Citrus Sinensis ID: 045945


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MESIEMSTVRLPTSCLFQTAPTRMKFPLVKSPGSLVSRSVSKAFGLKSSSFKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESELN
cccccccccccccccccccccccccccEEEccEEEEcccEEEEEcccccHHHHHHHccccccccccccccccccEEEEEEEEEccccccccHHHHHccEEEEEEEEEccccEEEEccccccc
cccccccccccccHccHcHcccEEEEEEEccccEEEcccccEEEcccHHHHHHHHHcccccccccccccccccEEEEEEccEEccccccccHHHHHHcEEEccccEEcccEEEEcccHHHHH
mesiemstvrlptsclfqtaptrmkfplvkspgslvsrsVSKAFGLKSSSFKVSAMAVYklpyscragacstcaglmvsgsvdqsdgsflddnqmeKGYVLTCiaypksdcviythkeseln
mesiemstvrlptsclfqtaptrmkfplvkspgslVSRSVSKAfglksssfkVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESELN
MESIEMSTVRLPTSCLFQTAPTRMKFPLVKSPGSLVSRSVSKAFGLKSSSFKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESELN
************TSCLFQTAPTRMKFPLV*************AFGLKSSSFKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVD***GSFLDDNQMEKGYVLTCIAYPKSDCVIYT*******
*********************************SLVSRSVSKAFGLKSSSFKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKE****
*********RLPTSCLFQTAPTRMKFPLVKSPGSLVSRSVSKAFGLKSSSFKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESELN
*****************QTAPTRMKFPLVKSPGSLVSRSVSKAFGLKSSSFKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESIEMSTVRLPTSCLFQTAPTRMKFPLVKSPGSLVSRSVSKAFGLKSSSFKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESELN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
P27788152 Ferredoxin-3, chloroplast N/A no 0.950 0.763 0.516 3e-28
Q9ZQG8155 Ferredoxin-3, chloroplast yes no 0.950 0.748 0.461 1e-26
P1493798 Ferredoxin, root R-B2 OS= N/A no 0.639 0.795 0.637 1e-24
P0024899 Ferredoxin OS=Mastigoclad N/A no 0.508 0.626 0.790 1e-24
P94044155 Ferredoxin-6, chloroplast N/A no 0.581 0.458 0.647 6e-24
P0025399 Ferredoxin OS=Nostoc musc N/A no 0.516 0.636 0.761 9e-24
P0A3C799 Ferredoxin-1 OS=Nostoc sp yes no 0.516 0.636 0.761 9e-24
P0A3C899 Ferredoxin-1 OS=Anabaena N/A no 0.516 0.636 0.761 9e-24
P0024799 Ferredoxin OS=Chlorogloeo N/A no 0.508 0.626 0.774 2e-23
P8352297 Ferredoxin OS=Hordeum vul N/A no 0.508 0.639 0.758 3e-23
>sp|P27788|FER3_MAIZE Ferredoxin-3, chloroplastic OS=Zea mays GN=FDX3 PE=2 SV=1 Back     alignment and function desciption
 Score =  123 bits (308), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/151 (51%), Positives = 87/151 (57%), Gaps = 35/151 (23%)

Query: 6   MSTVRLPTSC--LFQTAPTRMKFPLVKSPGSLVSRS-VSKAFGLKSSS-FKVSAMAVYK- 60
           MST    TSC  L     T+     VKSP SL   S V+K   LK+S    VSAMAVYK 
Sbjct: 1   MSTSTFATSCTLLGNVRTTQASQTAVKSPSSLSFFSQVTKVPSLKTSKKLDVSAMAVYKV 60

Query: 61  ------------------------------LPYSCRAGACSTCAGLMVSGSVDQSDGSFL 90
                                         LPYSCRAGACSTCAG + SGSVDQSDGSFL
Sbjct: 61  KLVGPEGEEHEFDAPDDAYILDAAETAGVELPYSCRAGACSTCAGKIESGSVDQSDGSFL 120

Query: 91  DDNQMEKGYVLTCIAYPKSDCVIYTHKESEL 121
           DD Q E+GYVLTC++YPKSDCVI+THKE +L
Sbjct: 121 DDGQQEEGYVLTCVSYPKSDCVIHTHKEGDL 151




Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
Zea mays (taxid: 4577)
>sp|Q9ZQG8|FER3_ARATH Ferredoxin-3, chloroplastic OS=Arabidopsis thaliana GN=FD3 PE=1 SV=1 Back     alignment and function description
>sp|P14937|FER2_RAPSA Ferredoxin, root R-B2 OS=Raphanus sativus PE=1 SV=1 Back     alignment and function description
>sp|P00248|FER_MASLA Ferredoxin OS=Mastigocladus laminosus GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P94044|FER6_MAIZE Ferredoxin-6, chloroplastic OS=Zea mays GN=FDX6 PE=2 SV=1 Back     alignment and function description
>sp|P00253|FER_NOSMU Ferredoxin OS=Nostoc muscorum PE=1 SV=2 Back     alignment and function description
>sp|P0A3C7|FER1_NOSS1 Ferredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P0A3C8|FER1_ANASO Ferredoxin-1 OS=Anabaena sp. (strain PCC 7119) GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P00247|FER_CHLFR Ferredoxin OS=Chlorogloeopsis fritschii PE=1 SV=2 Back     alignment and function description
>sp|P83522|FER_HORVU Ferredoxin OS=Hordeum vulgare PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
224100605155 predicted protein [Populus trichocarpa] 0.950 0.748 0.603 4e-40
224113441155 predicted protein [Populus trichocarpa] 0.950 0.748 0.597 2e-38
296080982168 unnamed protein product [Vitis vinifera] 0.983 0.714 0.578 4e-38
351727909154 uncharacterized protein LOC100500583 [Gl 0.991 0.785 0.562 1e-37
388508992156 unknown [Medicago truncatula] 0.991 0.775 0.568 1e-37
351721286154 uncharacterized protein LOC100305886 [Gl 0.991 0.785 0.555 2e-37
388511551154 unknown [Medicago truncatula] 0.991 0.785 0.555 9e-37
359486978 351 PREDICTED: uncharacterized protein LOC10 0.959 0.333 0.583 9e-37
217071412156 unknown [Medicago truncatula] 0.991 0.775 0.562 1e-36
449446283149 PREDICTED: ferredoxin-3, chloroplastic-l 0.950 0.778 0.581 3e-36
>gi|224100605|ref|XP_002311943.1| predicted protein [Populus trichocarpa] gi|222851763|gb|EEE89310.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 108/154 (70%), Gaps = 38/154 (24%)

Query: 6   MSTVRLPTSCLFQTAPTR-MKFP-----LVKSPGSLVS-RSVSKAFGLKSSSFKVSAMAV 58
           MSTVRLPT+C+ ++AP R +  P     L+KSPG+L S R+VSKAFGLKSSSFKVSAMAV
Sbjct: 1   MSTVRLPTTCMIRSAPPRKVASPSKSCALIKSPGALGSVRNVSKAFGLKSSSFKVSAMAV 60

Query: 59  YK-------------------------------LPYSCRAGACSTCAGLMVSGSVDQSDG 87
           YK                               LPYSCRAGACSTCAG++VSGSVDQSDG
Sbjct: 61  YKAKLIAPDGCEHEFDAPGDTYILDSAENAGVELPYSCRAGACSTCAGMLVSGSVDQSDG 120

Query: 88  SFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESEL 121
           SFLD+ QMEKGYVLTC++YP SDCVI+THKE +L
Sbjct: 121 SFLDEKQMEKGYVLTCVSYPTSDCVIHTHKEEDL 154




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224113441|ref|XP_002316497.1| predicted protein [Populus trichocarpa] gi|118487568|gb|ABK95610.1| unknown [Populus trichocarpa] gi|222865537|gb|EEF02668.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296080982|emb|CBI18580.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351727909|ref|NP_001236409.1| uncharacterized protein LOC100500583 [Glycine max] gi|255630677|gb|ACU15698.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388508992|gb|AFK42562.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351721286|ref|NP_001238228.1| uncharacterized protein LOC100305886 [Glycine max] gi|255626885|gb|ACU13787.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388511551|gb|AFK43837.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|359486978|ref|XP_002267623.2| PREDICTED: uncharacterized protein LOC100266537 [Vitis vinifera] Back     alignment and taxonomy information
>gi|217071412|gb|ACJ84066.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446283|ref|XP_004140901.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 1 [Cucumis sativus] gi|449446285|ref|XP_004140902.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 2 [Cucumis sativus] gi|449494152|ref|XP_004159464.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 1 [Cucumis sativus] gi|449494156|ref|XP_004159465.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
TAIR|locus:2038593155 FD3 "ferredoxin 3" [Arabidopsi 0.5 0.393 0.819 7.6e-29
TAIR|locus:2197349148 FD1 "ferredoxin 1" [Arabidopsi 0.5 0.412 0.737 8.2e-26
TAIR|locus:2206061148 FED A [Arabidopsis thaliana (t 0.5 0.412 0.704 2.4e-24
UNIPROTKB|P0A3C899 petF "Ferredoxin-1" [Nostoc sp 0.516 0.636 0.761 7.8e-23
UNIPROTKB|P2732097 petF "Ferredoxin-1" [Synechocy 0.5 0.628 0.770 1.3e-22
UNIPROTKB|P8352297 P83522 "Ferredoxin" [Hordeum v 0.5 0.628 0.770 3.4e-22
UNIPROTKB|P09911149 PETF "Ferredoxin-1, chloroplas 0.5 0.409 0.737 1.9e-21
UNIPROTKB|P0A3C998 petF1 "Ferredoxin-1" [Thermosy 0.5 0.622 0.721 1.9e-21
UNIPROTKB|P8352597 P83525 "Ferredoxin" [Scopolia 0.516 0.649 0.682 2.4e-21
UNIPROTKB|P8358297 P83582 "Ferredoxin" [Solanum n 0.516 0.649 0.682 2.4e-21
TAIR|locus:2038593 FD3 "ferredoxin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 7.6e-29, Sum P(2) = 7.6e-29
 Identities = 50/61 (81%), Positives = 59/61 (96%)

Query:    61 LPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESE 120
             LPYSCRAGACSTCAG +VSG+VDQSDGSFL+D+ +EKGYVLTC+AYP+SDCVI+THKE+E
Sbjct:    94 LPYSCRAGACSTCAGQIVSGNVDQSDGSFLEDSHLEKGYVLTCVAYPQSDCVIHTHKETE 153

