Citrus Sinensis ID: 046110

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
PLFEFREDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL
cccHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccEEcccccccHHHHHHHHHHHHHHHHHHccHHHHHHccEEcccccccccccccHHHHcccccccccccccccccccccccccc
ccHHHHHcccHHHHHHHHHHHHHHHHHcccHHcHHHHHHEEEEEccHHHccccccccHHHHHHHHHHHHHHHHHHccHHHHHHccEEEEccccHHHHHHHHcccccccccccEEEcccccccHHHHHHcc
PLFEFREDVILLILVKWRGLIDLGSVVETLCgkisnwdnvvlayepvwvigtgkvavpaQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQgdvfscicl
PLFEFREDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEvaastriiyrdTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL
PLFEFREDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL
**FEFREDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKV*************RKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCIC*
PLFEFREDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL
PLFEFREDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL
PLFE*REDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PLFEFREDVILLILVKWRGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
P48493195 Triosephosphate isomerase N/A no 0.507 0.338 0.757 1e-22
P34937253 Triosephosphate isomerase N/A no 0.546 0.280 0.633 1e-20
P48491254 Triosephosphate isomerase yes no 0.5 0.255 0.676 2e-20
P48495254 Triosephosphate isomerase N/A no 0.5 0.255 0.692 4e-20
P21820253 Triosephosphate isomerase N/A no 0.461 0.237 0.716 5e-20
P46226253 Triosephosphate isomerase N/A no 0.546 0.280 0.633 6e-20
P12863253 Triosephosphate isomerase N/A no 0.461 0.237 0.733 2e-19
P48494253 Triosephosphate isomerase no no 0.507 0.260 0.651 2e-18
P17751299 Triosephosphate isomerase yes no 0.5 0.217 0.630 4e-18
Q9M4S8314 Triosephosphate isomerase N/A no 0.453 0.187 0.661 8e-18
>sp|P48493|TPIS_LACSA Triosephosphate isomerase, cytosolic (Fragment) OS=Lactuca sativa PE=2 SV=1 Back     alignment and function desciption
 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/66 (75%), Positives = 55/66 (83%)

Query: 33  KISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTV 92
           KIS+WDNVVLAYEPVW IGTGKVA PAQAQEVHA LRKW  DNV+AEV+ASTRIIY  +V
Sbjct: 95  KISSWDNVVLAYEPVWAIGTGKVASPAQAQEVHAGLRKWFCDNVSAEVSASTRIIYGGSV 154

Query: 93  INSTLQ 98
             S  +
Sbjct: 155 SGSNCK 160

Lactuca sativa (taxid: 4236)
EC: 5EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|P34937|TPIS_HORVU Triosephosphate isomerase, cytosolic OS=Hordeum vulgare PE=1 SV=3 Back     alignment and function description
>sp|P48491|TPIS_ARATH Triosephosphate isomerase, cytosolic OS=Arabidopsis thaliana GN=CTIMC PE=1 SV=2 Back     alignment and function description
>sp|P48495|TPIS_PETHY Triosephosphate isomerase, cytosolic OS=Petunia hybrida GN=TPIP1 PE=2 SV=1 Back     alignment and function description
>sp|P21820|TPIS_COPJA Triosephosphate isomerase, cytosolic OS=Coptis japonica PE=2 SV=1 Back     alignment and function description
>sp|P46226|TPIS_SECCE Triosephosphate isomerase, cytosolic OS=Secale cereale PE=2 SV=3 Back     alignment and function description
>sp|P12863|TPIS_MAIZE Triosephosphate isomerase, cytosolic OS=Zea mays PE=3 SV=3 Back     alignment and function description
>sp|P48494|TPIS_ORYSJ Triosephosphate isomerase, cytosolic OS=Oryza sativa subsp. japonica GN=TPI PE=1 SV=3 Back     alignment and function description
>sp|P17751|TPIS_MOUSE Triosephosphate isomerase OS=Mus musculus GN=Tpi1 PE=1 SV=4 Back     alignment and function description
>sp|Q9M4S8|TPIC_FRAAN Triosephosphate isomerase, chloroplastic OS=Fragaria ananassa GN=TPI PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
77540216 253 triosephosphate isomerase [Glycine max] 0.5 0.256 0.769 1e-21
351721638 253 triosephosphate isomerase [Glycine max] 0.5 0.256 0.769 2e-21
356558075 253 PREDICTED: triosephosphate isomerase, cy 0.5 0.256 0.769 2e-21
255645891 252 unknown [Glycine max] 0.5 0.257 0.769 2e-21
449453796 256 PREDICTED: triosephosphate isomerase, cy 0.461 0.234 0.816 4e-21
449526391 256 PREDICTED: triosephosphate isomerase, cy 0.461 0.234 0.816 4e-21
449453798 254 PREDICTED: triosephosphate isomerase, cy 0.461 0.236 0.816 4e-21
388511931 252 unknown [Lotus japonicus] 0.5 0.257 0.738 4e-21
30983936107 putative triose-phosphate isomerase, par 0.507 0.616 0.712 5e-21
57283985 254 triose-phosphate isomerase [Phaseolus vu 0.5 0.255 0.738 9e-21
>gi|77540216|gb|ABA86966.1| triosephosphate isomerase [Glycine max] gi|255645039|gb|ACU23019.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/65 (76%), Positives = 56/65 (86%)

Query: 28  ETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRII 87
           + +  KISNWDNVVLAYEPVW IGTGKVA PAQAQEVHA+LRKW+ DNV+AEVAAS RII
Sbjct: 149 KAIAAKISNWDNVVLAYEPVWAIGTGKVATPAQAQEVHADLRKWVHDNVSAEVAASVRII 208

Query: 88  YRDTV 92
           Y  +V
Sbjct: 209 YGGSV 213

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351721638|ref|NP_001237472.1| triosephosphate isomerase [Glycine max] gi|48773765|gb|AAT46998.1| triosephosphate isomerase [Glycine max] Back     alignment and taxonomy information
>gi|356558075|ref|XP_003547334.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Glycine max] Back     alignment and taxonomy information
>gi|255645891|gb|ACU23435.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449453796|ref|XP_004144642.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449526391|ref|XP_004170197.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449453798|ref|XP_004144643.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 2 [Cucumis sativus] gi|449526393|ref|XP_004170198.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388511931|gb|AFK44027.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|30983936|gb|AAP40643.1| putative triose-phosphate isomerase, partial [Gossypium barbadense] Back     alignment and taxonomy information
>gi|57283985|emb|CAI43251.1| triose-phosphate isomerase [Phaseolus vulgaris var. nanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
TAIR|locus:2099906254 TPI "triosephosphate isomerase 0.5 0.255 0.676 2.7e-20
MGI|MGI:98797299 Tpi1 "triosephosphate isomeras 0.530 0.230 0.594 9.5e-18
TAIR|locus:2047072315 TIM "triosephosphate isomerase 0.453 0.187 0.661 1.6e-17
UNIPROTKB|O77458247 Tpi "Triosephosphate isomerase 0.515 0.271 0.6 2e-17
UNIPROTKB|Q7JNS1247 Tpi "Triosephosphate isomerase 0.515 0.271 0.6 2e-17
UNIPROTKB|P54714249 TPI1 "Triosephosphate isomeras 0.530 0.277 0.579 2.5e-17
UNIPROTKB|P60174286 TPI1 "Triosephosphate isomeras 0.530 0.241 0.579 2.5e-17
FB|FBgn0086355247 Tpi "Triose phosphate isomeras 0.515 0.271 0.585 5.3e-17
UNIPROTKB|D0G7F6248 TPI1 "Triosephosphate isomeras 0.530 0.278 0.565 6.7e-17
UNIPROTKB|Q5E956249 TPI1 "Triosephosphate isomeras 0.530 0.277 0.565 8.6e-17
TAIR|locus:2099906 TPI "triosephosphate isomerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 2.7e-20, P = 2.7e-20
 Identities = 44/65 (67%), Positives = 54/65 (83%)

Query:    28 ETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRII 87
             + +  +++NW NVV+AYEPVW IGTGKVA PAQAQEVH ELRKWL  NV+A+VAA+TRII
Sbjct:   149 KAIADRVTNWSNVVIAYEPVWAIGTGKVASPAQAQEVHDELRKWLAKNVSADVAATTRII 208

Query:    88 YRDTV 92
             Y  +V
Sbjct:   209 YGGSV 213
GO:0003824 "catalytic activity" evidence=IEA
GO:0004807 "triose-phosphate isomerase activity" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005829 "cytosol" evidence=ISS;IDA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0006096 "glycolysis" evidence=IC;RCA
GO:0044262 "cellular carbohydrate metabolic process" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009507 "chloroplast" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0005507 "copper ion binding" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009060 "aerobic respiration" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
MGI|MGI:98797 Tpi1 "triosephosphate isomerase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2047072 TIM "triosephosphate isomerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O77458 Tpi "Triosephosphate isomerase" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|Q7JNS1 Tpi "Triosephosphate isomerase" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|P54714 TPI1 "Triosephosphate isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P60174 TPI1 "Triosephosphate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0086355 Tpi "Triose phosphate isomerase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|D0G7F6 TPI1 "Triosephosphate isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E956 TPI1 "Triosephosphate isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.1.1LOW CONFIDENCE prediction!
3rd Layer5.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024314001
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (254 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00035677001
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (401 aa)
•••• •• 0.998
GSVIVG00035675001
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (405 aa)
•••• •• 0.998
GSVIVG00035097001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (342 aa)
•• • •• 0.975
GSVIVG00020570001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (337 aa)
•• • •• 0.975
GAPDH
SubName- Full=Chromosome chr17 scaffold_246, whole genome shotgun sequence; (317 aa)
•• • •• 0.972
GSVIVG00002074001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (429 aa)
•• • •• 0.965
GSVIVG00014624001
RecName- Full=Glucose-6-phosphate isomerase; EC=5.3.1.9; (340 aa)
   • •• 0.961
GSVIVG00002909001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (453 aa)
•    •• 0.957
GSVIVG00038435001
SubName- Full=Chromosome chr16 scaffold_94, whole genome shotgun sequence; (620 aa)
•    •• 0.950
GSVIVG00026404001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (620 aa)
•    •• 0.949

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
PLN02561253 PLN02561, PLN02561, triosephosphate isomerase 2e-34
PTZ00333255 PTZ00333, PTZ00333, triosephosphate isomerase; Pro 2e-29
PLN02429315 PLN02429, PLN02429, triosephosphate isomerase 1e-23
cd00311242 cd00311, TIM, Triosephosphate isomerase (TIM) is a 5e-22
PRK00042250 PRK00042, tpiA, triosephosphate isomerase; Provisi 2e-19
pfam00121242 pfam00121, TIM, Triosephosphate isomerase 1e-18
PRK13962645 PRK13962, PRK13962, bifunctional phosphoglycerate 3e-17
COG0149251 COG0149, TpiA, Triosephosphate isomerase [Carbohyd 8e-16
PRK14566260 PRK14566, PRK14566, triosephosphate isomerase; Pro 8e-16
TIGR00419205 TIGR00419, tim, triosephosphate isomerase 1e-13
PRK14567253 PRK14567, PRK14567, triosephosphate isomerase; Pro 3e-07
PRK14905355 PRK14905, PRK14905, triosephosphate isomerase/PTS 0.003
>gnl|CDD|178175 PLN02561, PLN02561, triosephosphate isomerase Back     alignment and domain information 
 Score =  119 bits (299), Expect = 2e-34
 Identities = 46/60 (76%), Positives = 51/60 (85%)

Query: 33  KISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTV 92
           K+S+W NVVLAYEPVW IGTGKVA PAQAQEVH ELRKWL  NV+ EVAA+TRIIY  +V
Sbjct: 154 KVSDWANVVLAYEPVWAIGTGKVATPAQAQEVHDELRKWLHKNVSPEVAATTRIIYGGSV 213

Length = 253
>gnl|CDD|240365 PTZ00333, PTZ00333, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|166070 PLN02429, PLN02429, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|238190 cd00311, TIM, Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>gnl|CDD|234589 PRK00042, tpiA, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|215732 pfam00121, TIM, Triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|237572 PRK13962, PRK13962, bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223227 COG0149, TpiA, Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184749 PRK14566, PRK14566, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|129513 TIGR00419, tim, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|173031 PRK14567, PRK14567, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|184898 PRK14905, PRK14905, triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG1643247 consensus Triosephosphate isomerase [Carbohydrate 100.0
PRK14566260 triosephosphate isomerase; Provisional 100.0
PF00121244 TIM: Triosephosphate isomerase; InterPro: IPR00065 100.0
PRK14567253 triosephosphate isomerase; Provisional 100.0
PRK15492260 triosephosphate isomerase; Provisional 100.0
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 100.0
PRK00042250 tpiA triosephosphate isomerase; Provisional 100.0
PLN02429315 triosephosphate isomerase 100.0
PRK13962645 bifunctional phosphoglycerate kinase/triosephospha 100.0
PLN02561253 triosephosphate isomerase 100.0
PTZ00333255 triosephosphate isomerase; Provisional 100.0
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 100.0
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 100.0
PRK14565237 triosephosphate isomerase; Provisional 99.97
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 99.96
PRK04302223 triosephosphate isomerase; Provisional 99.53
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 95.59
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 93.58
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 92.64
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 92.55
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 88.91
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 88.16
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 88.07
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 87.94
PRK05581220 ribulose-phosphate 3-epimerase; Validated 86.71
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 85.74
TIGR03772479 anch_rpt_subst anchored repeat ABC transporter, su 83.51
PRK09545311 znuA high-affinity zinc transporter periplasmic co 83.36
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 83.23
PLN02591250 tryptophan synthase 82.46
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 81.83
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 80.6
>KOG1643 consensus Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.3e-39  Score=256.12  Aligned_cols=107  Identities=44%  Similarity=0.654  Sum_probs=102.3

Q ss_pred             hhHHHHHHHHHHHhccccCCCceEEEeeeeeecCCCCCCChHHHHHHHHHHHHHHHhccChhhcCcCcEEEcCCCCcccH
Q 046110           18 RGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTL   97 (130)
Q Consensus        18 ~~~~~l~~Ql~~~l~~i~~~~~vvIAYEPvWAIGtG~~as~~~i~~v~~~IR~~l~~~~~~~~a~~irILYGGSV~~~N~   97 (130)
                      ++.+++.+||+++.+.+.+|++++||||||||||||++|||+|+|++|..||+|+.++.+..++..+||+||||||..||
T Consensus       137 ~t~dVv~~Ql~aiad~v~~w~niviAYEPVWAIGTGk~atp~QaqEVh~~iR~wl~~~vs~~Va~~~RIiYGGSV~g~N~  216 (247)
T KOG1643|consen  137 KTLDVVFRQLKAIADKVKDWSNIVIAYEPVWAIGTGKTATPEQAQEVHAEIRKWLKSNVSDAVASSTRIIYGGSVNGGNC  216 (247)
T ss_pred             chHHHHHHHHHHHHHhcCCccceEEEeeceeeecCCCCCCHHHHHHHHHHHHHHHhhcchhhhhhceEEEeccccccccH
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcccCCCcceEEEeeeecccccccccccc
Q 046110           98 QLNIQYYYPNLFIELTLAFSIRYQGDVFSCIC  129 (130)
Q Consensus        98 ~~l~~~~~~dvdG~Lig~~s~~~~~~~F~~I~  129 (130)
                      ++|.+.  +|+||+||||+|+++   .|++|+
T Consensus       217 ~el~~~--~diDGFLVGGaSLKp---eF~~Ii  243 (247)
T KOG1643|consen  217 KELAKK--PDIDGFLVGGASLKP---EFVDII  243 (247)
T ss_pred             HHhccc--ccccceEEcCcccCh---HHHHhh
Confidence            999987  778999999999988   799987

>PRK14566 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>PLN02429 triosephosphate isomerase Back     alignment and domain information
>PRK13962 bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>PLN02561 triosephosphate isomerase Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>TIGR03772 anch_rpt_subst anchored repeat ABC transporter, substrate-binding protein Back     alignment and domain information
>PRK09545 znuA high-affinity zinc transporter periplasmic component; Reviewed Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
1wyi_A250 Human Triosephosphate Isomerase Of New Crystal Form 2e-18
2vom_A250 Structural Basis Of Human Triosephosphate Isomerase 2e-18
1hti_A248 Crystal Structure Of Recombinant Human Triosephosph 2e-18
1r2r_A248 Crystal Structure Of Rabbit Muscle Triosephosphate 2e-18
1sw3_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 9e-18
1tph_1247 1.8 Angstroms Crystal Structure Of Wild Type Chicke 3e-17
1tpu_A247 S96p Change Is A Second-Site Suppressor For H95n Sl 3e-17
1tpw_A247 Triosephosphate Isomerase Drinks Water To Keep Heal 3e-17
1tpv_A247 S96p Change Is A Second-Site Suppressor For H95n Sl 4e-17
1tpb_1247 Offset Of A Catalytic Lesion By A Bound Water Solub 8e-17
1spq_A247 Understanding Protein Lids: Structural Analysis Of 8e-17
1tpc_1247 Offset Of A Catalytic Lesion By A Bound Water Solub 9e-17
1tim_A247 Structure Of Triose Phosphate Isomerase From Chicke 2e-16
1m6j_A261 Crystal Structure Of Triosephosphate Isomerase From 2e-16
2i9e_A259 Structure Of Triosephosphate Isomerase Of Tenebrio 3e-16
1sw7_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 3e-16
1qds_A251 Superstable E65q Mutant Of Leishmania Mexicana Trio 3e-16
1amk_A251 Leishmania Mexicana Triose Phosphate Isomerase Leng 4e-16
3th6_A249 Crystal Structure Of Triosephosphate Isomerase From 6e-16
1sw0_A248 Triosephosphate Isomerase From Gallus Gallus, Loop 8e-16
1sq7_A247 Understanding Protein Lids: Structural Analysis Of 9e-16
1su5_A247 Understanding Protein Lids: Structural Analysis Of 9e-16
1ssd_A247 Understanding Protein Lids: Structural Analysis Of 2e-15
2y6z_A256 Crystallographic Structure Of Gm23 An Example Of Ca 3e-15
3q37_A251 Identification Of Amino Acids That Account For Long 4e-15
1ci1_A251 Crystal Structure Of Triosephosphate Isomerase From 4e-15
1tcd_A249 Trypanosoma Cruzi Triosephosphate Isomerase Length 4e-15
2oma_A250 Crystallographic Analysis Of A Chemically Modified 4e-15
2v5b_A244 The Monomerization Of Triosephosphate Isomerase Fro 5e-15
2y70_A245 Crystallographic Structure Of Gm23, Mutant G89d, An 5e-15
4tim_A250 Crystallographic And Molecular Modeling Studies On 1e-14
1tri_A243 The Crystal Structure Of An Engineered Monomeric Tr 2e-14
1ml1_A243 Protein Engineering With Monomeric Triosephosphate 2e-14
1mss_A243 Large Scale Structural Rearrangements Of The Front 2e-14
2wsr_A242 Monotim Mutant Rmm0-1, Monomeric Form Length = 242 2e-14
1tti_A243 Three New Crystal Structures Of Point Mutation Vari 2e-14
2wsq_A242 Monotim Mutant Rmm0-1, Dimeric Form. Length = 242 2e-14
2vei_A238 Structure-Based Enzyme Engineering Efforts With An 2e-14
2vek_A238 Structure-Based Enzyme Engineering Efforts With An 2e-14
1dkw_A238 Crystal Structure Of Triose-Phosphate Isomerase Wit 3e-14
3tim_A250 The Crystal Structure Of The "open" And The "closed 7e-14
2v0t_A250 The A178l Mutation In The C-Terminal Hinge Of The F 8e-14
1kv5_A250 Structure Of Trypanosoma Brucei Brucei Tim With The 9e-14
3pf3_A257 Crystal Structure Of A Mutant (C202a) Of Triosephos 1e-13
1mo0_A275 Structural Genomics Of Caenorhabditis Elegans: Trio 1e-13
2v2d_A242 The A178l Mutation In The C-Terminal Hinge Of The F 1e-13
2yc7_A257 Crystal Structure Of A Mutant (C202a) Of Triosephos 1e-13
3psw_A248 Structure Of E97q Mutant Of Tim From Plasmodium Fal 1e-13
1ydv_A248 Triosephosphate Isomerase (Tim) Length = 248 1e-13
3psv_A248 Structure Of E97d Mutant Of Tim From Plasmodium Fal 1e-13
2yc8_A255 Crystal Structure Of A Double Mutant (C202a And C22 1e-13
3pvf_A248 Structure Of C126s Mutant Of Plasmodium Falciparum 1e-13
2vfd_A248 Crystal Structure Of The F96s Mutant Of Plasmodium 1e-13
2j24_A250 The Functional Role Of The Conserved Active Site Pr 1e-13
3pwa_A248 Structure Of C126a Mutant Of Plasmodium Falciparum 1e-13
2vff_A248 Crystal Structure Of The F96h Mutant Of Plasmodium 1e-13
2vfh_A248 Crystal Structure Of The F96w Mutant Of Plasmodium 2e-13
2dp3_A257 Crystal Structure Of A Double Mutant (C202aA198V) O 2e-13
2yc6_A257 Crystal Structure Of A Triple Mutant (A198v, C202a 3e-13
1b9b_A255 Triosephosphate Isomerase Of Thermotoga Maritima Le 7e-13
1vga_A248 Structures Of Unligated And Inhibitor Complexes Of 8e-13
3krs_A271 Structure Of Triosephosphate Isomerase From Cryptos 2e-12
4ff7_A248 Structure Of C126s Mutant Of Saccharomyces Cerevisi 4e-12
3ypi_A247 Electrophilic Catalysis In Triosephosphase Isomeras 4e-12
1ypi_A247 Structure Of Yeast Triosephosphate Isomerase At 1.9 5e-12
1i45_A248 Yeast Triosephosphate Isomerase (Mutant) Length = 2 4e-10
1nf0_A247 Triosephosphate Isomerase In Complex With Dhap Leng 4e-10
3qst_A255 Crystal Structure Of Trichomonas Vaginalis Trioseph 8e-10
3qsr_A255 Crystal Structure Of Trichomonas Vaginalis Trioseph 9e-10
3ta6_A267 Structure Of Mycobacterium Tuberculosis Triosephosp 6e-09
3gvg_A283 Crystal Structure Of Triosephosphate Isomerase From 7e-09
4iot_A255 High-resolution Structure Of Triosephosphate Isomer 1e-08
1tre_A255 The Structure Of Triosephosphate Isomerase From Esc 1e-08
1yya_A250 Crystal Structure Of Tt0473, Putative Triosephospha 3e-08
1tmh_A254 Modular Mutagenesis Of A Tim-barrel Enzyme: The Cry 4e-08
3uwu_A261 Crystal Structure Of Staphylococcus Aureus Trioseph 3e-07
3m9y_A254 Crystal Structure Of Triosephosphate Isomerase From 3e-07
4g1k_A272 Crystal Structure Of Triosephosphate Isomerase From 5e-07
1aw1_A256 Triosephosphate Isomerase Of Vibrio Marinus Complex 3e-06
3kxq_A275 Crystal Structure Of Triosephosphate Isomerase From 3e-06
2btm_A252 Does The His12-Lys13 Pair Play A Role In The Adapta 2e-05
1btm_A252 Triosephosphate Isomerase (Tim) Complexed With 2- P 2e-05
>pdb|1WYI|A Chain A, Human Triosephosphate Isomerase Of New Crystal Form Length = 250 Back     alignment and structure 
Iteration: 1

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/65 (61%), Positives = 47/65 (72%)
Query: 34  ISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVI 93
           + +W  VVLAYEPVW IGTGK A P QAQEVH +LR WLK NV+  VA STRIIY  +V 
Sbjct: 156 VKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVT 215
Query: 94  NSTLQ 98
            +T +
Sbjct: 216 GATCK 220
>pdb|2VOM|A Chain A, Structural Basis Of Human Triosephosphate Isomerase Deficiency. Mutation E104d And Correlation To Solvent Perturbation. Length = 250 Back     alignment and structure
>pdb|1HTI|A Chain A, Crystal Structure Of Recombinant Human Triosephosphate Isomerase At 2.8 Angstroms Resolution. Triosephosphate Isomerase Related Human Genetic Disorders And Comparison With The Trypanosomal Enzyme Length = 248 Back     alignment and structure
>pdb|1R2R|A Chain A, Crystal Structure Of Rabbit Muscle Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|1SW3|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant T175v Length = 248 Back     alignment and structure
>pdb|1TPH|1 Chain 1, 1.8 Angstroms Crystal Structure Of Wild Type Chicken Triosephosphate Isomerase-Phosphoglycolohydroxamate Complex Length = 247 Back     alignment and structure
>pdb|1TPU|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPW|A Chain A, Triosephosphate Isomerase Drinks Water To Keep Healthy Length = 247 Back     alignment and structure
>pdb|1TPV|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPB|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>pdb|1SPQ|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPC|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>pdb|1TIM|A Chain A, Structure Of Triose Phosphate Isomerase From Chicken Muscle Length = 247 Back     alignment and structure
>pdb|1M6J|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Entamoeba Histolytica Length = 261 Back     alignment and structure
>pdb|2I9E|A Chain A, Structure Of Triosephosphate Isomerase Of Tenebrio Molitor Length = 259 Back     alignment and structure
>pdb|1SW7|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant K174n, T175s, A176s Length = 248 Back     alignment and structure
>pdb|1QDS|A Chain A, Superstable E65q Mutant Of Leishmania Mexicana Triosephosphate Isomerase (Tim) Length = 251 Back     alignment and structure
>pdb|1AMK|A Chain A, Leishmania Mexicana Triose Phosphate Isomerase Length = 251 Back     alignment and structure
>pdb|3TH6|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Rhipicephalus (Boophilus) Microplus. Length = 249 Back     alignment and structure
>pdb|1SW0|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Hinge Mutant K174l, T175w Length = 248 Back     alignment and structure
>pdb|1SQ7|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1SU5|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1SSD|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|2Y6Z|A Chain A, Crystallographic Structure Of Gm23 An Example Of Catalytic Migration From Tim To Thiamin Phosphate Synthase Length = 256 Back     alignment and structure
>pdb|3Q37|A Chain A, Identification Of Amino Acids That Account For Long-Range Interactions In Proteins Using Two Triosephosphate Isomerases From Pathogenic Trypanosomes. Length = 251 Back     alignment and structure
>pdb|1CI1|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Trypanosoma Cruzi In Hexane Length = 251 Back     alignment and structure
>pdb|1TCD|A Chain A, Trypanosoma Cruzi Triosephosphate Isomerase Length = 249 Back     alignment and structure
>pdb|2OMA|A Chain A, Crystallographic Analysis Of A Chemically Modified Triosephosphate Isomerase From Trypanosoma Cruzi With Dithiobenzylamine (dtba) Length = 250 Back     alignment and structure
>pdb|2V5B|A Chain A, The Monomerization Of Triosephosphate Isomerase From Trypanosoma Cruzi Length = 244 Back     alignment and structure
>pdb|2Y70|A Chain A, Crystallographic Structure Of Gm23, Mutant G89d, An Example Of Catalytic Migration From Tim To Thiamin Phosphate Synthase. Length = 245 Back     alignment and structure
>pdb|4TIM|A Chain A, Crystallographic And Molecular Modeling Studies On Trypanosomal Triosephosphate Isomerase: A Critical Assessment Of The Predicted And Observed Structures Of The Complex With 2-Phosphoglycerate Length = 250 Back     alignment and structure
>pdb|1TRI|A Chain A, The Crystal Structure Of An Engineered Monomeric Triosephosphate Isomerase, Monotim: The Correct Modelling Of An Eight-Residue Loop Length = 243 Back     alignment and structure
>pdb|1ML1|A Chain A, Protein Engineering With Monomeric Triosephosphate Isomerase: The Modelling And Structure Verification Of A Seven Residue Loop Length = 243 Back     alignment and structure
>pdb|1MSS|A Chain A, Large Scale Structural Rearrangements Of The Front Loops In Monomerised Triosephosphate Isomerase, As Deduced From The Comparison Of The Structural Properties Of Monotim And Its Point Mutation Variant Monoss Length = 243 Back     alignment and structure
>pdb|2WSR|A Chain A, Monotim Mutant Rmm0-1, Monomeric Form Length = 242 Back     alignment and structure
>pdb|1TTI|A Chain A, Three New Crystal Structures Of Point Mutation Variants Of Monotim: Conformational Flexibility Of Loop-1,Loop-4 And Loop-8 Length = 243 Back     alignment and structure
>pdb|2WSQ|A Chain A, Monotim Mutant Rmm0-1, Dimeric Form. Length = 242 Back     alignment and structure
>pdb|2VEI|A Chain A, Structure-Based Enzyme Engineering Efforts With An Inactive Monomeric Tim Variant: The Importance Of A Single Point Mutation For Generating An Active Site With Suitable Binding Properties Length = 238 Back     alignment and structure
>pdb|2VEK|A Chain A, Structure-Based Enzyme Engineering Efforts With An Inactive Monomeric Tim Variant: The Importance Of A Single Point Mutation For Generating An Active Site With Suitable Binding Properties Length = 238 Back     alignment and structure
>pdb|1DKW|A Chain A, Crystal Structure Of Triose-Phosphate Isomerase With Modified Substrate Binding Site Length = 238 Back     alignment and structure
>pdb|3TIM|A Chain A, The Crystal Structure Of The "open" And The "closed" Conformation Of The Flexible Loop Of Trypanosomal Triosephosphate Isomerase Length = 250 Back     alignment and structure
>pdb|2V0T|A Chain A, The A178l Mutation In The C-Terminal Hinge Of The Flexible Loop-6 Of Triosephosphate Isomerase (Tim) Induces A More Closed Conformation Of This Hinge Region In Dimeric And Monomeric Tim Length = 250 Back     alignment and structure
>pdb|1KV5|A Chain A, Structure Of Trypanosoma Brucei Brucei Tim With The Salt-Bridge- Forming Residue Arg191 Mutated To Ser Length = 250 Back     alignment and structure
>pdb|3PF3|A Chain A, Crystal Structure Of A Mutant (C202a) Of Triosephosphate Isomerase From Giardia Lamblia Derivatized With Mmts Length = 257 Back     alignment and structure
>pdb|1MO0|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase Length = 275 Back     alignment and structure
>pdb|2V2D|A Chain A, The A178l Mutation In The C-Terminal Hinge Of The Flexible Loop-6 Of Triosephosphate Isomerase (Tim) Induces A More Closed Conformation Of This Hinge Region In Dimeric And Monomeric Tim Length = 242 Back     alignment and structure
>pdb|2YC7|A Chain A, Crystal Structure Of A Mutant (C202a) Of Triosephosphate Isomerase From Giardia Lamblia Complexed With 2-Phosphoglycolic Acid Length = 257 Back     alignment and structure
>pdb|3PSW|A Chain A, Structure Of E97q Mutant Of Tim From Plasmodium Falciparum Length = 248 Back     alignment and structure
>pdb|1YDV|A Chain A, Triosephosphate Isomerase (Tim) Length = 248 Back     alignment and structure
>pdb|3PSV|A Chain A, Structure Of E97d Mutant Of Tim From Plasmodium Falciparum Length = 248 Back     alignment and structure
>pdb|2YC8|A Chain A, Crystal Structure Of A Double Mutant (C202a And C222n) Of Triosephosphate Isomerase From Giardia Lamblia. Length = 255 Back     alignment and structure
>pdb|3PVF|A Chain A, Structure Of C126s Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Complexed With Pga Length = 248 Back     alignment and structure
>pdb|2VFD|A Chain A, Crystal Structure Of The F96s Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|2J24|A Chain A, The Functional Role Of The Conserved Active Site Proline Of Triosephosphate Isomerase Length = 250 Back     alignment and structure
>pdb|3PWA|A Chain A, Structure Of C126a Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|2VFF|A Chain A, Crystal Structure Of The F96h Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|2VFH|A Chain A, Crystal Structure Of The F96w Mutant Of Plasmodium Falciparum Triosephosphate Isomerase Complexed With 3- Phosphoglycerate Length = 248 Back     alignment and structure
>pdb|2DP3|A Chain A, Crystal Structure Of A Double Mutant (C202aA198V) OF TRIOSEPHOSPHATE Isomerase From Giardia Lamblia Length = 257 Back     alignment and structure
>pdb|2YC6|A Chain A, Crystal Structure Of A Triple Mutant (A198v, C202a And C222n) Of Triosephosphate Isomerase From Giardia Lamblia Complexed With 2-Phosphoglycolic Acid Length = 257 Back     alignment and structure
>pdb|1B9B|A Chain A, Triosephosphate Isomerase Of Thermotoga Maritima Length = 255 Back     alignment and structure
>pdb|1VGA|A Chain A, Structures Of Unligated And Inhibitor Complexes Of W168f Mutant Of Triosephosphate Isomerase From Plasmodium Falciparum Length = 248 Back     alignment and structure
>pdb|3KRS|A Chain A, Structure Of Triosephosphate Isomerase From Cryptosporidium Parvum At 1.55a Resolution Length = 271 Back     alignment and structure
>pdb|4FF7|A Chain A, Structure Of C126s Mutant Of Saccharomyces Cerevisiae Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|3YPI|A Chain A, Electrophilic Catalysis In Triosephosphase Isomerase: The Role Of Histidine-95 Length = 247 Back     alignment and structure
>pdb|1YPI|A Chain A, Structure Of Yeast Triosephosphate Isomerase At 1.9- Angstroms Resolution Length = 247 Back     alignment and structure
>pdb|1I45|A Chain A, Yeast Triosephosphate Isomerase (Mutant) Length = 248 Back     alignment and structure
>pdb|1NF0|A Chain A, Triosephosphate Isomerase In Complex With Dhap Length = 247 Back     alignment and structure
>pdb|3QST|A Chain A, Crystal Structure Of Trichomonas Vaginalis Triosephosphate Isomerase Tvag_096350 Gene (Val-45 Variant) Length = 255 Back     alignment and structure
>pdb|3QSR|A Chain A, Crystal Structure Of Trichomonas Vaginalis Triosephosphate Isomerase Tvag_497370 Gene (Ile-45 Variant) Length = 255 Back     alignment and structure
>pdb|3TA6|A Chain A, Structure Of Mycobacterium Tuberculosis Triosephosphate Isomerase Length = 267 Back     alignment and structure
>pdb|3GVG|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Mycobacterium Tuberculosis Length = 283 Back     alignment and structure
>pdb|4IOT|A Chain A, High-resolution Structure Of Triosephosphate Isomerase From E. Coli Length = 255 Back     alignment and structure
>pdb|1TRE|A Chain A, The Structure Of Triosephosphate Isomerase From Escherichia Coli Determined At 2.6 Angstrom Resolution Length = 255 Back     alignment and structure
>pdb|1YYA|A Chain A, Crystal Structure Of Tt0473, Putative Triosephosphate Isomerase From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|1TMH|A Chain A, Modular Mutagenesis Of A Tim-barrel Enzyme: The Crystal Structure Of A Chimeric E. Coli Tim Having The Eighth (beta-alpha)-unit Replaced By The Equivalent Unit Of Chicken Tim Length = 254 Back     alignment and structure
>pdb|3UWU|A Chain A, Crystal Structure Of Staphylococcus Aureus Triosephosphate Isomerase Complexed With Glycerol-3-Phosphate Length = 261 Back     alignment and structure
>pdb|3M9Y|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Methicillin Resistant Staphylococcus Aureus At 1.9 Angstrom Resolution Length = 254 Back     alignment and structure
>pdb|4G1K|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Burkholderia Thailandensis Length = 272 Back     alignment and structure
>pdb|1AW1|A Chain A, Triosephosphate Isomerase Of Vibrio Marinus Complexed With 2-Phosphoglycolate Length = 256 Back     alignment and structure
>pdb|3KXQ|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Bartonella Henselae At 1.6a Resolution Length = 275 Back     alignment and structure
>pdb|2BTM|A Chain A, Does The His12-Lys13 Pair Play A Role In The Adaptation Of Thermophilic Tims To High Temperatures? Length = 252 Back     alignment and structure
>pdb|1BTM|A Chain A, Triosephosphate Isomerase (Tim) Complexed With 2- Phosphoglycolic Acid Length = 252 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 9e-32
3th6_A249 Triosephosphate isomerase; alpha/beta barrel, embr 1e-31
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 1e-31
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 2e-31
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 2e-31
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 2e-31
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 4e-31
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotct 8e-31
3qst_A255 Triosephosphate isomerase, putative; TIM barrel; 1 1e-30
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 1e-30
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 2e-30
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 3e-30
1b9b_A255 TIM, protein (triosephosphate isomerase); thermoph 8e-28
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 2e-26
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 4e-26
3ta6_A267 Triosephosphate isomerase; HET: FLC; 1.41A {Mycoba 6e-25
1yya_A250 Triosephosphate isomerase; riken structural genomi 7e-25
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 1e-24
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 2e-24
3kxq_A275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBR 1e-23
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 1e-23
3s6d_A310 Putative triosephosphate isomerase; seattle struct 2e-23
4g1k_A272 Triosephosphate isomerase; structural genomics, se 3e-22
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 3e-20
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 3e-18
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 2e-17
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 2e-17
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Length = 271 Back     alignment and structure
 Score =  112 bits (282), Expect = 9e-32
 Identities = 28/56 (50%), Positives = 41/56 (73%)

Query: 33  KISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIY 88
            +S+  N+V+AYEP+W IGTG VA P QAQE HA +R+++    N +V+++ RIIY
Sbjct: 176 DVSDLSNLVIAYEPIWAIGTGVVATPGQAQEAHAFIREYVTRMYNPQVSSNLRIIY 231
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Length = 249 Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Length = 259 Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Length = 275 Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Length = 248 Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Length = 248 Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Length = 257 Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Length = 244 Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Length = 255 Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Length = 251 Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Length = 250 Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Length = 261 Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Length = 255 Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Length = 255 Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} Length = 254 Back     alignment and structure
>3ta6_A Triosephosphate isomerase; HET: FLC; 1.41A {Mycobacterium tuberculosis} PDB: 3tao_A* 3gvg_A Length = 267 Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Length = 250 Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Length = 252 Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Length = 256 Back     alignment and structure
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} Length = 275 Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Length = 233 Back     alignment and structure
>3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} Length = 310 Back     alignment and structure
>4g1k_A Triosephosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel, TPIA; 2.35A {Burkholderia thailandensis} Length = 272 Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Length = 247 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Length = 219 Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Length = 225 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Length = 226 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3ta6_A267 Triosephosphate isomerase; HET: FLC; 1.41A {Mycoba 100.0
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotct 100.0
4g1k_A272 Triosephosphate isomerase; structural genomics, se 100.0
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 100.0
3kxq_A275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBR 100.0
1yya_A250 Triosephosphate isomerase; riken structural genomi 100.0
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 100.0
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 100.0
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 100.0
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 100.0
3th6_A249 Triosephosphate isomerase; alpha/beta barrel, embr 100.0
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 100.0
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 100.0
3qst_A255 Triosephosphate isomerase, putative; TIM barrel; 1 100.0
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 100.0
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 100.0
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 100.0
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 100.0
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 100.0
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 100.0
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 100.0
1b9b_A255 TIM, protein (triosephosphate isomerase); thermoph 100.0
3s6d_A310 Putative triosephosphate isomerase; seattle struct 100.0
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 100.0
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 99.85
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 99.85
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 99.51
3hh8_A294 Metal ABC transporter substrate-binding lipoprote; 89.07
3ujp_A307 Mn transporter subunit; manganese binding protein, 88.38
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 86.04
1xvl_A321 Mn transporter, MNTC protein; manganese, ABC-type 85.58
3mfq_A282 TROA, high-affinity zinc uptake system protein ZNU 85.05
1toa_A313 Tromp-1, protein (periplasmic binding protein TROA 83.15
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 82.79
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 82.35
1ujp_A271 Tryptophan synthase alpha chain; riken structural 82.19
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 82.06
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 81.75
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 80.59
>3ta6_A Triosephosphate isomerase; HET: FLC; 1.41A {Mycobacterium tuberculosis} SCOP: c.1.1.0 PDB: 3tao_A* 3gvg_A Back     alignment and structure
Probab=100.00  E-value=1.5e-41  Score=276.23  Aligned_cols=108  Identities=29%  Similarity=0.397  Sum_probs=101.9

Q ss_pred             hhHHHHHHHHHHHhcccc--CCCceEEEeeeeeecCCCCCCChHHHHHHHHHHHHHHHhccChhhcCcCcEEEcCCCCcc
Q 046110           18 RGLIDLGSVVETLCGKIS--NWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINS   95 (130)
Q Consensus        18 ~~~~~l~~Ql~~~l~~i~--~~~~vvIAYEPvWAIGtG~~as~~~i~~v~~~IR~~l~~~~~~~~a~~irILYGGSV~~~   95 (130)
                      ++.+++.+||+.+|++++  ++++++|||||+||||||++|||+++|++|++||++++++|+.++++++|||||||||++
T Consensus       143 ~t~~vv~~Ql~~~l~~l~~~~~~~vvIAYEPVWAIGTG~tAtpe~aqevh~~IR~~l~~~~~~~~a~~~rIlYGGSV~~~  222 (267)
T 3ta6_A          143 NHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAK  222 (267)
T ss_dssp             CHHHHHHHHHHHHTTTCCHHHHTTCEEEECCGGGSSSSCCCCHHHHHHHHHHHHHHHHHHSCHHHHTTSCEEECSCCCTT
T ss_pred             CHHHHHHHHHHHHHhcCCHHHhCCEEEEECChhhhcCCcCCCHHHHHHHHHHHHHHHHHhhChhhhccceEEEcCCcCHh
Confidence            467899999999999986  588999999999999999999999999999999999999999889999999999999999


Q ss_pred             cHHHHHcccCCCcceEEEeeeecccccccccccc
Q 046110           96 TLQLNIQYYYPNLFIELTLAFSIRYQGDVFSCIC  129 (130)
Q Consensus        96 N~~~l~~~~~~dvdG~Lig~~s~~~~~~~F~~I~  129 (130)
                      |+++|+++  +|+||+|||+||+  ++++|.+||
T Consensus       223 N~~el~~~--~diDG~LVGgASL--~~~~F~~Ii  252 (267)
T 3ta6_A          223 NVGDIVAQ--DDVDGGLVGGASL--DGEHFATLA  252 (267)
T ss_dssp             THHHHHTS--TTCCEEEECGGGG--SHHHHHHHH
T ss_pred             HHHHHhcC--CCCCEEEechHhc--CHHHHHHHH
Confidence            99999987  7889999998886  789999997
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>4g1k_A Triosephosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel, TPIA; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* Back     alignment and structure
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Back     alignment and structure
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Back     alignment and structure
>3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ujp_A Mn transporter subunit; manganese binding protein, metal binding protein; 2.70A {Synechocystis SP} PDB: 1xvl_A 3v63_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1xvl_A Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} SCOP: c.92.2.2 Back     alignment and structure
>3mfq_A TROA, high-affinity zinc uptake system protein ZNUA; metal binding protein; 2.60A {Streptococcus suis} SCOP: c.92.2.0 Back     alignment and structure
>1toa_A Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC trans binding protein; 1.80A {Treponema pallidum} SCOP: c.92.2.2 PDB: 1k0f_A Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1neya_247 c.1.1.1 (A:) Triosephosphate isomerase {Baker's ye 7e-07
d1o5xa_246 c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium 1e-06
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Triosephosphate isomerase (TIM)
family: Triosephosphate isomerase (TIM)
domain: Triosephosphate isomerase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 44.1 bits (103), Expect = 7e-07
 Identities = 26/56 (46%), Positives = 39/56 (69%)

Query: 33  KISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIY 88
           ++ ++ NVV+AYEPVW IGTG  A P  AQ++HA +RK+L   +  + A+  RI+Y
Sbjct: 152 EVKDFTNVVVAYEPVWAIGTGLAATPEDAQDIHASIRKFLASKLGDKAASELRILY 207
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1r2ra_246 Triosephosphate isomerase {Rabbit (Oryctolagus cun 100.0
d1neya_247 Triosephosphate isomerase {Baker's yeast (Saccharo 100.0
d1m6ja_260 Triosephosphate isomerase {Entamoeba histolytica [ 100.0
d1n55a_249 Triosephosphate isomerase {Leishmania mexicana [Ta 100.0
d1b9ba_252 Triosephosphate isomerase {Thermotoga maritima [Ta 100.0
d2btma_251 Triosephosphate isomerase {Bacillus stearothermoph 100.0
d1kv5a_249 Triosephosphate isomerase {Trypanosoma brucei [Tax 100.0
d1o5xa_246 Triosephosphate isomerase {Plasmodium falciparum [ 100.0
d1mo0a_257 Triosephosphate isomerase {Nematode (Caenorhabditi 100.0
d1trea_255 Triosephosphate isomerase {Escherichia coli [TaxId 100.0
d1aw1a_255 Triosephosphate isomerase {Vibrio marinus [TaxId: 100.0
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 99.86
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 99.8
d1toaa_277 Periplasmic zinc binding protein TroA {Treponema p 84.02
d1xvla1279 Mn transporter MntC {Synechocystis sp. pcc 6803 [T 81.08
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 80.91
>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Triosephosphate isomerase (TIM)
family: Triosephosphate isomerase (TIM)
domain: Triosephosphate isomerase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

Probab=100.00  E-value=8.3e-41  Score=266.68  Aligned_cols=108  Identities=42%  Similarity=0.584  Sum_probs=101.0

Q ss_pred             hhHHHHHHHHHHHhccccCCCceEEEeeeeeecCCCCCCChHHHHHHHHHHHHHHHhccChhhcCcCcEEEcCCCCcccH
Q 046110           18 RGLIDLGSVVETLCGKISNWDNVVLAYEPVWVIGTGKVAVPAQAQEVHAELRKWLKDNVNAEVAASTRIIYRDTVINSTL   97 (130)
Q Consensus        18 ~~~~~l~~Ql~~~l~~i~~~~~vvIAYEPvWAIGtG~~as~~~i~~v~~~IR~~l~~~~~~~~a~~irILYGGSV~~~N~   97 (130)
                      .+++++.+||+.+++.++..++++|||||+||||||++|+|++++++|.+||+++.+.|+...++++|||||||||++|+
T Consensus       136 ~t~~~l~~Ql~~~l~~~~~~~~iiiAYEPvWAIGTG~~a~~~~i~~~~~~Ir~~l~~~~~~~~~~~i~ilYGGSV~~~N~  215 (246)
T d1r2ra_         136 ITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATC  215 (246)
T ss_dssp             CHHHHHHHHHHHHHHTCSCGGGEEEEECCGGGSSSSCCCCHHHHHHHHHHHHHHHHHHTCHHHHHHCCEEECSCCCTTTH
T ss_pred             chhhhHHHHHHHHhhcccccceEEEecCceeeccCCCCccchhhhhhHHHHHHHHHHhhhHhhcCcccEEecCCCCHHHH
Confidence            46889999999999988778899999999999999999999999999999999999999988899999999999999999


Q ss_pred             HHHHcccCCCcceEEEeeeeccccccccccccC
Q 046110           98 QLNIQYYYPNLFIELTLAFSIRYQGDVFSCICL  130 (130)
Q Consensus        98 ~~l~~~~~~dvdG~Lig~~s~~~~~~~F~~I~~  130 (130)
                      ++|+++  +|+||+|||+||+  |+| |.+||.
T Consensus       216 ~~i~~~--~~vDG~LVGgASL--~~e-F~~Ii~  243 (246)
T d1r2ra_         216 KELASQ--PDVDGFLVGGASL--KPE-FVDIIN  243 (246)
T ss_dssp             HHHHTS--TTCCEEEESGGGG--STH-HHHHHT
T ss_pred             HHHhcC--CCCCeEEeehhhC--CHH-HHHHHH
Confidence            999988  7789999988886  777 999983
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histolytica [TaxId: 5759]} Back     information, alignment and structure
>d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1toaa_ c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d1xvla1 c.92.2.2 (A:49-327) Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure