Citrus Sinensis ID: 046178
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 515 | ||||||
| 224064350 | 491 | predicted protein [Populus trichocarpa] | 0.924 | 0.969 | 0.652 | 1e-178 | |
| 118486275 | 491 | unknown [Populus trichocarpa] | 0.883 | 0.926 | 0.648 | 1e-176 | |
| 225453582 | 497 | PREDICTED: transcription factor MYC2-lik | 0.926 | 0.959 | 0.596 | 1e-165 | |
| 255578194 | 486 | DNA binding protein, putative [Ricinus c | 0.924 | 0.979 | 0.611 | 1e-165 | |
| 224128025 | 430 | predicted protein [Populus trichocarpa] | 0.768 | 0.920 | 0.565 | 1e-144 | |
| 356520239 | 464 | PREDICTED: transcription factor MYC2-lik | 0.833 | 0.924 | 0.533 | 1e-130 | |
| 356559821 | 466 | PREDICTED: transcription factor MYC2-lik | 0.827 | 0.914 | 0.499 | 1e-125 | |
| 225426580 | 468 | PREDICTED: transcription factor MYC4 [Vi | 0.891 | 0.980 | 0.497 | 1e-119 | |
| 193734712 | 476 | MYC2 [Hevea brasiliensis] | 0.867 | 0.939 | 0.475 | 1e-117 | |
| 255555757 | 479 | DNA binding protein, putative [Ricinus c | 0.918 | 0.987 | 0.455 | 1e-116 |
| >gi|224064350|ref|XP_002301432.1| predicted protein [Populus trichocarpa] gi|222843158|gb|EEE80705.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 630 bits (1625), Expect = e-178, Method: Compositional matrix adjust.
Identities = 345/529 (65%), Positives = 409/529 (77%), Gaps = 53/529 (10%)
Query: 1 MEDLIISPSSSSSLVSLTPETPPPTLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFL 60
ME+LIISPSS SS VSL+ ETPP TLQQRLQFIVQ+QP+WW+YAIFWQT SNDD+G++FL
Sbjct: 1 MEELIISPSSPSSPVSLSQETPP-TLQQRLQFIVQNQPDWWSYAIFWQT-SNDDSGRIFL 58
Query: 61 AWGDGHYQGTKDASPR------ARMSMPAPAPGAALDNNMERKRAISSIRGIQQSFMG-- 112
WGDGH+QG+KD SP+ +RM++ +N ERKR + ++GIQ S +G
Sbjct: 59 GWGDGHFQGSKDTSPKPNTFSNSRMTI----------SNSERKRVM--MKGIQ-SLIGEC 105
Query: 113 HEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGVGIPGRAQSSGSLVWLTGSHELQFYNCER 172
H++D+S+MDG D TD+EWFYVMSLTRSF G GI G+A ++GSL+WLTG HELQFYNCER
Sbjct: 106 HDLDMSLMDGNDATDSEWFYVMSLTRSFSPGDGILGKAYTTGSLIWLTGGHELQFYNCER 165
Query: 173 AKEAQSHGIETFVCIPTSCGVLELGSSDLIRENWGLVHQVKSLFGSDL--ITKPLNPNPT 230
KEAQ HGIET VCIPTSCGVLELGSS +IRENWGLV Q KSLFGSDL P PN +
Sbjct: 166 VKEAQMHGIETLVCIPTSCGVLELGSSSVIRENWGLVQQAKSLFGSDLSAYLVPKGPNNS 225
Query: 231 PAAPPMHFLDRNISFADIGIIAGVQQEQEEEEEEEEELSRPEEEDQNKVKKPRKDQGCTV 290
+ P FLDR+ISFAD+GIIAG+ QE + E++ EE ++ KP
Sbjct: 226 -SEEPTQFLDRSISFADMGIIAGL-QEDCAVDREQKNARETEEANKRNANKP-------- 275
Query: 291 KSSTGQSSYTVDSEHSDSDCPLPPPVNNISAVEKRTPKKRGRKPGLGRETPLNHVEAERQ 350
SY ++SEHSDSD PL +EKR PKKRGRKPGLGR+ PLNHVEAERQ
Sbjct: 276 -----GLSY-LNSEHSDSDFPLLA-----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQ 324
Query: 351 RREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLESQLLQRESKKVKLE 410
RREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYI ELK K+D+LESQ L+RESKKVKLE
Sbjct: 325 RREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKAKVDELESQ-LERESKKVKLE 383
Query: 411 IS---DNHSTTTSVDQA--RPSSAGSGGGFNLEVETKIMGSDAMIRVQSENVNHPAAKLM 465
++ DN STTTSVDQ+ RP+SAG G G LEVE K +G+DAMIRVQSENVN+PA++LM
Sbjct: 384 VADNLDNQSTTTSVDQSACRPNSAG-GAGLALEVEIKFVGNDAMIRVQSENVNYPASRLM 442
Query: 466 SSLRDLDLQLHHASMSCVNDLMLQDIVVRVPDGLRTEDALRSALLRRLD 514
+LR+L+ Q+HHASMSCVN+LMLQD+VVRVPDGLRTE+AL+SALL RL+
Sbjct: 443 CALRELEFQVHHASMSCVNELMLQDVVVRVPDGLRTEEALKSALLGRLE 491
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118486275|gb|ABK94979.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225453582|ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255578194|ref|XP_002529965.1| DNA binding protein, putative [Ricinus communis] gi|223530527|gb|EEF32408.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224128025|ref|XP_002320222.1| predicted protein [Populus trichocarpa] gi|222860995|gb|EEE98537.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356520239|ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356559821|ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225426580|ref|XP_002279973.1| PREDICTED: transcription factor MYC4 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|193734712|gb|ACF19982.1| MYC2 [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|255555757|ref|XP_002518914.1| DNA binding protein, putative [Ricinus communis] gi|223541901|gb|EEF43447.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 515 | ||||||
| TAIR|locus:2134583 | 423 | AT4G00870 "AT4G00870" [Arabido | 0.314 | 0.382 | 0.567 | 1.5e-79 | |
| TAIR|locus:2035609 | 623 | MYC2 "AT1G32640" [Arabidopsis | 0.316 | 0.261 | 0.562 | 1.8e-76 | |
| TAIR|locus:2141055 | 589 | MYC4 "AT4G17880" [Arabidopsis | 0.434 | 0.380 | 0.432 | 1.1e-72 | |
| TAIR|locus:2178555 | 592 | MYC3 "AT5G46760" [Arabidopsis | 0.415 | 0.361 | 0.420 | 8.2e-71 | |
| UNIPROTKB|Q336P5 | 699 | Os10g0575000 "Os10g0575000 pro | 0.304 | 0.224 | 0.529 | 5e-69 | |
| TAIR|locus:2172932 | 511 | NIG1 "AT5G46830" [Arabidopsis | 0.299 | 0.301 | 0.509 | 2.3e-64 | |
| TAIR|locus:2039094 | 566 | AIB "AT2G46510" [Arabidopsis t | 0.233 | 0.212 | 0.460 | 4.7e-38 | |
| TAIR|locus:2035237 | 590 | AT1G01260 "AT1G01260" [Arabido | 0.339 | 0.296 | 0.35 | 3e-36 | |
| TAIR|locus:2130619 | 467 | AT4G16430 "AT4G16430" [Arabido | 0.233 | 0.256 | 0.421 | 4.5e-33 | |
| TAIR|locus:2118524 | 518 | TT8 "AT4G09820" [Arabidopsis t | 0.351 | 0.349 | 0.305 | 7.7e-30 |
| TAIR|locus:2134583 AT4G00870 "AT4G00870" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 463 (168.0 bits), Expect = 1.5e-79, Sum P(3) = 1.5e-79
Identities = 93/164 (56%), Positives = 130/164 (79%)
Query: 342 LNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLESQLLQ 401
L+HVEAE+QRREKLNHRFYALRA+VP VSRMDKASLLSDAVSYI LK KIDDLE+++ +
Sbjct: 248 LSHVEAEKQRREKLNHRFYALRAIVPKVSRMDKASLLSDAVSYIESLKSKIDDLETEIKK 307
Query: 402 RESKKV-KLEISDNHSTTTSVD-QARPSSAGSGGGFNLEVETKIMGSDAMIRVQSENVNH 459
+ + KL+ S ++++ +SV+ Q + S G +LEV+ KI+G +A+IRVQ+ENVNH
Sbjct: 308 MKMTETDKLDNSSSNTSPSSVEYQVNQKPSKSNRGSDLEVQVKIVGEEAIIRVQTENVNH 367
Query: 460 PAAKLMSSLRDLDLQLHHASMSCVNDLMLQDIVVRVPDGLRTED 503
P + LMS+L ++D ++ HA+ S ++ +M+QD+VV VP+GLR+ED
Sbjct: 368 PTSALMSALMEMDCRVQHANASRLSQVMVQDVVVLVPEGLRSED 411
|
|
| TAIR|locus:2035609 MYC2 "AT1G32640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141055 MYC4 "AT4G17880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2178555 MYC3 "AT5G46760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q336P5 Os10g0575000 "Os10g0575000 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2172932 NIG1 "AT5G46830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039094 AIB "AT2G46510" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035237 AT1G01260 "AT1G01260" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130619 AT4G16430 "AT4G16430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118524 TT8 "AT4G09820" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 515 | |||
| pfam14215 | 171 | pfam14215, bHLH-MYC_N, bHLH-MYC and R2R3-MYB trans | 3e-67 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 3e-13 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 1e-11 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 4e-10 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.002 |
| >gnl|CDD|222598 pfam14215, bHLH-MYC_N, bHLH-MYC and R2R3-MYB transcription factors N-terminal | Back alignment and domain information |
|---|
Score = 214 bits (546), Expect = 3e-67
Identities = 83/191 (43%), Positives = 114/191 (59%), Gaps = 20/191 (10%)
Query: 26 LQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAPA 85
LQQRLQ +V+S E W+YAIFWQ +S D +G L WGDG+Y G +
Sbjct: 1 LQQRLQALVES--EQWSYAIFWQ-LSPDQSG--VLGWGDGYYNGEIKTRKTVAEEL---- 51
Query: 86 PGAALDNNMERKRAISSIRGIQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGVG 145
++RK+ + S + D + + D+TDTEWFY++S+T SF G G
Sbjct: 52 -------GLQRKKVLRE----LYSLLSGSRDAAALSPEDLTDTEWFYLVSMTFSFPPGEG 100
Query: 146 IPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFVCIPTSCGVLELGSSDLIREN 205
+PG+A +SGS +WL+G++EL NC R+ AQS GI+T VCIP GV+ELGS++ I E+
Sbjct: 101 LPGKAFASGSHIWLSGANELDSSNCSRSWLAQSAGIQTIVCIPVPGGVVELGSTEKIPED 160
Query: 206 WGLVHQVKSLF 216
LV VKSLF
Sbjct: 161 LNLVQHVKSLF 171
|
This is the N-terminal region of a family of MYB and MYC transcription factors. The DNA-binding HLH domain is further downstream, pfam00010. Members of the MYB and MYC family regulate the biosynthesis of phenylpropanoids in several plant species (DOI:10.1007/s11295-009-0232-y). Length = 171 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 515 | |||
| PF14215 | 163 | bHLH-MYC_N: bHLH-MYC and R2R3-MYB transcription fa | 100.0 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.24 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.24 | |
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.2 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 98.62 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 98.36 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 98.23 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 98.21 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 98.19 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 98.12 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 98.11 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 97.92 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 97.91 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 97.71 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 97.63 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 97.59 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.53 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 97.51 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 97.23 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.18 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 97.17 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 97.14 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 97.04 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 97.04 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 96.79 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 96.75 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 96.39 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 96.34 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 96.22 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 96.22 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 96.22 | |
| PRK00194 | 90 | hypothetical protein; Validated | 96.21 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 96.21 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 96.18 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 96.15 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 95.9 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 95.9 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 95.88 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 95.45 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 95.37 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 95.18 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 95.04 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 94.99 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 94.89 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 94.74 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 94.69 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 94.54 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 94.54 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 94.17 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 93.99 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 93.96 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 93.78 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 92.95 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 92.88 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 92.84 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 92.82 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 92.75 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 92.43 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 92.03 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 91.81 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 91.66 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 91.61 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 91.08 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 90.57 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 90.16 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 89.9 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 89.78 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 89.73 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 89.7 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 89.7 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 89.69 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 89.49 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 88.96 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 88.81 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 88.62 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 88.17 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 87.95 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 87.35 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 86.88 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 86.18 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 85.79 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 85.53 | |
| PF13185 | 148 | GAF_2: GAF domain; PDB: 2QYB_A 3KSG_B 3KSF_C 3KSI_ | 84.72 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 84.51 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 84.32 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 82.86 | |
| KOG4395 | 285 | consensus Transcription factor Atonal, contains HT | 80.61 |
| >PF14215 bHLH-MYC_N: bHLH-MYC and R2R3-MYB transcription factors N-terminal | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-53 Score=396.98 Aligned_cols=163 Identities=46% Similarity=0.837 Sum_probs=146.9
Q ss_pred HHHHHHHHHccCCCCcEEEEeeecccCCCCCCcceEEcceecCCCCCCCccccCCCCCCCCCcccchhHHHHHhhhhhhh
Q 046178 26 LQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAPAPGAALDNNMERKRAISSIRG 105 (515)
Q Consensus 26 Lq~~L~~lv~~~~~~W~YAIFWq~~s~~~~g~~vL~WgDGy~~g~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~lre 105 (515)
|||+||+||+ +.+|+||||||+ ++++ ++|+||||||+|++++++.. .+.+.+|+++ ||+
T Consensus 1 Lq~~Lr~lv~--~~~W~YaVFWk~-~~~~---~~L~W~DG~~~g~~~~~~~~------------~~~~~~~~~~---l~~ 59 (163)
T PF14215_consen 1 LQQRLRSLVE--NSQWTYAVFWKL-SPDN---SVLVWGDGYCNGPKETRKNG------------EEEQEQRSKV---LRE 59 (163)
T ss_pred ChHHHHHHhC--CCCCcEEEEeEE-cCCC---CeeeEcceeecCCcccccch------------hhccchhhhH---HHH
Confidence 7999999997 579999999999 8774 49999999999998766421 1345566766 499
Q ss_pred hcccccCCCccccccCCCCCCCceEEEEEeeeeeeCCCCCccceEeeCCCeeeeeCCCCcCcCcchhHHHHhhcCCceEE
Q 046178 106 IQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGVGIPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFV 185 (515)
Q Consensus 106 L~~sl~~g~~~~~~l~~~~vtd~Ewfyl~sm~~sf~~g~GlpG~a~~sg~~~Wl~~~~~~~~~~~~r~~~a~~~giqTiv 185 (515)
|| ++++ ..++.+++|+|+||||++||+|+| |+|+|||||++|+|+||++++.++.+.|+|+++||++||||||
T Consensus 60 l~-~~~~----~~~~~~~~v~~~e~f~~~s~~~sf--g~G~~G~a~~sg~~~Wi~~~~~~~~~~~~r~~~aq~~~~~Tiv 132 (163)
T PF14215_consen 60 LH-SSFS----SYALSPEEVTDTEWFYLVSMSYSF--GEGIPGRAAASGQHIWISGANELDSSYCERAWLAQFAGIQTIV 132 (163)
T ss_pred Hh-hhcc----ccccccchhHHHHHHhhceeeEEe--cCCccEEEeecCccEEEeCCCccccccchhhhhhcccccceEE
Confidence 99 6554 556788999999999999999999 9999999999999999999999999999999999999999999
Q ss_pred EEecCCceEeeccccccccChhHHHHHHHHh
Q 046178 186 CIPTSCGVLELGSSDLIRENWGLVHQVKSLF 216 (515)
Q Consensus 186 ciP~~~GVvELGSt~~v~E~~~lv~~ik~~F 216 (515)
|||+++||||||||++|+||+++|++||++|
T Consensus 133 ~IPv~~GVvELGSt~~I~Ed~~~v~~vk~~F 163 (163)
T PF14215_consen 133 CIPVPNGVVELGSTEKIPEDSNLVQRVKSLF 163 (163)
T ss_pred EEEecCCEEEeeeeeeeccCHHHHHHHHhhC
Confidence 9999999999999999999999999999998
|
|
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF13185 GAF_2: GAF domain; PDB: 2QYB_A 3KSG_B 3KSF_C 3KSI_A 3KSH_A 3MMH_A 3RFB_B 1F5M_A 3KO6_B 3HCY_A | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 515 | |||
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 1e-16 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 4e-14 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 6e-14 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 3e-13 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 5e-11 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 3e-10 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 3e-09 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 6e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 2e-04 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 3e-04 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 8e-04 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 9e-04 |
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
Score = 74.3 bits (183), Expect = 1e-16
Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 5/75 (6%)
Query: 343 NHVEAERQRREKLNHRFYALRAVVP---NVSRMDKASLLSDAVSYIRELKVKIDDLESQL 399
H ERQRR +L F+ALR +P N + K +L A +YI ++ + L S+
Sbjct: 9 THNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEE 68
Query: 400 --LQRESKKVKLEIS 412
L++ +++K ++
Sbjct: 69 DLLRKRREQLKHKLE 83
|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 515 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.58 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.48 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.47 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.46 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.42 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.41 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.41 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.39 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.37 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.32 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.3 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 99.0 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 98.99 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 98.73 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 98.55 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.48 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.22 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 97.84 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 96.99 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 95.69 | |
| 1f5m_A | 180 | GAF; CGMP binding, signaling protein; 1.90A {Sacch | 95.21 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 95.14 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 94.57 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 94.35 | |
| 3dba_A | 180 | CONE CGMP-specific 3',5'-cyclic phosphodiesterase | 94.22 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 94.11 | |
| 1vhm_A | 195 | Protein YEBR; structural genomics, unknown functio | 93.11 | |
| 2vjw_A | 149 | GAF-B, GAF family protein; histidine kinase, hypox | 92.98 | |
| 2e4s_A | 189 | CAMP and CAMP-inhibited CGMP 3',5'-cyclic phosphod | 92.89 | |
| 3e0y_A | 181 | Conserved domain protein; APC87688.2, geobacter su | 92.65 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 92.19 | |
| 3mmh_A | 167 | FRMSR, methionine-R-sulfoxide reductase; oxidoredu | 92.18 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 92.15 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 91.73 | |
| 3hcy_A | 151 | Putative two-component sensor histidine kinase PR; | 91.43 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 91.3 | |
| 3trc_A | 171 | Phosphoenolpyruvate-protein phosphotransferase; si | 90.8 | |
| 2w3g_A | 153 | DOSS, two component sensor histidine kinase DEVS ( | 90.52 | |
| 3k2n_A | 177 | Sigma-54-dependent transcriptional regulator; PSI- | 90.5 | |
| 3ksh_A | 160 | Putative uncharacterized protein; FRMSR, free-Met- | 90.4 | |
| 3rfb_A | 171 | Putative uncharacterized protein; FRMSR, GAF, oxid | 90.19 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 89.76 | |
| 3ci6_A | 171 | Phosphoenolpyruvate-protein phosphotransferase; PE | 89.35 | |
| 2qyb_A | 181 | Membrane protein, putative; GAF domain, domain of | 88.82 | |
| 2zmf_A | 189 | CAMP and CAMP-inhibited CGMP 3',5'-cyclic phospho | 88.71 | |
| 3oov_A | 169 | Methyl-accepting chemotaxis protein, putative; str | 87.05 | |
| 1ykd_A | 398 | Adenylate cyclase; GAF domain, bound cyclic AMP li | 86.59 | |
| 3ibj_A | 691 | CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE | 84.09 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 83.07 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 83.03 | |
| 1mc0_A | 368 | 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF | 82.59 | |
| 1mc0_A | 368 | 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF | 82.0 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 80.27 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=99.58 E-value=2.2e-15 Score=125.15 Aligned_cols=65 Identities=23% Similarity=0.416 Sum_probs=60.7
Q ss_pred CCccchHHHHHHHHHHHHHHHHHhccCCCC-CCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 046178 340 TPLNHVEAERQRREKLNHRFYALRAVVPNV-SRMDKASLLSDAVSYIRELKVKIDDLESQLLQRES 404 (515)
Q Consensus 340 ~~~~H~~~ER~RR~kln~~f~~LrslvP~~-~k~dKasIL~daI~YIk~Lq~~v~~Le~~~~~~~s 404 (515)
.+.+|+.+||+||++||++|..|+++||.. .|+||++||.+||+||++|+.+++.|+.+...+..
T Consensus 6 rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~ 71 (82)
T 1am9_A 6 KRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRT 71 (82)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 356899999999999999999999999986 89999999999999999999999999999977654
|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1f5m_A GAF; CGMP binding, signaling protein; 1.90A {Saccharomyces cerevisiae} SCOP: d.110.2.1 PDB: 3ko6_A* | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >3dba_A CONE CGMP-specific 3',5'-cyclic phosphodiesterase alpha'; 3', GAF domain, cyclic nucleotide phosphodiesterase hydrolase, lipoprotein, membrane; HET: 35G; 2.57A {Gallus gallus} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1vhm_A Protein YEBR; structural genomics, unknown function; HET: MES; 2.10A {Escherichia coli} SCOP: d.110.2.1 | Back alignment and structure |
|---|
| >2vjw_A GAF-B, GAF family protein; histidine kinase, hypoxia sensing, hydrolase; HET: MSE; 2.0A {Mycobacterium smegmatis} PDB: 2vks_A | Back alignment and structure |
|---|
| >3e0y_A Conserved domain protein; APC87688.2, geobacter sulfurreducens PCA, structural genomics, PSI-2, midwest center for structural G MCSG; 3.10A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3mmh_A FRMSR, methionine-R-sulfoxide reductase; oxidoreductase; HET: SME MRD; 1.25A {Neisseria meningitidis} SCOP: d.110.2.0 | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3hcy_A Putative two-component sensor histidine kinase PR; two-component sensor histidine kinase protein, structural GE PSI, MCSG; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3trc_A Phosphoenolpyruvate-protein phosphotransferase; signal transduction; HET: MSE; 1.65A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2w3g_A DOSS, two component sensor histidine kinase DEVS (GAF family protein); redox sensor, heme, hypoxia, GAF domain, transferase; HET: HEM; 1.40A {Mycobacterium tuberculosis} PDB: 2w3d_A* 2w3f_A* 2w3e_A* 2w3h_A* 2y79_A* 2y8h_A* 2vzw_A* | Back alignment and structure |
|---|
| >3k2n_A Sigma-54-dependent transcriptional regulator; PSI-2, protein structure initiative, structural genomics; 2.50A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3ksh_A Putative uncharacterized protein; FRMSR, free-Met-R-SO, oxidoreductase; 1.50A {Staphylococcus aureus} SCOP: d.110.2.0 PDB: 3ksf_A 3ksi_A 3ksg_A* | Back alignment and structure |
|---|
| >3rfb_A Putative uncharacterized protein; FRMSR, GAF, oxidoreductase, SME; HET: SME; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3ci6_A Phosphoenolpyruvate-protein phosphotransferase; PEP-phosphotransferase, GAF domain, structura genomics, PSI-2, protein structure initiative; HET: MSE P4G; 1.55A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2qyb_A Membrane protein, putative; GAF domain, domain of putative membrane protein, PSI-2, MCSG structural genomics; 2.40A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2zmf_A CAMP and CAMP-inhibited CGMP 3',5'-cyclic phospho 10A; GAF domain, phosphodiesterase, CGMP-binding, HYD nucleotide-binding, structural genomics; HET: MSE CMP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3oov_A Methyl-accepting chemotaxis protein, putative; structural genomics, PSI-2, protein structure initiative; 2.20A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1ykd_A Adenylate cyclase; GAF domain, bound cyclic AMP ligand, lyase; HET: CMP; 1.90A {Anabaena SP} | Back alignment and structure |
|---|
| >3ibj_A CGMP-dependent 3',5'-cyclic phosphodiesterase; PDE2A, GAF-domains, allosteric regulation hydrolase, membrane; 3.02A {Homo sapiens} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >1mc0_A 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF domain, 3',5' guanosine monophosphate, hydrolase; HET: PCG; 2.86A {Mus musculus} SCOP: d.110.2.1 d.110.2.1 | Back alignment and structure |
|---|
| >1mc0_A 3',5'-cyclic nucleotide phosphodiesterase 2A; GAF domain, 3',5' guanosine monophosphate, hydrolase; HET: PCG; 2.86A {Mus musculus} SCOP: d.110.2.1 d.110.2.1 | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 515 | ||||
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 3e-15 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 4e-14 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 9e-14 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 3e-13 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 2e-12 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 5e-12 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 1e-11 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 6e-11 |
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Max protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.7 bits (168), Expect = 3e-15
Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 4/74 (5%)
Query: 343 NHVEAERQRREKLNHRFYALRAVVP--NVSRMDKASLLSDAVSYIRELKVKIDDLESQL- 399
+H ER+RR+ + F++LR VP + +A +L A YI+ ++ K + +
Sbjct: 5 HHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDID 64
Query: 400 -LQRESKKVKLEIS 412
L+R++ ++ ++
Sbjct: 65 DLKRQNALLEQQVR 78
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 515 | |||
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.41 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.39 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.34 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.28 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 97.11 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 96.64 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 95.83 | |
| d1f5ma_ | 176 | Hypothetical protein ykl069wp {Baker's yeast (Sacc | 93.82 | |
| d1vhma_ | 159 | Hypothetical protein YebR {Escherichia coli [TaxId | 93.77 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 92.4 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 92.22 | |
| d1mc0a1 | 187 | 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF | 91.22 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 87.44 |
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-1a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.45 E-value=4.1e-14 Score=114.82 Aligned_cols=65 Identities=23% Similarity=0.406 Sum_probs=59.5
Q ss_pred CCccchHHHHHHHHHHHHHHHHHhccCCC-CCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 046178 340 TPLNHVEAERQRREKLNHRFYALRAVVPN-VSRMDKASLLSDAVSYIRELKVKIDDLESQLLQRES 404 (515)
Q Consensus 340 ~~~~H~~~ER~RR~kln~~f~~LrslvP~-~~k~dKasIL~daI~YIk~Lq~~v~~Le~~~~~~~s 404 (515)
.+.+|+.+||+||++||+.|..|++|||. ..|++|++||.+||+||++|+.+++.|+.+...+..
T Consensus 6 kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk~ 71 (80)
T d1am9a_ 6 KRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRT 71 (80)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45689999999999999999999999997 479999999999999999999999999998876643
|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1f5ma_ d.110.2.1 (A:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhma_ d.110.2.1 (A:) Hypothetical protein YebR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1mc0a1 d.110.2.1 (A:215-401) 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|