Query:   121 L 121
             L
Sbjct:   154 L 154


GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0022900 "electron transport chain" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0009536 "plastid" evidence=IDA
GO:0009688 "abscisic acid biosynthetic process" evidence=RCA
TAIR|locus:2197349 FD1 "ferredoxin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206061 FED A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0A3C8 petF "Ferredoxin-1" [Nostoc sp. PCC 7119 (taxid:1168)] Back     alignment and assigned GO terms
UNIPROTKB|P27320 petF "Ferredoxin-1" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|P83522 P83522 "Ferredoxin" [Hordeum vulgare (taxid:4513)] Back     alignment and assigned GO terms
UNIPROTKB|P09911 PETF "Ferredoxin-1, chloroplastic" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|P0A3C9 petF1 "Ferredoxin-1" [Thermosynechococcus elongatus BP-1 (taxid:197221)] Back     alignment and assigned GO terms
UNIPROTKB|P83525 P83525 "Ferredoxin" [Scopolia japonica (taxid:221162)] Back     alignment and assigned GO terms
UNIPROTKB|P83582 P83582 "Ferredoxin" [Solanum nigrum (taxid:4112)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A3D2FER1_SYNE7No assigned EC number0.72580.50810.6262yesno
P0A3D3FER1_SYNP6No assigned EC number0.72580.50810.6262yesno
P31965FER1_SYNP2No assigned EC number0.73840.53270.6701yesno
P0A3C9FER_THEEBNo assigned EC number0.52570.76220.9489yesno
P0A3C7FER1_NOSS1No assigned EC number0.76190.51630.6363yesno
P00254FER1_ANAVTNo assigned EC number0.74600.51630.6363yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
TIGR0200897 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] 7e-38
CHL0013499 CHL00134, petF, ferredoxin; Validated 3e-37
PTZ00038191 PTZ00038, PTZ00038, ferredoxin; Provisional 1e-32
PLN03136148 PLN03136, PLN03136, Ferredoxin; Provisional 6e-27
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 1e-20
PRK07609 339 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucosee 1e-18
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 3e-13
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 2e-12
TIGR02160352 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenas 3e-11
PRK10684332 PRK10684, PRK10684, HCP oxidoreductase, NADH-depen 3e-05
PRK05713 312 PRK05713, PRK05713, hypothetical protein; Provisio 8e-05
PRK11872 340 PRK11872, antC, anthranilate dioxygenase reductase 2e-04
>gnl|CDD|233684 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] Back     alignment and domain information
 Score =  122 bits (309), Expect = 7e-38
 Identities = 47/61 (77%), Positives = 52/61 (85%)

Query: 61  LPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESE 120
           LPYSCRAGACSTCAG +  G+VDQSD SFLDD+QME GYVLTC+AYP SDC I THKE +
Sbjct: 36  LPYSCRAGACSTCAGKVEEGTVDQSDQSFLDDDQMEAGYVLTCVAYPTSDCTIETHKEED 95

Query: 121 L 121
           L
Sbjct: 96  L 96


This model represents single domain 2Fe-2S (also called plant type) ferredoxins. In general, these occur as a single domain proteins or with a chloroplast transit peptide. Species tend to be photosynthetic, but several forms may occur in one species and individually may not be associated with photocynthesis. Halobacterial forms differ somewhat in architecture; they score between trusted and noise cutoffs. Sequences scoring below the noise cutoff tend to be ferredoxin-related domains of larger proteins. Length = 97

>gnl|CDD|177056 CHL00134, petF, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|240237 PTZ00038, PTZ00038, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|178681 PLN03136, PLN03136, Ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|181058 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|131215 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>gnl|CDD|236735 PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|235575 PRK05713, PRK05713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183350 PRK11872, antC, anthranilate dioxygenase reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.88
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.86
CHL0013499 petF ferredoxin; Validated 99.85
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.84
PLN03136148 Ferredoxin; Provisional 99.84
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.81
PTZ00038191 ferredoxin; Provisional 99.8
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.72
PRK05713 312 hypothetical protein; Provisional 99.68
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.67
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.62
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.58
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.57
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.51
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.49
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.47
PLN02593117 adrenodoxin-like ferredoxin protein 99.36
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.27
PTZ00490143 Ferredoxin superfamily; Provisional 99.22
COG3894 614 Uncharacterized metal-binding protein [General fun 99.07
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 98.39
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 98.36
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 98.33
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 98.32
TIGR02911261 sulfite_red_B sulfite reductase, subunit B. Member 98.18
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 98.09
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 98.04
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 98.02
PRK08166 847 NADH dehydrogenase subunit G; Validated 97.96
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 97.92
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 97.84
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 97.81
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 97.62
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 97.34
PRK12779944 putative bifunctional glutamate synthase subunit b 97.25
cd06189224 flavin_oxioreductase NAD(P)H dependent flavin oxid 97.22
PRK05464409 Na(+)-translocating NADH-quinone reductase subunit 97.21
cd06188283 NADH_quinone_reductase Na+-translocating NADH:quin 97.21
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 97.18
cd06198216 FNR_like_3 NAD(P) binding domain of ferredoxin red 97.18
cd06211238 phenol_2-monooxygenase_like Phenol 2-monooxygenase 97.16
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.15
cd06196218 FNR_like_1 Ferredoxin reductase-like proteins cata 97.12
COG1018266 Hmp Flavodoxin reductases (ferredoxin-NADPH reduct 97.11
TIGR01941405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 97.11
cd06217235 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr 97.09
PRK05802320 hypothetical protein; Provisional 97.09
PRK08051232 fre FMN reductase; Validated 97.08
cd06212232 monooxygenase_like The oxygenase reductase FAD/NAD 97.05
cd06194222 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding 97.05
cd00322223 FNR_like Ferredoxin reductase (FNR), an FAD and NA 97.01
cd06191231 FNR_iron_sulfur_binding Iron-sulfur binding Ferred 96.97
cd06215231 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr 96.97
cd06209228 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD 96.93
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 96.92
cd06195241 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c 96.89
PRK05713312 hypothetical protein; Provisional 96.89
cd06187224 O2ase_reductase_like The oxygenase reductase FAD/N 96.88
cd06210236 MMO_FAD_NAD_binding Methane monooxygenase (MMO) re 96.84
cd06184247 flavohem_like_fad_nad_binding FAD_NAD(P)H binding 96.81
PRK11872340 antC anthranilate dioxygenase reductase; Provision 96.77
PRK13289399 bifunctional nitric oxide dioxygenase/dihydropteri 96.74
cd06213227 oxygenase_e_transfer_subunit The oxygenase reducta 96.7
cd06185211 PDR_like Phthalate dioxygenase reductase (PDR) is 96.69
PRK07609339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 96.63
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 96.54
cd06214241 PA_degradation_oxidoreductase_like NAD(P) binding 96.52
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 96.44
cd06216243 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr 96.42
cd06190232 T4MO_e_transfer_like Toluene-4-monoxygenase electr 96.37
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 96.34
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 96.06
cd06183234 cyt_b5_reduct_like Cytochrome b5 reductase catalyz 96.01
PF00175109 NAD_binding_1: Oxidoreductase NAD-binding domain ; 95.73
cd06193235 siderophore_interacting Siderophore interacting pr 95.65
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 95.64
PTZ00319300 NADH-cytochrome B5 reductase; Provisional 95.61
PRK12814 652 putative NADPH-dependent glutamate synthase small 95.2
PTZ003061167 NADH-dependent fumarate reductase; Provisional 95.05
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 94.85
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 94.7
PRK09130 687 NADH dehydrogenase subunit G; Validated 94.55
cd06197220 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin 94.5
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 94.42
PLN03116307 ferredoxin--NADP+ reductase; Provisional 94.29
KOG3309159 consensus Ferredoxin [Energy production and conver 94.22
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 94.0
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 93.89
PRK07860 797 NADH dehydrogenase subunit G; Validated 93.84
PRK08493 819 NADH dehydrogenase subunit G; Validated 93.7
cd06201289 SiR_like2 Cytochrome p450- like alpha subunits of 93.69
PRK10926248 ferredoxin-NADP reductase; Provisional 93.63
PLN03115367 ferredoxin--NADP(+) reductase; Provisional 93.41
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 93.39
PRK09129 776 NADH dehydrogenase subunit G; Validated 93.13
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 93.1
COG4097438 Predicted ferric reductase [Inorganic ion transpor 92.94
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 92.89
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 92.81
cd06206384 bifunctional_CYPOR These bifunctional proteins fus 92.66
cd06208286 CYPOR_like_FNR These ferredoxin reductases are rel 92.48
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 92.2
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 91.84
PLN02252888 nitrate reductase [NADPH] 91.78
cd06200245 SiR_like1 Cytochrome p450- like alpha subunits of 91.71
cd06182267 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) 91.33
KOG0534286 consensus NADH-cytochrome b-5 reductase [Coenzyme 91.32
KOG3378385 consensus Globins and related hemoproteins [Energy 90.82
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 90.7
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 89.87
KOG3049 288 consensus Succinate dehydrogenase, Fe-S protein su 88.58
cd06207382 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) 87.91
cd06202406 Nitric_oxide_synthase The ferredoxin-reductase (FN 87.85
PTZ00274325 cytochrome b5 reductase; Provisional 87.62
PF08030156 NAD_binding_6: Ferric reductase NAD binding domain 87.57
COG0543252 UbiB 2-polyprenylphenol hydroxylase and related fl 87.23
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 87.15
cd06204416 CYPOR NADPH cytochrome p450 reductase (CYPOR) serv 84.27
COG2871410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 84.09
PRK06214530 sulfite reductase; Provisional 83.24
cd06199360 SiR Cytochrome p450- like alpha subunits of E. col 82.86
cd06203398 methionine_synthase_red Human methionine synthase 82.17
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
Probab=99.88  E-value=7e-23  Score=164.83  Aligned_cols=91  Identities=25%  Similarity=0.471  Sum_probs=81.6

Q ss_pred             CCeeEEcCChhhhh--HhHHHHcCCCCch-------------------------------------HHHHHHcCCCcCCC
Q 045945           24 MKFPLVKSPGSLVS--RSVSKAFGLKSSS-------------------------------------FKVSAMAVYKLPYS   64 (122)
Q Consensus        24 ~~~~YvCGP~~fm~--~~~~~~~~~~~~~-------------------------------------L~a~~~~Gi~i~~~   64 (122)
                      +.++|+|||.+||+  ++++++.|+++++                                     |++++++|+++||+
T Consensus       203 ~~~vyiCGP~~m~~~v~~~l~~~Gv~~~~i~~E~F~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~lL~~~~~~gi~~~~~  282 (332)
T PRK10684        203 SRTVMTCGPAPYMDWVEQEVKALGVTADRFFKEKFFTPVAEAATSGLTFTKLQPAREFYAPVGTTLLEALESNKVPVVAA  282 (332)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCCHHHeEeeccCCCCCCcCCCceEEEEecCCEEEEeCCCChHHHHHHHcCCCccCC
Confidence            57899999999999  7788887776432                                     77788999999999


Q ss_pred             CCCcccCCCeeeeeeccccCCCCCCCChhcccCCeEEeeceEECCCeEEE
Q 045945           65 CRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIY  114 (122)
Q Consensus        65 Cr~G~CGtCkv~vl~G~v~~~~~~~Ls~~e~~~g~~LaCqs~~~sdl~I~  114 (122)
                      ||.|.||+|++++++|++.+.....|+++++++|++|+||++|.+|++|+
T Consensus       283 C~~G~Cg~C~~~~~~G~v~~~~~~~l~~~~~~~g~~l~C~~~~~~d~~i~  332 (332)
T PRK10684        283 CRAGVCGCCKTKVVSGEYTVSSTMTLTPAEIAQGYVLACSCHPQGDLVLA  332 (332)
T ss_pred             CCCcCCCCCEEEEecCcccccccccCCHHHHhCCcEEEeeCEECCCeEEC
Confidence            99999999999999999998766789999999999999999999998873



>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>PRK08051 fre FMN reductase; Validated Back     alignment and domain information
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes Back     alignment and domain information
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PTZ00319 NADH-cytochrome B5 reductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PLN03116 ferredoxin--NADP+ reductase; Provisional Back     alignment and domain information
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>PRK10926 ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>PLN03115 ferredoxin--NADP(+) reductase; Provisional Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) Back     alignment and domain information
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>KOG0534 consensus NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain Back     alignment and domain information
>PTZ00274 cytochrome b5 reductase; Provisional Back     alignment and domain information
>PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins Back     alignment and domain information
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PRK06214 sulfite reductase; Provisional Back     alignment and domain information
>cd06199 SiR Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3p63_A96 Structure Of M. Laminosus Ferredoxin With A Shorter 7e-26
1rfk_A98 Crystal Structure Of 2fe2s Ferredoxin From Thermoph 1e-25
1fxa_A98 Crystallization And Structure Determination To 2.5- 7e-25
1j7c_A98 Structure Of The Anabaena Ferredoxin Mutant E95k Le 1e-24
1qog_A98 Ferredoxin Mutation S47a Length = 98 1e-24
2pvg_C96 Crystal Srtucture Of The Binary Complex Between Fer 2e-24
1qof_A98 Ferredoxin Mutation Q70k Length = 98 3e-24
1dox_A96 1h And 15n Sequential Assignment, Secondary Structu 3e-24
1j7b_A98 Structure Of The Anabaena Ferredoxin Mutant E94k Le 3e-24
1off_A97 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 L 4e-24
1qob_A98 Ferredoxin Mutation D62k Length = 98 6e-24
1j7a_A98 Structure Of The Anabaena Ferredoxin D68k Mutant Le 6e-24
1qoa_A98 Ferredoxin Mutation C49s Length = 98 6e-24
1frr_A95 Crystal Structure Of [2fe-2s] Ferredoxin I From Equ 7e-24
1roe_A97 Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elo 2e-23
4fxc_A98 Tertiary Structure Of [2fe-2s] Ferredoxin From Spir 2e-23
3b2g_A98 Leptolyngbya Boryana Ferredoxin Length = 98 2e-23
3ab5_A97 Crystal Structure Of The 2fe 2s Ferredoxin From Cya 3e-23
1wri_A93 Crystal Structure Of Ferredoxin Isoform Ii From E. 1e-22
1pfd_A96 The Solution Structure Of High Plant Parsley [2fe-2 2e-22
1gaq_B98 Crystal Structure Of The Complex Between Ferredoxin 1e-21
3av8_A97 Refined Structure Of Plant-Type [2fe-2s] Ferredoxin 1e-21
1awd_A94 Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fu 6e-21
1fxi_A96 Structure Of The [2fe-2s] Ferredoxin I From The Blu 7e-21
1iue_A98 Crystal Structure Analysis Of Ferredoxin From Plasm 1e-19
1a70_A97 Spinach Ferredoxin Length = 97 2e-19
1frd_A98 Molecular Structure Of The Oxidized, Recombinant, H 8e-12
1doi_A128 2fe-2s Ferredoxin From Haloarcula Marismortui Lengt 6e-08
1e10_A128 [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le 2e-07
1e0z_A128 [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le 2e-07
1krh_A 338 X-Ray Stucture Of Benzoate Dioxygenase Reductase Le 2e-06
>pdb|3P63|A Chain A, Structure Of M. Laminosus Ferredoxin With A Shorter L1,2 Loop Length = 96 Back     alignment and structure

Iteration: 1

Score = 112 bits (279), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 53/90 (58%), Positives = 67/90 (74%), Gaps = 2/90 (2%) Query: 34 SLVSRSVSKAFGLKSSSFKVSAM--AVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLD 91 +L++ + +K + + + A A LPYSCRAGACSTCAG ++SG+VDQSD SFLD Sbjct: 6 TLINPTGNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLD 65 Query: 92 DNQMEKGYVLTCIAYPKSDCVIYTHKESEL 121 D+Q+E GYVLTC+AYP SDCVI THKE EL Sbjct: 66 DDQIEAGYVLTCVAYPTSDCVIETHKEEEL 95
>pdb|1RFK|A Chain A, Crystal Structure Of 2fe2s Ferredoxin From Thermophilic Cyanobacterium Mastigocladus Laminosus Length = 98 Back     alignment and structure
>pdb|1FXA|A Chain A, Crystallization And Structure Determination To 2.5-Angstroms Resolution Of The Oxidized [2fe-2s] Ferredoxin Isolated From Anabaena 7120 Length = 98 Back     alignment and structure
>pdb|1J7C|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E95k Length = 98 Back     alignment and structure
>pdb|1QOG|A Chain A, Ferredoxin Mutation S47a Length = 98 Back     alignment and structure
>pdb|2PVG|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin And Ferredoxin:thioredoxin Reductase Length = 96 Back     alignment and structure
>pdb|1QOF|A Chain A, Ferredoxin Mutation Q70k Length = 98 Back     alignment and structure
>pdb|1DOX|A Chain A, 1h And 15n Sequential Assignment, Secondary Structure And Tertiary Fold Of [2fe-2s] Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 96 Back     alignment and structure
>pdb|1J7B|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E94k Length = 98 Back     alignment and structure
>pdb|1OFF|A Chain A, 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 97 Back     alignment and structure
>pdb|1QOB|A Chain A, Ferredoxin Mutation D62k Length = 98 Back     alignment and structure
>pdb|1J7A|A Chain A, Structure Of The Anabaena Ferredoxin D68k Mutant Length = 98 Back     alignment and structure
>pdb|1QOA|A Chain A, Ferredoxin Mutation C49s Length = 98 Back     alignment and structure
>pdb|1FRR|A Chain A, Crystal Structure Of [2fe-2s] Ferredoxin I From Equisetum Arvense At 1.8 Angstroms Resolution Length = 95 Back     alignment and structure
>pdb|1ROE|A Chain A, Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elongatus Length = 97 Back     alignment and structure
>pdb|4FXC|A Chain A, Tertiary Structure Of [2fe-2s] Ferredoxin From Spirulina Platensis Refined At 2.5 Angstroms Resolution: Structural Comparisons Of Plant-Type Ferredoxins And An Electrostatic Potential Analysis Length = 98 Back     alignment and structure
>pdb|3B2G|A Chain A, Leptolyngbya Boryana Ferredoxin Length = 98 Back     alignment and structure
>pdb|3AB5|A Chain A, Crystal Structure Of The 2fe 2s Ferredoxin From Cyanidioschyzon Merolae Length = 97 Back     alignment and structure
>pdb|1WRI|A Chain A, Crystal Structure Of Ferredoxin Isoform Ii From E. Arvense Length = 93 Back     alignment and structure
>pdb|1PFD|A Chain A, The Solution Structure Of High Plant Parsley [2fe-2s] Ferredoxin, Nmr, 18 Structures Length = 96 Back     alignment and structure
>pdb|1GAQ|B Chain B, Crystal Structure Of The Complex Between Ferredoxin And Ferredoxin-Nadp+ Reductase Length = 98 Back     alignment and structure
>pdb|3AV8|A Chain A, Refined Structure Of Plant-Type [2fe-2s] Ferredoxin I From Aphanothece Sacrum At 1.46 A Resolution Length = 97 Back     alignment and structure
>pdb|1AWD|A Chain A, Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fusca Length = 94 Back     alignment and structure
>pdb|1FXI|A Chain A, Structure Of The [2fe-2s] Ferredoxin I From The Blue-Green Alga Aphanothece Sacrum At 2.2 Angstroms Resolution Length = 96 Back     alignment and structure
>pdb|1IUE|A Chain A, Crystal Structure Analysis Of Ferredoxin From Plasmodium Falciparum Length = 98 Back     alignment and structure
>pdb|1A70|A Chain A, Spinach Ferredoxin Length = 97 Back     alignment and structure
>pdb|1FRD|A Chain A, Molecular Structure Of The Oxidized, Recombinant, Heterocyst (2fe-2s) Ferredoxin From Anabaena 7120 Determined To 1.7 Angstroms Resolution Length = 98 Back     alignment and structure
>pdb|1DOI|A Chain A, 2fe-2s Ferredoxin From Haloarcula Marismortui Length = 128 Back     alignment and structure
>pdb|1E10|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 Back     alignment and structure
>pdb|1E0Z|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 Back     alignment and structure
>pdb|1KRH|A Chain A, X-Ray Stucture Of Benzoate Dioxygenase Reductase Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 5e-37
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 6e-37
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 6e-37
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 1e-36
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 2e-36
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 2e-36
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 4e-36
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 2e-33
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 8e-29
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 2e-12
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 5e-12
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 2e-08
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Length = 94 Back     alignment and structure
 Score =  120 bits (302), Expect = 5e-37
 Identities = 44/61 (72%), Positives = 50/61 (81%)

Query: 61  LPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESE 120
           LPYSCRAGACS+CAG + SG VDQSD SFLDD QM KG+VLTC+AYP SD  I TH+E+ 
Sbjct: 33  LPYSCRAGACSSCAGKVESGEVDQSDQSFLDDAQMGKGFVLTCVAYPTSDVTILTHQEAA 92

Query: 121 L 121
           L
Sbjct: 93  L 93


>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Length = 97 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Length = 95 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Length = 98 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Length = 128 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Length = 98 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.87
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.83
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.83
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.83
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.82
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.82
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.82
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.81
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.75
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.74
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.71
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.7
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.68
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.68
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.67
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.67
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.67
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.66
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.65
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.64
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.64
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.6
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.57
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.38
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 97.95
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 97.71
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 97.41
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 97.4
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 97.25
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 97.15
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 97.02
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-bi 96.97
3lrx_A158 Putative hydrogenase; alpha-beta protein, structur 96.96
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 96.95
2gpj_A252 Siderophore-interacting protein; structural genomi 96.95
3lyu_A142 Putative hydrogenase; the C-terminal has AN alpha- 96.94
4eh1_A243 Flavohemoprotein; structural genomics, niaid, nati 96.92
1tvc_A250 Methane monooxygenase component C, methane monooxy 96.9
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 96.79
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antipa 96.74
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin 96.7
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 96.61
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 96.6
4g1v_A399 Flavohemoglobin; three domains: globin fold, antip 96.55
4fk8_A271 Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st 96.54
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, b 96.52
2bgi_A272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi 96.48
2qdx_A257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1. 96.38
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimila 96.32
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 96.22
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 96.05
3jqq_A316 Ferredoxin NADP reductase; FAD, oxidoreductase; HE 95.09
2bmw_A304 Ferredoxin--NADP reductase; oxidoreductase, flavop 95.08
2b5o_A402 FNR, ferredoxin--NADP reductase; complex with FAD, 94.97
1fnb_A314 Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( 94.75
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 94.52
3vo2_A310 Putative uncharacterized protein; rossmann fold, o 94.27
3lo8_A311 Ferredoxin--NADP reductase; electron transport, ox 93.87
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 93.84
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 93.68
1f20_A435 Nitric-oxide synthase; nitric-xoide synthase, redu 93.65
1tll_A688 Nitric-oxide synthase, brain; reductase module, FM 93.06
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 92.81
4dql_A393 Bifunctional P-450/NADPH-P450 reductase; rossmann 91.93
2rc5_A314 Ferredoxin-NADP reductase; FAD, oxidoreductase; HE 91.08
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 90.74
1ddg_A374 Sulfite reductase (NADPH) flavoprotein alpha- comp 88.22
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 88.0
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 87.0
2qtl_A539 MSR;, methionine synthase reductase; alpha-beta-al 85.66
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 84.65
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 84.07
2bpo_A682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 82.97
3qe2_A618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 80.43
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
Probab=99.87  E-value=1.6e-22  Score=159.94  Aligned_cols=92  Identities=25%  Similarity=0.504  Sum_probs=77.5

Q ss_pred             CCCCeeEEcCChhhhh--HhHHHH----------cCCC------------------------Cch--HHHHHHcCCCcCC
Q 045945           22 TRMKFPLVKSPGSLVS--RSVSKA----------FGLK------------------------SSS--FKVSAMAVYKLPY   63 (122)
Q Consensus        22 ~~~~~~YvCGP~~fm~--~~~~~~----------~~~~------------------------~~~--L~a~~~~Gi~i~~   63 (122)
                      +.+.++|+|||.+||+  ++++++          |+.+                        +++  |++++++|+++||
T Consensus       191 ~~~~~vyvCGP~~m~~~v~~~l~~~~~~~i~~E~F~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~ll~a~~~~g~~~~~  270 (321)
T 2pia_A          191 KPAQHVYCCGPQALMDTVRDMTGHWPSGTVHFESFGATNTNARENTPFTVRLSRSGTSFEIPANRSILEVLRDANVRVPS  270 (321)
T ss_dssp             CTTEEEEEESCHHHHHHHHHHTTTSCTTCEEEECCCCCCCCCSCCCCEEEEETTTCCEEEECTTSCHHHHHHHTTCCCCC
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHhCCHhhEEEEecCCCCCCCCCCccEEEEEeCCCeEEEECCCCcHHHHHHHcCCCCCC
Confidence            4578999999999999  555442          2211                        111  8889999999999


Q ss_pred             CCCCcccCCCeeeeeeccccCCCCCCCChhcccCCeEEeeceEECCC-eEEEe
Q 045945           64 SCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSD-CVIYT  115 (122)
Q Consensus        64 ~Cr~G~CGtCkv~vl~G~v~~~~~~~Ls~~e~~~g~~LaCqs~~~sd-l~I~l  115 (122)
                      +|+.|.||+|+++|++|++++.+ ..|+++|+ +|++|+||++|.+| ++|++
T Consensus       271 ~C~~G~Cg~C~~~v~~G~~~~~~-~~l~~~e~-~g~~L~C~~~~~~d~~~i~l  321 (321)
T 2pia_A          271 SCESGTCGSCKTALCSGEADHRD-MVLRDDEK-GTQIMVCVSRAKSAELVLDL  321 (321)
T ss_dssp             SCSSSSSCTTEEEEEESCEECCC-SSCCTTTT-TTEEETTTCEESSSEEEECC
T ss_pred             CCCCCCCCCCEEEEecCcccccc-CCCChHHH-CCeEEEeEeEECCCcEEEeC
Confidence            99999999999999999999887 68999998 99999999999998 88864



>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Back     alignment and structure
>3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} Back     alignment and structure
>3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* Back     alignment and structure
>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Back     alignment and structure
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Back     alignment and structure
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Back     alignment and structure
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Back     alignment and structure
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Back     alignment and structure
>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Back     alignment and structure
>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Back     alignment and structure
>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* Back     alignment and structure
>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Back     alignment and structure
>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1wria_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 2e-22
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 1e-20
d1iuea_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite 1e-20
d1czpa_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 2e-20
d1frra_95 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 4e-20
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 2e-19
d1awda_94 d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [ 2e-19
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 2e-19
d1frda_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 1e-17
d2piaa398 d.15.4.2 (A:224-321) Phthalate dioxygenase reducta 9e-15
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 5e-14
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 9e-07
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 93 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Equisetum arvense [TaxId: 3258]
 Score = 82.0 bits (202), Expect = 2e-22
 Identities = 46/67 (68%), Positives = 53/67 (79%)

Query: 55  AMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIY 114
                 LP SC+AGACSTC G +VSG+VDQS+GSFLDD Q+E+GYVLTCIA P+SD VI 
Sbjct: 27  GSEKADLPLSCQAGACSTCLGKIVSGTVDQSEGSFLDDEQIEQGYVLTCIAIPESDVVIE 86

Query: 115 THKESEL 121
           THKE EL
Sbjct: 87  THKEDEL 93


>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 98 Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Length = 94 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 98 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.9
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.89
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.89
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.89
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.89
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.87
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.87
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.86
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.82
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.82
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.76
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.62
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.53
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.5
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.41
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.35
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.28
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.1
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 98.71
d1cqxa3142 Flavohemoglobin, C-terminal domain {Alcaligenes eu 97.69
d1krha2133 Benzoate dioxygenase reductase {Acinetobacter sp. 97.63
d1qfja2135 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 97.62
d1tvca2141 Methane monooxygenase component C, MmoC {Methyloco 97.61
d1gvha3143 Flavohemoglobin, C-terminal domain {Escherichia co 97.49
d1umka2147 cytochrome b5 reductase {Human (Homo sapiens) [Tax 97.44
d2piaa2120 Phthalate dioxygenase reductase {Pseudomonas cepac 97.38
d2cnda2146 Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} 97.36
d1a8pa2158 Ferredoxin reductase (flavodoxin reductase) {Azoto 97.14
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 97.08
d2bmwa2162 Ferredoxin reductase (flavodoxin reductase) {Cyano 97.05
d1fnda2160 Ferredoxin reductase (flavodoxin reductase) {Spina 96.82
d1jb9a2154 Ferredoxin reductase (flavodoxin reductase) {Maize 96.43
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 96.21
d1fdra2148 Ferredoxin reductase (flavodoxin reductase) {Esche 96.03
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 95.99
d1f20a2165 Neuronal nitric-oxide synthase FAD/NADP+ domain {R 95.95
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 95.95
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 93.34
d1ddga2153 Sulfite reductase flavoprotein {Escherichia coli [ 93.09
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 93.09
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 92.13
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 91.22
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 91.11
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 90.27
d1ja1a3160 NADPH-cytochrome p450 reductase {Rat (Rattus norve 89.59
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 89.4
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 87.64
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Equisetum arvense [TaxId: 3258]
Probab=99.90  E-value=1.1e-24  Score=146.55  Aligned_cols=79  Identities=61%  Similarity=1.031  Sum_probs=74.2

Q ss_pred             HcCCCCch--HHHHHHcCCCcCCCCCCcccCCCeeeeeeccccCCCCCCCChhcccCCeEEeeceEECCCeEEEecCCCC
Q 045945           43 AFGLKSSS--FKVSAMAVYKLPYSCRAGACSTCAGLMVSGSVDQSDGSFLDDNQMEKGYVLTCIAYPKSDCVIYTHKESE  120 (122)
Q Consensus        43 ~~~~~~~~--L~a~~~~Gi~i~~~Cr~G~CGtCkv~vl~G~v~~~~~~~Ls~~e~~~g~~LaCqs~~~sdl~I~l~~~~~  120 (122)
                      ++.+++++  |++++++||++||+|+.|.||+|+++|++|++.+.+...|+++++++||+|+||++|.+|++|+++.+++
T Consensus        14 ~~~~~~g~slLda~~~~Gi~ip~~C~~G~CgtC~~~v~~G~v~~~~~~~l~~~e~~~g~~L~C~~~~~~d~~ie~~~e~~   93 (95)
T d1frra_          14 TLDVPEGTTILDAAEEAGYDLPFSCRAGACSSCLGKVVSGSVDESEGSFLDDGQMEEGFVLTCIAIPESDLVIETHKEEE   93 (95)
T ss_dssp             EEEECTTCCHHHHHHHTTCCCCCSSSSSSSSTTEEEEEESCEECTTCCSCCHHHHHTTEEETTTCEESSCEEEECCCTTT
T ss_pred             EEEECCCCcHHHHHHHcCCCEEeccCCcEeCCCEEEEecceEcccccccCCHHHHhcCcEEeeeCEECCCEEEEecCccc
Confidence            46677776  9999999999999999999999999999999999888899999999999999999999999999999988


Q ss_pred             C
Q 045945          121 L  121 (122)
Q Consensus       121 ~  121 (122)
                      |
T Consensus        94 ~   94 (95)
T d1frra_          94 L   94 (95)
T ss_dssp             T
T ss_pred             c
Confidence            6



>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Back     information, alignment and structure
>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure