Citrus Sinensis ID: 046172
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| 359486071 | 1261 | PREDICTED: TMV resistance protein N-like | 1.0 | 0.157 | 0.471 | 3e-51 | |
| 359486073 | 1296 | PREDICTED: TMV resistance protein N-like | 1.0 | 0.152 | 0.467 | 5e-51 | |
| 359486075 | 1291 | PREDICTED: TMV resistance protein N-like | 1.0 | 0.153 | 0.467 | 7e-51 | |
| 224145028 | 709 | nbs-lrr resistance protein [Populus tric | 0.994 | 0.277 | 0.502 | 1e-50 | |
| 105922468 | 581 | NBS type disease resistance protein [Pop | 0.994 | 0.339 | 0.502 | 2e-50 | |
| 255561520 | 465 | conserved hypothetical protein [Ricinus | 0.994 | 0.423 | 0.510 | 6e-50 | |
| 255564976 | 944 | TMV resistance protein N, putative [Rici | 1.0 | 0.209 | 0.5 | 2e-49 | |
| 147770134 | 1414 | hypothetical protein VITISV_040107 [Viti | 1.0 | 0.140 | 0.457 | 3e-49 | |
| 255537139 | 1137 | leucine-rich repeat-containing protein, | 0.989 | 0.172 | 0.502 | 4e-49 | |
| 357515077 | 1266 | NBS-LRR resistance-like protein 4G [Medi | 0.984 | 0.154 | 0.492 | 5e-49 |
| >gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 206 bits (525), Expect = 3e-51, Method: Compositional matrix adjust.
Identities = 101/214 (47%), Positives = 149/214 (69%), Gaps = 16/214 (7%)
Query: 1 SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQIT 60
SFD LDD +K+IFLDI CFFK +DKD++IK L +C F +I I +L++KSL+ I N++
Sbjct: 429 SFDGLDDNQKDIFLDIACFFKGQDKDYVIKLLKSCDFFPEIEIRNLIDKSLVTISYNKLC 488
Query: 61 MHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIG 120
MHDL+QEMG E+V+QES+ +PG+RSRLW +D+I++LT NTGTE +EG+ ++S +K++
Sbjct: 489 MHDLIQEMGWEIVRQESIKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLNLSTLKELH 548
Query: 121 LNLDTFTKMHKLRFLKFYNSISEGKS---------KCMVSNCQGPILA-------KVRYF 164
+++ FTKM+KLR L+FY++ G S K + C+ + +R
Sbjct: 549 FSVNVFTKMNKLRVLRFYDAQIWGSSWIGRHNDRYKSPYTECKFHLSGDFKFLSNHLRSL 608
Query: 165 HWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD 198
HWDGYPL SLPSN +P+KL+ L++ S +EQLW+
Sbjct: 609 HWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWE 642
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224145028|ref|XP_002325500.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862375|gb|EEE99881.1| nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|105922468|gb|ABF81418.1| NBS type disease resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255561520|ref|XP_002521770.1| conserved hypothetical protein [Ricinus communis] gi|223538983|gb|EEF40580.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357515077|ref|XP_003627827.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] gi|355521849|gb|AET02303.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 1.0 | 0.153 | 0.424 | 1.5e-41 | |
| TAIR|locus:2122955 | 1309 | AT4G19500 [Arabidopsis thalian | 0.989 | 0.149 | 0.449 | 5.6e-39 | |
| TAIR|locus:2118116 | 1895 | WRKY19 [Arabidopsis thaliana ( | 0.959 | 0.100 | 0.464 | 5.1e-37 | |
| TAIR|locus:2146243 | 900 | AT5G18360 [Arabidopsis thalian | 0.989 | 0.217 | 0.393 | 9.6e-34 | |
| TAIR|locus:2162439 | 1008 | AT5G22690 [Arabidopsis thalian | 0.989 | 0.194 | 0.37 | 4.6e-31 | |
| TAIR|locus:2122965 | 1210 | AT4G19510 [Arabidopsis thalian | 0.712 | 0.116 | 0.427 | 4.4e-30 | |
| TAIR|locus:2155322 | 1170 | LAZ5 "LAZARUS 5" [Arabidopsis | 0.989 | 0.167 | 0.368 | 1.1e-29 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.994 | 0.165 | 0.371 | 3.1e-29 | |
| TAIR|locus:2151506 | 1127 | RPS6 "RESISTANT TO P. SYRINGAE | 0.994 | 0.174 | 0.373 | 6e-29 | |
| TAIR|locus:2115870 | 1234 | AT4G08450 [Arabidopsis thalian | 1.0 | 0.160 | 0.379 | 2.4e-28 |
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 453 (164.5 bits), Expect = 1.5e-41, P = 1.5e-41
Identities = 84/198 (42%), Positives = 134/198 (67%)
Query: 1 SFDDLDDEEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQIT 60
S+D LD++EK IFL I CF+ + D++ K L+ CG+ A+IGI+ L KSLIV N +
Sbjct: 422 SYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLIVESNGCVK 481
Query: 61 MHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIG 120
+HDLL++MGRE+V+Q++VNNP +R LW EDI +L+ N+GT+ +EGI ++S++ ++
Sbjct: 482 IHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVF 541
Query: 121 LNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHWDGYPLTSLPSNIYP 180
+ F + L+ L FY+ +G+++ + N + K+RY WDGYPL ++PS +P
Sbjct: 542 ASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFP 601
Query: 181 DKLVFLEIPDSNIEQLWD 198
+ LV L + +SN+E+LWD
Sbjct: 602 EFLVELCMSNSNLEKLWD 619
|
|
| TAIR|locus:2122955 AT4G19500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 6e-42 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 150 bits (379), Expect = 6e-42
Identities = 79/201 (39%), Positives = 118/201 (58%), Gaps = 4/201 (1%)
Query: 1 SFDDLDD-EEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQI 59
S+D L++ ++K IF I C F E + I L D IG+ +LV+KSLI + + +
Sbjct: 429 SYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIV 488
Query: 60 TMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQI 119
MH LLQEMG+E+V+ +S N PGER L +DI +VL NTGT+K+ GI D+ ++ ++
Sbjct: 489 EMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDEL 547
Query: 120 GLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQG--PILAKVRYFHWDGYPLTSLPSN 177
++ + F M L FLKFY + K + +G + K+R WD YPL +PSN
Sbjct: 548 HIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSN 607
Query: 178 IYPDKLVFLEIPDSNIEQLWD 198
P+ LV L++ S +E+LWD
Sbjct: 608 FRPENLVKLQMQGSKLEKLWD 628
|
syringae 6; Provisional. Length = 1153 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.94 | |
| PF07725 | 20 | LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le | 97.98 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.93 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.56 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.54 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.3 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.18 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.11 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.01 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.0 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.63 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.62 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.58 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.52 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.3 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 95.52 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 94.99 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 94.72 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 94.65 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 94.46 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 94.27 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.26 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.2 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 93.85 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 92.97 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 92.67 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 92.63 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 92.28 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 92.27 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 92.24 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 92.06 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 92.05 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 91.84 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 91.62 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 91.11 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 90.83 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 89.61 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 89.33 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 89.06 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 88.88 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 87.79 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 87.29 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 87.29 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 86.77 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 85.99 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 85.21 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 85.19 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 84.59 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 82.16 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 80.63 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 80.28 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-40 Score=321.31 Aligned_cols=197 Identities=40% Similarity=0.707 Sum_probs=183.2
Q ss_pred CCccCcc-cccceeceeecCCCCCCHHHHHHHHHHcCCcceechhhcccCCcceeecCeEEecHHHHHHHHHHhhhcccC
Q 046172 1 SFDDLDD-EEKNIFLDIVCFFKREDKDFIIKFLNACGFDAQIGISDLVNKSLIVIHNNQITMHDLLQEMGREVVKQESVN 79 (198)
Q Consensus 1 SYd~L~~-~~K~~FL~iAcf~~~~~~~~v~~~l~~~g~~~~~~i~~L~~~sLi~~~~~~i~MHdli~dmg~~i~~~es~~ 79 (198)
|||+|++ ++|.||++|||||+|.+.+.|..++.++|+.+..|++.|++||||+++.++++||||+|+||++|+++++ .
T Consensus 429 SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~ 507 (1153)
T PLN03210 429 SYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-N 507 (1153)
T ss_pred hhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-C
Confidence 8999986 6999999999999999999999999999999999999999999999998899999999999999999998 6
Q ss_pred CCCCceecccccceeeeecccccccceEEEEeeCCcccccccChhhhcCCccccEEEEecccccCCCccccccCCCCc--
Q 046172 80 NPGERSRLWHYEDIIEVLTFNTGTEKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPI-- 157 (198)
Q Consensus 80 ~~~k~~rl~~~~d~~~~l~~~~~~~~v~~i~l~~~~~~~~~~~~~~f~~m~~Lr~L~l~~~~~~~~~~~~~~lp~~l~-- 157 (198)
+||+|+|+|+++|+++++++++|+.+|++|++|.++..++.++..+|.+|++|++|++++...........++|+++.
T Consensus 508 ~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~l 587 (1153)
T PLN03210 508 EPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYL 587 (1153)
T ss_pred CCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhc
Confidence 899999999999999999999999999999999998888899999999999999999987543222334578999998
Q ss_pred cCCcceEEeCCCCCCCCCCCCCCCCceEEEcCCCCcccCCC
Q 046172 158 LAKVRYFHWDGYPLTSLPSNIYPDKLVFLEIPDSNIEQLWD 198 (198)
Q Consensus 158 l~~Lr~L~~~~~~l~~LP~~~~l~~L~~L~L~~S~i~~LW~ 198 (198)
+++||+|+|++||++++|+.|.+++|++|+|++|++++||+
T Consensus 588 p~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~ 628 (1153)
T PLN03210 588 PPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWD 628 (1153)
T ss_pred CcccEEEEecCCCCCCCCCcCCccCCcEEECcCcccccccc
Confidence 78899999999999999999999999999999999999995
|
syringae 6; Provisional |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 6e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 53.3 bits (127), Expect = 1e-08
Identities = 31/212 (14%), Positives = 74/212 (34%), Gaps = 33/212 (15%)
Query: 1 SFDDLD-DEEKNIFLDIVCFFKREDKDFIIKFL-----NACGFDAQIGISDLVNKSLIVI 54
S + L+ E + +F + F L + D + ++ L SL+
Sbjct: 362 SLNVLEPAEYRKMFDRLSVF--PPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEK 419
Query: 55 HNNQ--ITMHDLLQEMGREVVKQESVNNPGERSRLWHYEDIIEVLTFNTGTEKIEG---- 108
+ I++ + E+ ++ + +++ RS + HY + + ++
Sbjct: 420 QPKESTISIPSIYLELKVKLENEYALH----RSIVDHYNIPKTFDSDDLIPPYLDQYFYS 475
Query: 109 -ICFDMSKVKQIGLNLDTFTKMH-KLRFLKFYNSISEGKSKCMVSNCQGPILAKVRYFHW 166
I + ++ + F + RFL+ I + S L +++++
Sbjct: 476 HIGHHLKNIEHPE-RMTLFRMVFLDFRFLE--QKIRHDSTAWNASGSILNTLQQLKFY-- 530
Query: 167 DGYPLTSLPSNIYPDKLV-----FLEIPDSNI 193
Y + P ++LV FL + N+
Sbjct: 531 KPYICDNDP---KYERLVNAILDFLPKIEENL 559
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.27 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.95 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 98.67 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 98.63 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.29 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.27 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.27 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.19 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.19 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.17 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.13 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.13 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.11 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.07 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.06 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.06 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.04 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.03 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.02 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.02 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.02 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.01 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.0 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.99 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.99 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.98 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.96 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.96 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.96 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.96 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.95 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.94 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.93 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.93 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.91 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.9 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.89 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.89 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.88 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.88 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.86 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.86 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.85 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.85 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.85 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.84 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.83 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.83 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.82 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.81 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.81 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.81 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.8 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.8 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.79 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.79 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.78 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.77 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.76 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.76 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.75 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.74 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.74 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.73 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.73 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.72 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.72 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.71 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.71 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.7 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.7 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.7 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.7 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.67 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.66 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.64 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.63 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.63 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.62 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.62 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.62 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.6 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.58 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.58 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.57 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.54 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.53 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.53 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.53 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.51 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.5 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.49 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.48 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.46 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.42 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.41 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.4 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.39 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.39 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.37 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.37 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.36 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.35 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.34 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.33 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.33 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.32 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.3 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.3 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.26 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.24 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.23 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.23 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.18 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.17 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.15 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.02 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 96.96 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 96.89 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.87 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.85 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.83 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 96.78 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.71 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.7 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.34 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.28 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 96.22 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.01 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.0 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.79 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 95.62 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 95.56 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 94.95 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 94.72 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 93.82 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 93.74 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 93.63 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 93.18 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 92.78 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 92.54 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 90.23 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 89.14 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 87.95 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 86.12 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 84.77 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 84.69 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 84.68 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 83.68 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 82.58 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 81.53 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 81.38 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.27 E-value=5.6e-13 Score=119.34 Aligned_cols=76 Identities=11% Similarity=0.102 Sum_probs=63.9
Q ss_pred CCccCcccccceec-----------eeecCCCCCCHHHHHHHHHHc--CCccee-----------chhhcccCCcceee-
Q 046172 1 SFDDLDDEEKNIFL-----------DIVCFFKREDKDFIIKFLNAC--GFDAQI-----------GISDLVNKSLIVIH- 55 (198)
Q Consensus 1 SYd~L~~~~K~~FL-----------~iAcf~~~~~~~~v~~~l~~~--g~~~~~-----------~i~~L~~~sLi~~~- 55 (198)
||++|+++.|.||+ |||+||+|+... +.+|.++ ||.... ++++|+++|||+..
T Consensus 370 Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~ 447 (549)
T 2a5y_B 370 SYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGK 447 (549)
T ss_dssp SSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEE
T ss_pred ccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEec
Confidence 89999999999999 999999998877 7899999 776432 49999999999886
Q ss_pred c---CeEEecHHHHHHHHHHhhhccc
Q 046172 56 N---NQITMHDLLQEMGREVVKQESV 78 (198)
Q Consensus 56 ~---~~i~MHdli~dmg~~i~~~es~ 78 (198)
. .+++|||+||++|++++++++.
T Consensus 448 ~~~~~~~~mHdlv~~~a~~~~~~~~~ 473 (549)
T 2a5y_B 448 RMPVLTFKIDHIIHMFLKHVVDAQTI 473 (549)
T ss_dssp CSSSCEEECCHHHHHHHHTTSCTHHH
T ss_pred CCCceEEEeChHHHHHHHHHHHHHHH
Confidence 2 4699999999999999988764
|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.09 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.06 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.05 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.0 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.89 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.86 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.74 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.69 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.48 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.4 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.31 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.3 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.28 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.18 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.18 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.17 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.16 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.14 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.11 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.09 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.08 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.07 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.04 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.64 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.64 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.61 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.9 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.66 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.56 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 90.71 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 90.13 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 85.99 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 85.85 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 85.27 |
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=98.09 E-value=3.4e-06 Score=59.07 Aligned_cols=81 Identities=12% Similarity=0.170 Sum_probs=59.6
Q ss_pred cceEEEEeeCCcccccccChhhhcCCccccEEEEecccccCCCccccccCCCCc-cCCcceEEeCCCCCCCCCC--CC-C
Q 046172 104 EKIEGICFDMSKVKQIGLNLDTFTKMHKLRFLKFYNSISEGKSKCMVSNCQGPI-LAKVRYFHWDGYPLTSLPS--NI-Y 179 (198)
Q Consensus 104 ~~v~~i~l~~~~~~~~~~~~~~f~~m~~Lr~L~l~~~~~~~~~~~~~~lp~~l~-l~~Lr~L~~~~~~l~~LP~--~~-~ 179 (198)
..++.+.+.-... -.++ +.|.+|++|+.|++.+.. ...+| ++. +++|+.|+++++.+.++|. .+ .
T Consensus 20 ~~L~~L~ls~N~l--~~lp-~~~~~l~~L~~L~l~~N~-------i~~l~-~~~~l~~L~~L~l~~N~i~~~~~~~~l~~ 88 (124)
T d1dcea3 20 LLVTHLDLSHNRL--RALP-PALAALRCLEVLQASDNA-------LENVD-GVANLPRLQELLLCNNRLQQSAAIQPLVS 88 (124)
T ss_dssp TTCCEEECCSSCC--CCCC-GGGGGCTTCCEEECCSSC-------CCCCG-GGTTCSSCCEEECCSSCCCSSSTTGGGGG
T ss_pred CCCCEEECCCCcc--Ccch-hhhhhhhccccccccccc-------ccccC-ccccccccCeEECCCCccCCCCCchhhcC
Confidence 3455554443332 2333 578999999999998763 34555 477 9999999999999998885 34 5
Q ss_pred CCCceEEEcCCCCccc
Q 046172 180 PDKLVFLEIPDSNIEQ 195 (198)
Q Consensus 180 l~~L~~L~L~~S~i~~ 195 (198)
+.+|++|+++++.+..
T Consensus 89 ~~~L~~L~l~~N~i~~ 104 (124)
T d1dcea3 89 CPRLVLLNLQGNSLCQ 104 (124)
T ss_dssp CTTCCEEECTTSGGGG
T ss_pred CCCCCEEECCCCcCCc
Confidence 8899999999988764
|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|