Citrus Sinensis ID: 046172

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD
cccccccccccEEEEEEEccccccHHHHHHHHHHccccccccHHHHHccccEEEEccEEEEcHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccEEEEEEEcccccEEEccHHHHHccccccEEEEEccccccccEEEccccccccccccEEEEEccccccccccccccccEEEEEccccccccccc
ccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHccEEEEccccEEHHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHccccccEEEEEEEEcccccEEEccHHHHHHcHccEEEEEEccccccccEEEccccccccccHcEEEEccccccccccccccHHHHEEEcccccHHHHHcc
SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNAcgfdaqigisDLVNKSLIVIHNNQITMHDLLQEMGREvvkqesvnnpgersrlwHYEDIIEVLtfntgtekiegICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSisegkskcmvsncqgpilakvryfhwdgypltslpsniypdklvfleipdsnieqlwd
sfddlddeekNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQEsvnnpgersrlwhYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEipdsnieqlwd
SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD
**********NIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREV************SRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPD********
SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD
SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD
*FDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.969 0.101 0.448 5e-40
Q9FH83 1288 Probable WRKY transcripti no no 0.974 0.149 0.358 1e-29
Q9FL92 1372 Probable WRKY transcripti no no 0.984 0.142 0.356 8e-29
O82500 1095 Putative disease resistan no no 0.994 0.179 0.349 5e-27
Q40392 1144 TMV resistance protein N N/A no 0.939 0.162 0.333 1e-24
O23530 1301 Protein SUPPRESSOR OF npr no no 0.929 0.141 0.318 5e-19
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.964 0.118 0.308 5e-18
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  164 bits (414), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 116/194 (59%), Gaps = 2/194 (1%)

Query: 5    LDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVI-HNNQITMHD 63
            LDD E+ IFLDI CFF R DKD +   L+ CGF A +G   LV+KSL+ I  +N + M  
Sbjct: 1051 LDDNERGIFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLS 1110

Query: 64   LLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNL 123
             +Q  GRE+V+QES + PG+RSRLW+ + I  V   +TGT  IEGI  DM  +K    N 
Sbjct: 1111 FIQATGREIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLK-FDANP 1169

Query: 124  DTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYPDKL 183
            + F KM  LR LK Y S +E K           + +K+R  HW+ YPL+SLP +  P+ L
Sbjct: 1170 NVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENL 1229

Query: 184  VFLEIPDSNIEQLW 197
            V L +P S  ++LW
Sbjct: 1230 VELNLPSSCAKKLW 1243
Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
359486071 1261 PREDICTED: TMV resistance protein N-like 1.0 0.157 0.471 3e-51
359486073 1296 PREDICTED: TMV resistance protein N-like 1.0 0.152 0.467 5e-51
359486075 1291 PREDICTED: TMV resistance protein N-like 1.0 0.153 0.467 7e-51
224145028 709 nbs-lrr resistance protein [Populus tric 0.994 0.277 0.502 1e-50
105922468 581 NBS type disease resistance protein [Pop 0.994 0.339 0.502 2e-50
255561520 465 conserved hypothetical protein [Ricinus 0.994 0.423 0.510 6e-50
255564976 944 TMV resistance protein N, putative [Rici 1.0 0.209 0.5 2e-49
147770134 1414 hypothetical protein VITISV_040107 [Viti 1.0 0.140 0.457 3e-49
255537139 1137 leucine-rich repeat-containing protein, 0.989 0.172 0.502 4e-49
357515077 1266 NBS-LRR resistance-like protein 4G [Medi 0.984 0.154 0.492 5e-49
>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 149/214 (69%), Gaps = 16/214 (7%)

Query: 1   SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQIT 60
           SFD LDD +K+IFLDI CFFK +DKD++IK L +C F  +I I +L++KSL+ I  N++ 
Sbjct: 429 SFDGLDDNQKDIFLDIACFFKGQDKDYVIKLLKSCDFFPEIEIRNLIDKSLVTISYNKLC 488

Query: 61  MHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIG 120
           MHDL+QEMG E+V+QES+ +PG+RSRLW  +D+I++LT NTGTE +EG+  ++S +K++ 
Sbjct: 489 MHDLIQEMGWEIVRQESIKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELH 548

Query: 121 LNLDTFTKMHKLRFLKFYNSISEGKS---------KCMVSNCQGPILA-------KVRYF 164
            +++ FTKM+KLR L+FY++   G S         K   + C+  +          +R  
Sbjct: 549 FSVNVFTKMNKLRVLRFYDAQIWGSSWIGRHNDRYKSPYTECKFHLSGDFKFLSNHLRSL 608

Query: 165 HWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD 198
           HWDGYPL SLPSN +P+KL+ L++  S +EQLW+
Sbjct: 609 HWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWE 642

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145028|ref|XP_002325500.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862375|gb|EEE99881.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|105922468|gb|ABF81418.1| NBS type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561520|ref|XP_002521770.1| conserved hypothetical protein [Ricinus communis] gi|223538983|gb|EEF40580.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357515077|ref|XP_003627827.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] gi|355521849|gb|AET02303.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 1.0 0.153 0.424 1.5e-41
TAIR|locus:2122955 1309 AT4G19500 [Arabidopsis thalian 0.989 0.149 0.449 5.6e-39
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.959 0.100 0.464 5.1e-37
TAIR|locus:2146243 900 AT5G18360 [Arabidopsis thalian 0.989 0.217 0.393 9.6e-34
TAIR|locus:2162439 1008 AT5G22690 [Arabidopsis thalian 0.989 0.194 0.37 4.6e-31
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.712 0.116 0.427 4.4e-30
TAIR|locus:2155322 1170 LAZ5 "LAZARUS 5" [Arabidopsis 0.989 0.167 0.368 1.1e-29
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.994 0.165 0.371 3.1e-29
TAIR|locus:2151506 1127 RPS6 "RESISTANT TO P. SYRINGAE 0.994 0.174 0.373 6e-29
TAIR|locus:2115870 1234 AT4G08450 [Arabidopsis thalian 1.0 0.160 0.379 2.4e-28
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 453 (164.5 bits), Expect = 1.5e-41, P = 1.5e-41
 Identities = 84/198 (42%), Positives = 134/198 (67%)

Query:     1 SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQIT 60
             S+D LD++EK IFL I CF+  +  D++ K L+ CG+ A+IGI+ L  KSLIV  N  + 
Sbjct:   422 SYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLIVESNGCVK 481

Query:    61 MHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIG 120
             +HDLL++MGRE+V+Q++VNNP +R  LW  EDI  +L+ N+GT+ +EGI  ++S++ ++ 
Sbjct:   482 IHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVF 541

Query:   121 LNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYP 180
              +   F  +  L+ L FY+   +G+++  + N    +  K+RY  WDGYPL ++PS  +P
Sbjct:   542 ASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFP 601

Query:   181 DKLVFLEIPDSNIEQLWD 198
             + LV L + +SN+E+LWD
Sbjct:   602 EFLVELCMSNSNLEKLWD 619
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2122955 AT4G19500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-42
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  150 bits (379), Expect = 6e-42
 Identities = 79/201 (39%), Positives = 118/201 (58%), Gaps = 4/201 (1%)

Query: 1   SFDDLDD-EEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQI 59
           S+D L++ ++K IF  I C F  E  + I   L     D  IG+ +LV+KSLI +  + +
Sbjct: 429 SYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIV 488

Query: 60  TMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQI 119
            MH LLQEMG+E+V+ +S N PGER  L   +DI +VL  NTGT+K+ GI  D+ ++ ++
Sbjct: 489 EMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDEL 547

Query: 120 GLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQG--PILAKVRYFHWDGYPLTSLPSN 177
            ++ + F  M  L FLKFY    + K +      +G   +  K+R   WD YPL  +PSN
Sbjct: 548 HIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSN 607

Query: 178 IYPDKLVFLEIPDSNIEQLWD 198
             P+ LV L++  S +E+LWD
Sbjct: 608 FRPENLVKLQMQGSKLEKLWD 628

syringae 6; Provisional. Length = 1153

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.94
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 97.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.93
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.56
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.54
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.3
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.18
PLN03150 623 hypothetical protein; Provisional 97.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.01
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.0
KOG0617 264 consensus Ras suppressor protein (contains leucine 96.63
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.62
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.58
KOG0617264 consensus Ras suppressor protein (contains leucine 96.52
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.52
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 94.99
PLN03150623 hypothetical protein; Provisional 94.72
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 94.46
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 94.27
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.2
KOG0472565 consensus Leucine-rich repeat protein [Function un 93.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 92.97
PRK15386 426 type III secretion protein GogB; Provisional 92.67
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 92.63
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 92.28
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 92.27
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 92.24
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 92.06
KOG4237 498 consensus Extracellular matrix protein slit, conta 92.05
KOG4237 498 consensus Extracellular matrix protein slit, conta 91.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 91.62
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 91.11
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 90.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 89.61
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 89.33
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 89.06
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 88.88
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 87.79
smart0037026 LRR Leucine-rich repeats, outliers. 87.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.29
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 86.77
KOG2982 418 consensus Uncharacterized conserved protein [Funct 85.99
PRK15386 426 type III secretion protein GogB; Provisional 85.21
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 85.19
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 84.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 82.16
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.63
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 80.28
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=1.3e-40  Score=321.31  Aligned_cols=197  Identities=40%  Similarity=0.707  Sum_probs=183.2

Q ss_pred             CCccCcc-cccceeceeecCCCCCCHHHHHHHHHHcCCcceechhhcccCCcceeecCeEEecHHHHHHHHHHhhhcccC
Q 046172            1 SFDDLDD-EEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVN   79 (198)
Q Consensus         1 SYd~L~~-~~K~~FL~iAcf~~~~~~~~v~~~l~~~g~~~~~~i~~L~~~sLi~~~~~~i~MHdli~dmg~~i~~~es~~   79 (198)
                      |||+|++ ++|.||++|||||+|.+.+.|..++.++|+.+..|++.|++||||+++.++++||||+|+||++|+++++ .
T Consensus       429 SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~  507 (1153)
T PLN03210        429 SYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-N  507 (1153)
T ss_pred             hhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-C
Confidence            8999986 6999999999999999999999999999999999999999999999998899999999999999999998 6


Q ss_pred             CCCCceecccccceeeeecccccccceEEEEeeCCcccccccChhhhcCCccccEEEEecccccCCCccccccCCCCc--
Q 046172           80 NPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPI--  157 (198)
Q Consensus        80 ~~~k~~rl~~~~d~~~~l~~~~~~~~v~~i~l~~~~~~~~~~~~~~f~~m~~Lr~L~l~~~~~~~~~~~~~~lp~~l~--  157 (198)
                      +||+|+|+|+++|+++++++++|+.+|++|++|.++..++.++..+|.+|++|++|++++...........++|+++.  
T Consensus       508 ~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~l  587 (1153)
T PLN03210        508 EPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYL  587 (1153)
T ss_pred             CCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhc
Confidence            899999999999999999999999999999999998888899999999999999999987543222334578999998  


Q ss_pred             cCCcceEEeCCCCCCCCCCCCCCCCceEEEcCCCCcccCCC
Q 046172          158 LAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD  198 (198)
Q Consensus       158 l~~Lr~L~~~~~~l~~LP~~~~l~~L~~L~L~~S~i~~LW~  198 (198)
                      +++||+|+|++||++++|+.|.+++|++|+|++|++++||+
T Consensus       588 p~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~  628 (1153)
T PLN03210        588 PPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWD  628 (1153)
T ss_pred             CcccEEEEecCCCCCCCCCcCCccCCcEEECcCcccccccc
Confidence            78899999999999999999999999999999999999995

syringae 6; Provisional
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 53.3 bits (127), Expect = 1e-08
 Identities = 31/212 (14%), Positives = 74/212 (34%), Gaps = 33/212 (15%)

Query: 1   SFDDLD-DEEKNIFLDIVCFFKREDKDFIIKFL-----NACGFDAQIGISDLVNKSLIVI 54
           S + L+  E + +F  +  F            L     +    D  + ++ L   SL+  
Sbjct: 362 SLNVLEPAEYRKMFDRLSVF--PPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEK 419

Query: 55  HNNQ--ITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEG---- 108
              +  I++  +  E+  ++  + +++    RS + HY       + +     ++     
Sbjct: 420 QPKESTISIPSIYLELKVKLENEYALH----RSIVDHYNIPKTFDSDDLIPPYLDQYFYS 475

Query: 109 -ICFDMSKVKQIGLNLDTFTKMH-KLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHW 166
            I   +  ++     +  F  +    RFL+    I    +    S      L +++++  
Sbjct: 476 HIGHHLKNIEHPE-RMTLFRMVFLDFRFLE--QKIRHDSTAWNASGSILNTLQQLKFY-- 530

Query: 167 DGYPLTSLPSNIYPDKLV-----FLEIPDSNI 193
             Y   + P     ++LV     FL   + N+
Sbjct: 531 KPYICDNDP---KYERLVNAILDFLPKIEENL 559
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.27
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.95
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.67
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.63
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.29
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.19
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.17
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.07
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.06
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.04
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.03
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.02
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.02
3m19_A 251 Variable lymphocyte receptor A diversity region; a 98.02
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.01
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.0
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.99
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.99
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.98
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.96
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 97.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.96
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.95
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.94
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.93
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.93
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.91
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.89
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.89
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.88
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 97.88
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.86
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.86
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.85
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.85
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.85
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.84
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.83
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.82
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.81
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.8
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.8
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.79
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.77
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.76
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.76
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.75
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.74
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.74
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.73
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.73
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.72
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.72
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.71
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.71
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.7
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.7
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.7
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.7
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.66
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.64
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.63
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.63
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.62
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.62
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.62
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.58
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.58
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.57
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.54
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.53
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.53
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.53
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.51
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.49
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.48
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 97.46
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.42
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 97.41
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 97.4
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.39
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 97.39
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 97.37
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 97.37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 97.36
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 97.3
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.3
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.17
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.02
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 96.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.85
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.7
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.34
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.28
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.01
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 95.62
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 95.56
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 94.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.72
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 93.82
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.74
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 93.63
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 93.18
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 92.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 92.54
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 90.23
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 89.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 87.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 86.12
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 84.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 84.69
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 84.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 83.68
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 82.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 81.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 81.38
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.27  E-value=5.6e-13  Score=119.34  Aligned_cols=76  Identities=11%  Similarity=0.102  Sum_probs=63.9

Q ss_pred             CCccCcccccceec-----------eeecCCCCCCHHHHHHHHHHc--CCccee-----------chhhcccCCcceee-
Q 046172            1 SFDDLDDEEKNIFL-----------DIVCFFKREDKDFIIKFLNAC--GFDAQI-----------GISDLVNKSLIVIH-   55 (198)
Q Consensus         1 SYd~L~~~~K~~FL-----------~iAcf~~~~~~~~v~~~l~~~--g~~~~~-----------~i~~L~~~sLi~~~-   55 (198)
                      ||++|+++.|.||+           |||+||+|+...  +.+|.++  ||....           ++++|+++|||+.. 
T Consensus       370 Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~  447 (549)
T 2a5y_B          370 SYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGK  447 (549)
T ss_dssp             SSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEE
T ss_pred             ccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEec
Confidence            89999999999999           999999998877  7899999  776432           49999999999886 


Q ss_pred             c---CeEEecHHHHHHHHHHhhhccc
Q 046172           56 N---NQITMHDLLQEMGREVVKQESV   78 (198)
Q Consensus        56 ~---~~i~MHdli~dmg~~i~~~es~   78 (198)
                      .   .+++|||+||++|++++++++.
T Consensus       448 ~~~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          448 RMPVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             CSSSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             CCCceEEEeChHHHHHHHHHHHHHHH
Confidence            2   4699999999999999988764
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.09
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.06
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.0
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.89
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.86
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.75
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 97.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.69
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.4
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.31
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 97.3
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.28
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.18
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.18
d1ozna_ 284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.17
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.16
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.14
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.11
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.08
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.07
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.04
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 96.64
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.61
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 95.9
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 95.66
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.56
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 90.71
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 90.13
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 85.99
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 85.85
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 85.27
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=98.09  E-value=3.4e-06  Score=59.07  Aligned_cols=81  Identities=12%  Similarity=0.170  Sum_probs=59.6

Q ss_pred             cceEEEEeeCCcccccccChhhhcCCccccEEEEecccccCCCccccccCCCCc-cCCcceEEeCCCCCCCCCC--CC-C
Q 046172          104 EKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPI-LAKVRYFHWDGYPLTSLPS--NI-Y  179 (198)
Q Consensus       104 ~~v~~i~l~~~~~~~~~~~~~~f~~m~~Lr~L~l~~~~~~~~~~~~~~lp~~l~-l~~Lr~L~~~~~~l~~LP~--~~-~  179 (198)
                      ..++.+.+.-...  -.++ +.|.+|++|+.|++.+..       ...+| ++. +++|+.|+++++.+.++|.  .+ .
T Consensus        20 ~~L~~L~ls~N~l--~~lp-~~~~~l~~L~~L~l~~N~-------i~~l~-~~~~l~~L~~L~l~~N~i~~~~~~~~l~~   88 (124)
T d1dcea3          20 LLVTHLDLSHNRL--RALP-PALAALRCLEVLQASDNA-------LENVD-GVANLPRLQELLLCNNRLQQSAAIQPLVS   88 (124)
T ss_dssp             TTCCEEECCSSCC--CCCC-GGGGGCTTCCEEECCSSC-------CCCCG-GGTTCSSCCEEECCSSCCCSSSTTGGGGG
T ss_pred             CCCCEEECCCCcc--Ccch-hhhhhhhccccccccccc-------ccccC-ccccccccCeEECCCCccCCCCCchhhcC
Confidence            3455554443332  2333 578999999999998763       34555 477 9999999999999998885  34 5


Q ss_pred             CCCceEEEcCCCCccc
Q 046172          180 PDKLVFLEIPDSNIEQ  195 (198)
Q Consensus       180 l~~L~~L~L~~S~i~~  195 (198)
                      +.+|++|+++++.+..
T Consensus        89 ~~~L~~L~l~~N~i~~  104 (124)
T d1dcea3          89 CPRLVLLNLQGNSLCQ  104 (124)
T ss_dssp             CTTCCEEECTTSGGGG
T ss_pred             CCCCCEEECCCCcCCc
Confidence            8899999999988764
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure