1129 478 consensus TPR repeat-containing protein [General f 96.84
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.84
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.81
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.81
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.79
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.65
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.65
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.64
KOG3060 289 consensus Uncharacterized conserved protein [Funct 96.64
KOG2076 895 consensus RNA polymerase III transcription factor 96.63
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.6
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.54
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 96.52
PF12688120 TPR_5: Tetratrico peptide repeat 96.38
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.38
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.37
KOG0547 606 consensus Translocase of outer mitochondrial membr 96.36
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.3
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.28
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.28
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.27
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.27
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.26
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.23
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.2
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.2
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.16
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.13
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.09
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.07
KOG1125579 consensus TPR repeat-containing protein [General f 96.06
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.04
PRK10803263 tol-pal system protein YbgF; Provisional 95.99
KOG0547606 consensus Translocase of outer mitochondrial membr 95.99
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.98
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.93
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 95.92
KOG0495 913 consensus HAT repeat protein [RNA processing and m 95.87
KOG1128 777 consensus Uncharacterized conserved protein, conta 95.87
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 95.85
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.76
KOG2076 895 consensus RNA polymerase III transcription factor 95.75
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.75
PF13762145 MNE1: Mitochondrial splicing apparatus component 95.69
PF13929292 mRNA_stabil: mRNA stabilisation 95.66
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 95.64
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.59
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.58
PF1337173 TPR_9: Tetratricopeptide repeat 95.54
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 95.53
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 95.52
PRK14720 906 transcript cleavage factor/unknown domain fusion p 95.5
KOG4340 459 consensus Uncharacterized conserved protein [Funct 95.22
KOG0495 913 consensus HAT repeat protein [RNA processing and m 95.07
KOG3785557 consensus Uncharacterized conserved protein [Funct 95.04
PRK04841 903 transcriptional regulator MalT; Provisional 95.04
KOG3941 406 consensus Intermediate in Toll signal transduction 95.03
KOG4570 418 consensus Uncharacterized conserved protein [Funct 94.99
PRK10803263 tol-pal system protein YbgF; Provisional 94.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 94.88
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.83
PF12688120 TPR_5: Tetratrico peptide repeat 94.83
KOG2047 835 consensus mRNA splicing factor [RNA processing and 94.81
PF1337173 TPR_9: Tetratricopeptide repeat 94.74
KOG3785557 consensus Uncharacterized conserved protein [Funct 94.57
KOG2376 652 consensus Signal recognition particle, subunit Srp 94.56
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.55
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.46
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 94.41
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.14
KOG3616 1636 consensus Selective LIM binding factor [Transcript 94.13
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.12
COG3629280 DnrI DNA-binding transcriptional activator of the 94.1
PF13929292 mRNA_stabil: mRNA stabilisation 94.05
KOG1128 777 consensus Uncharacterized conserved protein, conta 93.94
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 93.77
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.76
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 93.52
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 93.36
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.35
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.09
KOG0553 304 consensus TPR repeat-containing protein [General f 93.06
PRK10153517 DNA-binding transcriptional activator CadC; Provis 93.06
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.89
KOG2796366 consensus Uncharacterized conserved protein [Funct 92.85
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.8
smart00299140 CLH Clathrin heavy chain repeat homology. 92.65
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 92.55
PRK15331165 chaperone protein SicA; Provisional 91.97
PRK04841 903 transcriptional regulator MalT; Provisional 91.87
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.86
smart00299140 CLH Clathrin heavy chain repeat homology. 91.74
PRK15331165 chaperone protein SicA; Provisional 91.68
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.58
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 91.52
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.37
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.31
PLN02789 320 farnesyltranstransferase 91.26
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.06
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.63
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.59
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 90.13
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 90.12
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 90.0
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 89.99
PF1342844 TPR_14: Tetratricopeptide repeat 89.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 89.84
KOG0553304 consensus TPR repeat-containing protein [General f 89.83
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 89.8
COG3629280 DnrI DNA-binding transcriptional activator of the 89.79
COG1729262 Uncharacterized protein conserved in bacteria [Fun 89.69
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.66
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 89.65
KOG2376 652 consensus Signal recognition particle, subunit Srp 89.61
KOG4555175 consensus TPR repeat-containing protein [Function 89.53
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 89.45
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 89.38
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.36
COG1729262 Uncharacterized protein conserved in bacteria [Fun 89.17
COG4235287 Cytochrome c biogenesis factor [Posttranslational 89.0
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 88.77
PLN02789 320 farnesyltranstransferase 88.69
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.18
PF13281374 DUF4071: Domain of unknown function (DUF4071) 88.03
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 87.68
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 87.54
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.53
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 87.35
PF1342844 TPR_14: Tetratricopeptide repeat 86.9
KOG1125579 consensus TPR repeat-containing protein [General f 86.5
COG4700251 Uncharacterized protein conserved in bacteria cont 86.22
PF13170297 DUF4003: Protein of unknown function (DUF4003) 86.09
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 85.85
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 85.74
PF13762145 MNE1: Mitochondrial splicing apparatus component 85.69
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 85.65
PF09477116 Type_III_YscG: Bacterial type II secretion system 85.16
COG3898 531 Uncharacterized membrane-bound protein [Function u 84.58
PF1343134 TPR_17: Tetratricopeptide repeat 84.42
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 84.26
KOG4162799 consensus Predicted calmodulin-binding protein [Si 84.18
KOG4648 536 consensus Uncharacterized conserved protein, conta 83.99
COG3118304 Thioredoxin domain-containing protein [Posttransla 83.69
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 83.44
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 83.41
PF13934226 ELYS: Nuclear pore complex assembly 82.92
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 82.69
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.47
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 82.39
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 82.06
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 81.6
COG4700251 Uncharacterized protein conserved in bacteria cont 81.25
KOG2610 491 consensus Uncharacterized conserved protein [Funct 80.87
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.67
PRK10564303 maltose regulon periplasmic protein; Provisional 80.13
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=99.98  E-value=6e-32  Score=212.63  Aligned_cols=158  Identities=15%  Similarity=0.220  Sum_probs=148.0

Q ss_pred             hHHHHHHHHhhchhhhcchhHHHHHhcCCCchhHHHHHHHhhC-CCChHHHHHHhhhhC-CChhHHHHHHHHHHcCCCch
Q 045917            4 RQIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSL-PISLHFTRSLFNNVM-PPLFAYNTLIRAYAKTSCSI   81 (162)
Q Consensus         4 ~~~~~~l~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~-~~~~~~a~~~~~~m~-~~~~~~~~li~~~~~~~~~~   81 (162)
                      ++++..+...|++++|++++..|.+.|+.|+..+||+|+++|+ .|++++|.++|++|. ||..+||+||.+|+++|+.+
T Consensus       329 ~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~  408 (697)
T PLN03081        329 SIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGT  408 (697)
T ss_pred             HHHHHHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHH
Confidence            3444455555788889999999999999999999999999999 999999999999999 99999999999999999999


Q ss_pred             HHHHHHHHHHHcCCCCCCccHHHHHHHhhhhccchhhhHHHHHHHH-HhcCcchhHHHHHHHHHHhcCChhHHHHhhccc
Q 045917           82 ESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFK-VGLHSDKYIGNTLLRMYAACKEIDFAKALFDEM  160 (162)
Q Consensus        82 ~a~~~~~~m~~~~~~p~~~t~~~li~~~~~~~~~~~a~~i~~~~~~-~~~~~~~~~~~~ll~~y~~~g~~~~a~~~~~~m  160 (162)
                      +|+++|++|.+.|+.||..||++++.+|++.|..++|.++|..|.+ .|+.|+..+|++++++|++.|++++|.++|++|
T Consensus       409 ~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~  488 (697)
T PLN03081        409 KAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRA  488 (697)
T ss_pred             HHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHC
Confidence            9999999999999999999999999999999999999999999976 699999999999999999999999999999998


Q ss_pred             C
Q 045917          161 P  161 (162)
Q Consensus       161 ~  161 (162)
                      +
T Consensus       489 ~  489 (697)
T PLN03081        489 P  489 (697)
T ss_pred             C
Confidence            6



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF13934 ELYS: Nuclear pore complex assembly Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 44.4 bits (103), Expect = 6e-06
 Identities = 11/59 (18%), Positives = 23/59 (38%)

Query: 50  LHFTRSLFNNVMPPLFAYNTLIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKA 108
           +          +  L  YN ++  +A+     E + +   +   GL PD L+Y   ++ 
Sbjct: 151 VVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQC 209


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.92
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.85
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.64
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.63
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.28
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.23
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.23
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.2
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.2
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.17
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.08
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.07
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.05
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.03
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.02
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.0
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.98
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.98
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.97
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.95
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.91
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.89
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.88
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.84
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.82
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.82
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.8
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.8
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.8
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.79
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.78
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.78
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.78
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.77
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.76
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.71
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 98.71
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.66
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.65
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.63
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.6
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.57
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.55
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.55
3u4t_A272 TPR repeat-containing protein; structural genomics 98.53
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.53
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.52
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.45
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.45
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.45
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.44
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.43
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.43
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.43
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.42
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.41
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.39
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.37
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.37
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.36
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.35
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.31
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.31
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.31
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.28
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.27
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.25
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.22
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.22
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.22
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.2
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.19
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.19
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.17
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.15
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.14
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.12
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.1
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.09
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.08
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.08
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.07
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.05
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.03
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.03
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.02
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.02
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.01
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.01
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.01
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.01
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.99
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.99
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.98
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.98
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.98
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.97
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.97
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.95
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.93
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.92
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.91
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.89
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 97.89
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.88
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.83
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.83
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.82
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.81
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.81
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.81
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.78
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.77
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.76
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.74
3k9i_A117 BH0479 protein; putative protein binding protein, 97.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.72
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.7
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.7
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.69
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.68
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.68
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.66
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.66
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.63
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.57
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.56
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.56
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.56
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.55
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.53
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.46
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.45
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.44
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.42
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.39
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.39
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.38
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.37
3k9i_A117 BH0479 protein; putative protein binding protein, 97.32
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.28
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.27
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.24
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.16
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.15
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.09
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 97.04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.01
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.0
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.98
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.98
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 96.94
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.9
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.89
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.84
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.78
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.77
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.71
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.59
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.55
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 96.54
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 96.51
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.46
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 96.41
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.33
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.2
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.1
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.08
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.4
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.4
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.3
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.72
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.68
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 94.47
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.83
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.6
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.44
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 93.02
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.72
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.56
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.5
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.41
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 92.11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 92.03
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 91.9
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.6
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 91.52
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 91.4
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 91.15
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 91.05
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.68
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.64
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 90.57
2uwj_G115 Type III export protein PSCG; virulence, chaperone 90.53
2p58_C116 Putative type III secretion protein YSCG; type III 90.34
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 89.68
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 89.48
1pc2_A152 Mitochondria fission protein; unknown function; NM 88.99
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 87.86
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 87.28
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 87.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 86.68
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 86.63
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 85.33
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.07
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 84.56
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 84.41
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.75
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 82.68
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 81.41
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.0
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.38
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=5.2e-36  Score=226.60  Aligned_cols=157  Identities=10%  Similarity=0.052  Sum_probs=149.0

Q ss_pred             HHHHHHHHhhchhhhcchhHHHHHhcCCCchhHHHHHHHhhC-CCC---------hHHHHHHhhhhC-----CChhHHHH
Q 045917            5 QIETLIQLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSL-PIS---------LHFTRSLFNNVM-----PPLFAYNT   69 (162)
Q Consensus         5 ~~~~~l~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~-~~~---------~~~a~~~~~~m~-----~~~~~~~~   69 (162)
                      ..+..+.+.|++++|.++|+.|++.|+.||..+||+||.+|+ .+.         ++.|.++|++|.     ||..|||+
T Consensus        31 ~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~  110 (501)
T 4g26_A           31 QKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNEATFTN  110 (501)
T ss_dssp             HHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCHHHHHH
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCHHHHHH
Confidence            345556666899999999999999999999999999999998 654         688999999997     99999999


Q ss_pred             HHHHHHcCCCchHHHHHHHHHHHcCCCCCCccHHHHHHHhhhhccchhhhHHHHHHHHHhcCcchhHHHHHHHHHHhcCC
Q 045917           70 LIRAYAKTSCSIESIKLFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKE  149 (162)
Q Consensus        70 li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~t~~~li~~~~~~~~~~~a~~i~~~~~~~~~~~~~~~~~~ll~~y~~~g~  149 (162)
                      +|.+|++.|++++|.++|++|.+.|+.||..||+++|.+|++.|++++|.++++.|.+.|+.||..+|++||++|++.|+
T Consensus       111 lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~  190 (501)
T 4g26_A          111 GARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKN  190 (501)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHhhcccC
Q 045917          150 IDFAKALFDEMP  161 (162)
Q Consensus       150 ~~~a~~~~~~m~  161 (162)
                      +++|.++|++|+
T Consensus       191 ~d~A~~ll~~Mr  202 (501)
T 4g26_A          191 ADKVYKTLQRLR  202 (501)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            999999999996



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.79
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.79
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.75
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.66
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.51
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.51
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.03
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.03
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.97
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.9
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.9
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.88
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.69
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 97.67
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.59
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.57
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.53
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.4
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.36
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.27
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.24
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.19
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 97.16
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.92
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.8
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.68
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.5
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.43
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.34
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.34
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.23
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 95.87
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.75
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 95.54
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.47
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.09
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.62
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 93.54
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.38
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.09
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 91.63
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.69
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 90.62
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 89.88
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 88.35
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 87.08
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 82.6
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 81.94
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 81.33
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 81.01
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 80.46
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.79  E-value=7.4e-08  Score=67.22  Aligned_cols=146  Identities=10%  Similarity=0.004  Sum_probs=76.7

Q ss_pred             HHhhchhhhcchhHHHHHhcCCCchhHHHHHHHhhC-CCChHHHHHHhhhhC---C-ChhHHHHHHHHHHcCCCchHHHH
Q 045917           11 QLSKTAHHHHQLPALFLKTSLDHNTYIISRFILTSL-PISLHFTRSLFNNVM---P-PLFAYNTLIRAYAKTSCSIESIK   85 (162)
Q Consensus        11 ~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~-~~~~~~a~~~~~~m~---~-~~~~~~~li~~~~~~~~~~~a~~   85 (162)
                      ...|+.++|...+......+. .++..+..+-..+. .|++++|...|+...   | +..+|..+-..+...|+.++|..
T Consensus       214 ~~~~~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~  292 (388)
T d1w3ba_         214 KEARIFDRAVAAYLRALSLSP-NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAED  292 (388)
T ss_dssp             HTTTCTTHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHH
T ss_pred             hccccHHHHHHHHHHhHHHhh-hHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHH
Confidence            334455555555555444321 22333444444455 666666666665543   2 34455555556666666666666


Q ss_pred             HHHHHHHcCCCCCCccHHHHHHHhhhhccchhhhHHHHHHHHHhcCcchhHHHHHHHHHHhcCChhHHHHhhcc
Q 045917           86 LFDEMLKTGLRPDNLTYPFVVKASDQCLLIGVGGSVHSLIFKVGLHSDKYIGNTLLRMYAACKEIDFAKALFDE  159 (162)
Q Consensus        86 ~~~~m~~~~~~p~~~t~~~li~~~~~~~~~~~a~~i~~~~~~~~~~~~~~~~~~ll~~y~~~g~~~~a~~~~~~  159 (162)
                      .++..... .+.+...+..+...+.+.|++++|...++...+.. +-+..++..+-.+|.+.|++++|.+.|++
T Consensus       293 ~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~  364 (388)
T d1w3ba_         293 CYNTALRL-CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             HHHHHHHH-CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHH
T ss_pred             HHHhhhcc-CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            66554432 22334445555555666666666666665554421 12244555566666666666666666553



>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure