Citrus Sinensis ID: 046417


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MSPQKRSSSASPPPSTNDLKQRVITCLNKLADRDTLPVATAELESIARTLTQDSFSSFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKEVPGVCEEVSSPSPSKSFSIDNGSSGCFPSITKSSQNVGLRTPQPKKMVPTSRSPASDSSYGTTSKTEISFKSNNRKSGASILCKSADGKSSDWKVEIAVPRTPSSIGTCEVHNRTSDSKDAKLGEVENNVNCQPEKKMVIYSKIRDDKMYKCGGFKSGSRVVPYSDDEMSDFVHHNGIDEDFDYPKDPEDLSLIREQLLQIENQQSSLFDLLQRFIGSSQSGMNSLETRVHGLEMALDEISYDLALSNGRILNNNAAENTCCKLPGAEFLSSKFWRRAEGRSSTSRFSSSGNILPLHSGSNTLDKD
cccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccc
cccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccEEEEEcccccccccccHccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEcccccccccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEcccccccccccccccccHHHHHHHcccccc
mspqkrsssaspppstndlKQRVITCLNkladrdtlpVATAELESIARTLTQDSFSSFLNclqttdssskspvrKQCVNLLTLLsrshgdslspHLSKMIStvscrlrdpdssvRSACVAATTAMslnitkpsfsvlskPLIELILVEQDVNSQVGGAMCLAAAidaapnpeVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVggarskgvldWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWkevpgvceevsspspsksfsidngssgcfpsitkssqnvglrtpqpkkmvptsrspasdssygttskteisfksnnrksgasilcksadgkssdwkveiavprtpssigtcevhnrtsdskdaklgevennvncqpekkMVIYSKirddkmykcggfksgsrvvpysddemsdfvhhngidedfdypkdpedlSLIREQLLQIENQQSSLFDLLQRFigssqsgmnslETRVHGLEMALDEISYDlalsngrilnnnaaentccklpgaeflsskfwrraegrsstsrfsssgnilplhsgsntldkd
mspqkrsssaspppstndlKQRVITCLNkladrdtlPVATAELESIARTLTQDSFSSFLNCLQttdssskspvrKQCVNLLTLLsrshgdslspHLSKMISTVSCRLRDPDSSVRSACVAATtamslnitkpsFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEgfkakaavlGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSClaaletrrfdkvkIVRETMNRSLEMWKEVPGVCEEVSSPSPSKSFSIDNGSSGCFPSITKssqnvglrtpqpkkmvptsrspasdssygttskteisfksnnrksgaSILCKsadgkssdwKVEIAvprtpssigtcevhnrtsdskdaklgevennvncqpekkMVIYSKIRDDKMYKCGGFKSGSRVVPYSDDEMSDFVHHNGIDEDFDYPKDPEDLSLIREQLLQIENQQSSLFDLLQRFIGSSQSGMNSLETRVHGLEMALDEISYDLALSNGRILNNNAAENTCCKLPGAEFLSSKFWRRAEGRsstsrfsssgnilplhsgsntldkd
MSPQKRSSSASPPPSTNDLKQRVITCLNKLADRDTLPVATAELESIARTLTQDSFSSFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKevpgvceevsspspsksfsIDNGSSGCFPSITKSSQNVGLRTPQPKKMVPTSRSPASDSSYGTTSKTEISFKSNNRKSGASILCKSADGKSSDWKVEIAVPRTPSSIGTCEVHNRTSDSKDAKLGEVENNVNCQPEKKMVIYSKIRDDKMYKCGGFKSGSRVVPYSDDEMSDFVHHNGIDEDFDYPKDPEDLSLIREQLLQIENQQSSLFDLLQRFIGSSQSGMNSLETRVHGLEMALDEISYDLALSNGRILNNNAAENTCCKLPGAEFLSSKFWRRAEGrsstsrfsssGNILPLHSGSNTLDKD
*********************RVITCLNKLADRDTLPVATAELESIARTLTQDSFSSFLNCLQ************QCVNLLTLL********************C*********RSACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKEVPGVC**********************************************************************************************************************************KKMVIYSKIRDDKMYKCGGFKSGSRVVPYS****SDFVHHNGIDEDFDY******LSLIREQLLQIENQQSSLFDLLQRFIG********LETRVHGLEMALDEISYDLALSNGRILNNNAAENTCCKLPGAEFLSSKFWR******************************
*********************RVITCLNKLADRDTLPVATAELESIARTLTQDSFSSFLNCLQT**********KQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSACVAATTAMSLNITKPSFSVLSKPLIELILVE****SQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKE**************************************************************************************************************************************************************************************************REQLLQ*ENQ*****************************EMALD********************************************************************
******************LKQRVITCLNKLADRDTLPVATAELESIARTLTQDSFSSFLNCLQ**********RKQCVNLLTLLSRSHGDSLSPHLSKMISTVS************ACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKEVPG*****************NGSSGCFPSITKS*********************************EISFKSNNRKSGASILCK********WKVEIAVPRTPSSIGTCEVHNRTSDSKDAKLGEVENNVNCQPEKKMVIYSKIRDDKMYKCGGFKSGSRVVPYSDDEMSDFVHHNGIDEDFDYPKDPEDLSLIREQLLQIENQQSSLFDLLQRFIGSSQSGMNSLETRVHGLEMALDEISYDLALSNGRILNNNAAENTCCKLPGAEFLSSKFWRR************SGNILPLHS********
*************PSTNDLKQRVITCLNKLADRDTLPVATAELESIARTLTQDSFSSFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKEVP*****************************************************************************************DWKVEIAVPRT*********************************KKM***SK***************SRV********SDFVHHNGIDEDFDYPKDPEDLSLIREQLLQIENQQSSLFDLLQRFIGSSQSGMNSLETRVHGLEMALDEISYDLALSN***********TCCKLPGAEFLSSKFWRRAE****T***SSSGNILPL**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPQKRSSSASPPPSTNDLKQRVITCLNKLADRDTLPVATAELESIARTLTQDSFSSFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKEVPGVCEEVSSPSPSKSFSIDNGSSGCFPSITKSSQNVGLRTPQPKKMVPTSRSPASDSSYGTTSKTEISFKSNNRKSGASILCKSADGKSSDWKVEIAVPRTPSSIGTCEVHNRTSDSKDAKLGEVENNVNCQPEKKMVIYSKIRDDKMYKCGGFKSGSRVVPYSDDEMSDFVHHNGIDEDFDYPKDPEDLSLIREQLLQIENQQSSLFDLLQRFIGSSQSGMNSLETRVHGLEMALDEISYDLALSNGRILNNNAAENTCCKLPGAEFLSSKFWRRAEGRSSTSRFSSSGNILPLHSGSNTLDKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query595 2.2.26 [Sep-21-2011]
F4I6M4 821 Microtubule-associated pr no no 0.463 0.336 0.363 4e-42
Q9T041 864 Microtubule-associated pr no no 0.458 0.315 0.383 2e-41
>sp|F4I6M4|SP2L_ARATH Microtubule-associated protein SPIRAL2-like OS=Arabidopsis thaliana GN=SP2L PE=2 SV=1 Back     alignment and function desciption
 Score =  173 bits (438), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 165/292 (56%), Gaps = 16/292 (5%)

Query: 18  DLKQRVITCLNKLADRDTLPVATAELESIARTL--TQDSFSSFLNCLQTTDSSSKSPVRK 75
           +LKQR++T L++L DRDT  +A  +LE I  ++  + +     L+CL  + S  K+PV++
Sbjct: 36  ELKQRILTSLSRLGDRDTYQIAVDDLEKIVVSVPDSPEILPVLLHCLFDSSSDLKAPVKR 95

Query: 76  QCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSACVAATTAMSLNITKPS-- 133
           + + LL+ L  S+ D     L+K+IS +  RL+D D+ VR AC  A  ++S    K    
Sbjct: 96  ESIRLLSFLCLSYTDLSFSQLAKIISHIVKRLKDADNGVRDACRDAIGSLSAQFLKEKEV 155

Query: 134 ----------FSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRL 183
                       + +KPL E  + EQ+ + Q G A+C+   ID+A  P V   +KL PR+
Sbjct: 156 ENGNYVGSSLVGLFAKPLFE-AMAEQNKSLQSGAAICMGKMIDSATEPPVAAFQKLCPRI 214

Query: 184 GKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVL 243
            K +    +  KA++L V+GS+ +VG A +   L+ L+  + E L C +W TRKAAA+VL
Sbjct: 215 SKLLNSPNYITKASLLPVVGSLSQVG-AIAPQSLESLLHSIHECLGCTNWVTRKAAADVL 273

Query: 244 GKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKEVPGVCE 295
             +AV    L  +   S L ALE  RFDK+K VRE+++ +L +WK + G  E
Sbjct: 274 ISLAVHSSSLVADKTDSTLTALEACRFDKIKPVRESLSEALNVWKNIAGKGE 325




Plant-specific microtubule-associated protein (MAP) that regulates the orientation of cortical microtubules and the direction of organ growth.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T041|MAPT_ARATH Microtubule-associated protein TORTIFOLIA1 OS=Arabidopsis thaliana GN=TOR1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
255558336654 Microtubule-associated protein TORTIFOLI 0.991 0.902 0.622 0.0
224110978631 predicted protein [Populus trichocarpa] 0.924 0.871 0.623 0.0
224102491563 predicted protein [Populus trichocarpa] 0.936 0.989 0.629 0.0
449458125658 PREDICTED: microtubule-associated protei 0.951 0.860 0.578 0.0
296086478653 unnamed protein product [Vitis vinifera] 0.963 0.877 0.589 1e-176
225424811654 PREDICTED: microtubule-associated protei 0.963 0.876 0.589 1e-176
357486347 750 Microtubule-associated protein TORTIFOLI 0.963 0.764 0.553 1e-164
225457188638 PREDICTED: microtubule-associated protei 0.942 0.879 0.541 1e-159
356497808 793 PREDICTED: microtubule-associated protei 0.937 0.703 0.549 1e-158
8778871649 T7N9.27 [Arabidopsis thaliana] 0.884 0.810 0.560 1e-154
>gi|255558336|ref|XP_002520195.1| Microtubule-associated protein TORTIFOLIA1, putative [Ricinus communis] gi|223540687|gb|EEF42250.1| Microtubule-associated protein TORTIFOLIA1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/602 (62%), Positives = 453/602 (75%), Gaps = 12/602 (1%)

Query: 1   MSPQKRSSSASPPPS---TNDLKQRVITCLNKLADRDTLPVATAELESIARTL-TQDSFS 56
           MS QKRS  +    +    NDLK RVI+CLNKL+DRDTL +AT ELE+IA+TL T D+FS
Sbjct: 1   MSLQKRSPPSLTLSTTTTNNDLKNRVISCLNKLSDRDTLLLATTELETIAKTLATHDAFS 60

Query: 57  SFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRS 116
           SFL C+  TDSS +SPVRK CVNLLTLLS SHG+SL+PH SKMIST++ RL DPDS+VR+
Sbjct: 61  SFLTCIYNTDSSCRSPVRKHCVNLLTLLSNSHGNSLAPHFSKMISTLTRRLHDPDSAVRA 120

Query: 117 ACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQL 176
           ACV ATTAMS  ITKP FS LSKPLIE++ VE+D N Q+G A+CLAAAI+AAP PE+E L
Sbjct: 121 ACVEATTAMSSQITKPPFSTLSKPLIEIMTVEKDFNCQIGSALCLAAAIEAAPQPELEML 180

Query: 177 RKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATR 236
           RK+LPRLGK VR +GFKAKAA+L VIGS+V VGGA+SKGVLDWL+PCLVEFL CDDW++R
Sbjct: 181 RKMLPRLGKLVRGDGFKAKAALLSVIGSIVSVGGAKSKGVLDWLMPCLVEFLSCDDWSSR 240

Query: 237 KAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKEVPGVCEE 296
           KAAAEVLGK+AV +K+LA E+K  CL+ LE RRFDKVK VRETMNR+LE+WK+VPGV +E
Sbjct: 241 KAAAEVLGKLAVAEKELAKEHKAVCLSCLENRRFDKVKAVRETMNRTLELWKQVPGVSDE 300

Query: 297 VSSPSPSKSFSIDNGSSGCFPSITKSSQNVGLRTPQPKKMVPTSRSPASDSSYGTTSKTE 356
           VS PS SK  SIDN  S  FPS   +S  VG   P PKK V  +RSP SDSS  TT++ +
Sbjct: 301 VSVPSQSKFSSIDNAISESFPSAPHNSNEVGFNHPVPKKTVLANRSPLSDSSVVTTARKQ 360

Query: 357 ISFKSNNRKSGASILCKSADGKSSDWKVEIAVPRTPSSIGTCEVHNRTSDSKDAKLGEVE 416
              K  N  S  S+  KS   ++S WK+EIA+P+     G CE   +  D    + GE  
Sbjct: 361 SPAKCINDNSKTSMFRKSEHKETSAWKIEIALPQ---DTGGCEEDIKRQDFGGFESGEDV 417

Query: 417 NNVNCQPEKKMVIYSKIRDDKMYKCGGFKSGSRVVPYSDDE---MSDFVHHNGIDEDFDY 473
           NN  C+PE K V+++ IR DK++K GGF+SGSRVVP +DD+     D   +N  +E  + 
Sbjct: 418 NNGKCRPETKRVLFNSIRKDKLHKSGGFRSGSRVVPCNDDDDCYSKDVEVNNPTEESIEN 477

Query: 474 PKDPEDLSLIREQLLQIENQQSSLFDLLQRFIGSSQSGMNSLETRVHGLEMALDEISYDL 533
            KD EDLSLI +QL+QIENQQS L DLLQ+FIGSSQ G+NSLETRV+GLEMALDEISYDL
Sbjct: 478 SKDIEDLSLIHDQLIQIENQQSHLLDLLQKFIGSSQHGINSLETRVNGLEMALDEISYDL 537

Query: 534 ALSNGRILNNNAAENTCCKLPGAEFLSSKFWRRAEGRSSTSRFSSSGNILPLHSGSNTLD 593
           ALS GR+ N ++A+NTCCKLPG   L SKFWRR EG+SSTSRFS  G+I  LH+  N  D
Sbjct: 538 ALSTGRLPNMDSADNTCCKLPGT--LCSKFWRRTEGQSSTSRFSFPGSIGSLHAAQNIRD 595

Query: 594 KD 595
           +D
Sbjct: 596 RD 597




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224110978|ref|XP_002315702.1| predicted protein [Populus trichocarpa] gi|222864742|gb|EEF01873.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102491|ref|XP_002312697.1| predicted protein [Populus trichocarpa] gi|222852517|gb|EEE90064.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449458125|ref|XP_004146798.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Cucumis sativus] gi|449518027|ref|XP_004166045.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296086478|emb|CBI32067.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424811|ref|XP_002267941.1| PREDICTED: microtubule-associated protein SPIRAL2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357486347|ref|XP_003613461.1| Microtubule-associated protein TORTIFOLIA1 [Medicago truncatula] gi|355514796|gb|AES96419.1| Microtubule-associated protein TORTIFOLIA1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|225457188|ref|XP_002280600.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497808|ref|XP_003517749.1| PREDICTED: microtubule-associated protein SPIRAL2-like [Glycine max] Back     alignment and taxonomy information
>gi|8778871|gb|AAF79870.1|AC000348_23 T7N9.27 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
TAIR|locus:2205739625 AT1G27210 [Arabidopsis thalian 0.662 0.630 0.546 3.4e-143
TAIR|locus:2025906498 AT1G59850 "AT1G59850" [Arabido 0.615 0.734 0.524 3.5e-91
TAIR|locus:2154144615 AT5G62580 [Arabidopsis thalian 0.670 0.648 0.400 1.8e-64
TAIR|locus:2136467 864 TOR1 "TORTIFOLIA 1" [Arabidops 0.880 0.606 0.312 6.3e-54
TAIR|locus:2060161 820 AT2G07170 [Arabidopsis thalian 0.611 0.443 0.338 7.4e-54
TAIR|locus:2036411 821 AT1G50890 "AT1G50890" [Arabido 0.857 0.621 0.291 7.2e-50
TAIR|locus:2205739 AT1G27210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1033 (368.7 bits), Expect = 3.4e-143, Sum P(2) = 3.4e-143
 Identities = 223/408 (54%), Positives = 285/408 (69%)

Query:     1 MSPQKRSSS-ASPPPSTN-DLKQRVITCLNKLADRDTLPVATAELESIARTLTQDSFSSF 58
             +SP   S+S +S  PST  DLKQRVI CLNKLADRDTL +A+AEL+SIAR LT DSFS F
Sbjct:    15 LSPSSSSTSPSSQSPSTPPDLKQRVIACLNKLADRDTLALASAELDSIARNLTHDSFSPF 74

Query:    59 LNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSAC 118
             LNC+  TDSS KSPVRKQCV LL++LSR HGDSL+PHL+KM+STV  RLRDPDSSVRSAC
Sbjct:    75 LNCIHNTDSSVKSPVRKQCVALLSVLSRYHGDSLTPHLAKMVSTVIRRLRDPDSSVRSAC 134

Query:   119 VAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRK 178
               AT  MS ++T+  F+ ++KPLIE ++ E D N Q+G A+CLAA++DAA +PE EQLRK
Sbjct:   135 AVATADMSAHVTRQPFASVAKPLIETLIQEGDSNLQIGAALCLAASVDAATDPESEQLRK 194

Query:   179 LLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKA 238
              LP++GK ++ +GFKAKAA+L  +GS++  GGA +K VLDWLVP L+EFL  +DWA RK+
Sbjct:   195 SLPKIGKLLKSDGFKAKAALLSAVGSIITAGGAGTKPVLDWLVPVLIEFLSSEDWAARKS 254

Query:   239 AAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSLEMWKXXXXXXXXXX 298
             AAE LGKVA  + DLA++YK++C  ALE+RRFDKVK VRETMNR+L +WK          
Sbjct:   255 AAEALGKVATAE-DLASQYKKTCTTALESRRFDKVKSVRETMNRALNLWKEVSTDDEASL 313

Query:   299 XXXXXXXXXIDNGSSGCFPSITKSSQ-NVGLRTPQPKKMVPT-SRSPAS--DSSYGTTSK 354
                       D+G+ GCF S+T+SS  +VGL++ +PKK+ P   RSP+   + SY  T +
Sbjct:   314 SPSRSST---DDGNIGCFSSVTRSSTIDVGLKSARPKKVTPIMKRSPSLPVNRSYAATRQ 370

Query:   355 TEISFKSNNRKSGASILCKSADGKSSDWKVEIAVPRTPSSIGTCEVHN 402
              E   K N  +   ++L + A   S D K     P   SS  T E  N
Sbjct:   371 KENLPKRN--QGNMTMLVEEAS--SVDNKGPHFTPVKKSSEETEEKAN 414


GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2025906 AT1G59850 "AT1G59850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154144 AT5G62580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136467 TOR1 "TORTIFOLIA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060161 AT2G07170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036411 AT1G50890 "AT1G50890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VIII.2894.1
hypothetical protein (563 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 0.001
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
 Score = 37.0 bits (86), Expect = 0.001
 Identities = 15/52 (28%), Positives = 26/52 (50%)

Query: 195 KAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKV 246
           + A    +G++   G    +  +  L+P L+  L  DD   R+AAA  LG++
Sbjct: 4   REAAALALGALAGGGPELLRPAVPELLPALLPLLKDDDDEVREAAAWALGRI 55


The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514). These EZ repeats are found in subunits of cyanobacterial phycocyanin lyase and other proteins and probably carry out a scaffolding role. Length = 55

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 595
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 100.0
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.97
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.74
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.44
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.44
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 99.22
PRK09687280 putative lyase; Provisional 99.13
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.03
KOG1242569 consensus Protein containing adaptin N-terminal re 99.02
PRK09687280 putative lyase; Provisional 99.0
KOG1242569 consensus Protein containing adaptin N-terminal re 98.94
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.91
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.84
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 98.81
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.79
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.76
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.74
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 98.72
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.67
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.6
KOG2032533 consensus Uncharacterized conserved protein [Funct 98.51
KOG0212675 consensus Uncharacterized conserved protein [Funct 98.5
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 98.49
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.42
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.39
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 98.38
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 98.36
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 98.36
KOG0212675 consensus Uncharacterized conserved protein [Funct 98.36
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.34
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 98.34
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.33
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.32
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 98.28
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 98.27
KOG18241233 consensus TATA-binding protein-interacting protein 98.23
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.22
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.17
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 98.13
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.1
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.09
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.97
KOG1820815 consensus Microtubule-associated protein [Cytoskel 97.97
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 97.95
KOG2259823 consensus Uncharacterized conserved protein [Funct 97.87
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.86
PTZ00429746 beta-adaptin; Provisional 97.85
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.82
PF05004309 IFRD: Interferon-related developmental regulator ( 97.81
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.79
KOG12481176 consensus Uncharacterized conserved protein [Funct 97.76
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.69
PTZ00429 746 beta-adaptin; Provisional 97.67
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.65
TIGR02270410 conserved hypothetical protein. Members are found 97.64
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 97.64
KOG2956516 consensus CLIP-associating protein [General functi 97.5
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.49
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.48
KOG2956516 consensus CLIP-associating protein [General functi 97.47
KOG4224550 consensus Armadillo repeat protein VAC8 required f 97.45
KOG2933334 consensus Uncharacterized conserved protein [Funct 97.44
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 97.43
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 97.37
KOG4224550 consensus Armadillo repeat protein VAC8 required f 97.37
KOG12481176 consensus Uncharacterized conserved protein [Funct 97.33
TIGR02270410 conserved hypothetical protein. Members are found 97.31
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.3
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.29
PF05004309 IFRD: Interferon-related developmental regulator ( 97.29
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.27
PF13251182 DUF4042: Domain of unknown function (DUF4042) 97.2
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.12
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.94
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 96.89
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 96.89
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 96.72
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.7
PF14500262 MMS19_N: Dos2-interacting transcription regulator 96.57
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 96.41
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 96.22
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 96.2
KOG2022982 consensus Nuclear transport receptor LGL2 (importi 96.17
PF08167165 RIX1: rRNA processing/ribosome biogenesis 96.17
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.14
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 96.09
KOG1078865 consensus Vesicle coat complex COPI, gamma subunit 96.05
KOG22741005 consensus Predicted importin 9 [Intracellular traf 96.05
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 96.05
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 96.03
KOG19431133 consensus Beta-tubulin folding cofactor D [Posttra 96.02
KOG1820815 consensus Microtubule-associated protein [Cytoskel 95.96
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 95.96
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.89
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 95.83
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 95.78
KOG4653982 consensus Uncharacterized conserved protein [Funct 95.66
KOG2933334 consensus Uncharacterized conserved protein [Funct 95.62
PF03378435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 95.59
KOG4653982 consensus Uncharacterized conserved protein [Funct 95.58
COG5656970 SXM1 Importin, protein involved in nuclear import 95.51
KOG2022982 consensus Nuclear transport receptor LGL2 (importi 95.34
PF13251182 DUF4042: Domain of unknown function (DUF4042) 95.29
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 95.23
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 95.16
KOG0803 1312 consensus Predicted E3 ubiquitin ligase [Posttrans 95.14
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 95.12
COG5240898 SEC21 Vesicle coat complex COPI, gamma subunit [In 95.1
KOG2032533 consensus Uncharacterized conserved protein [Funct 95.02
KOG1992960 consensus Nuclear export receptor CSE1/CAS (import 94.98
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.9
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 94.78
KOG0567289 consensus HEAT repeat-containing protein [General 94.6
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 94.58
KOG1059877 consensus Vesicle coat complex AP-3, delta subunit 94.54
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 94.52
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 94.38
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 94.3
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 94.29
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 94.27
KOG2062929 consensus 26S proteasome regulatory complex, subun 94.14
KOG2137700 consensus Protein kinase [Signal transduction mech 94.03
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 93.99
KOG1993978 consensus Nuclear transport receptor KAP120 (impor 93.86
smart00638574 LPD_N Lipoprotein N-terminal Domain. 93.83
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 93.76
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 93.74
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 93.72
PF08167165 RIX1: rRNA processing/ribosome biogenesis 93.69
KOG2259823 consensus Uncharacterized conserved protein [Funct 93.66
COG5116926 RPN2 26S proteasome regulatory complex component [ 93.65
KOG2025 892 consensus Chromosome condensation complex Condensi 93.38
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 93.1
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 93.07
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 92.93
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 92.81
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 92.7
KOG2025 892 consensus Chromosome condensation complex Condensi 92.65
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 92.44
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 92.43
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 92.41
KOG18371621 consensus Uncharacterized conserved protein [Funct 92.2
PF1036392 DUF2435: Protein of unknown function (DUF2435) 92.18
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 92.14
KOG04141251 consensus Chromosome condensation complex Condensi 92.12
COG5096 757 Vesicle coat complex, various subunits [Intracellu 91.77
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 91.7
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 91.55
KOG2081559 consensus Nuclear transport regulator [Intracellul 91.52
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 91.27
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 91.09
KOG1993978 consensus Nuclear transport receptor KAP120 (impor 91.08
KOG2549576 consensus Transcription initiation factor TFIID, s 91.06
PF14500262 MMS19_N: Dos2-interacting transcription regulator 90.73
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 90.61
KOG1243690 consensus Protein kinase [General function predict 90.56
KOG22741005 consensus Predicted importin 9 [Intracellular traf 90.36
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 90.08
KOG4535728 consensus HEAT and armadillo repeat-containing pro 89.88
smart00638574 LPD_N Lipoprotein N-terminal Domain. 89.63
KOG04131529 consensus Uncharacterized conserved protein relate 89.24
PF04118307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 89.16
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 89.02
KOG45241014 consensus Uncharacterized conserved protein [Funct 88.89
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 88.57
KOG2149393 consensus Uncharacterized conserved protein [Funct 88.53
PF12397121 U3snoRNP10: U3 small nucleolar RNA-associated prot 88.36
KOG1078865 consensus Vesicle coat complex COPI, gamma subunit 88.33
KOG2137700 consensus Protein kinase [Signal transduction mech 88.02
PF03378435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 87.9
KOG2021980 consensus Nuclear mRNA export factor receptor LOS1 87.63
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 87.55
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 87.41
KOG2062929 consensus 26S proteasome regulatory complex, subun 87.21
COG5656970 SXM1 Importin, protein involved in nuclear import 87.09
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 87.02
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 86.46
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 86.45
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 86.05
PF12054441 DUF3535: Domain of unknown function (DUF3535); Int 85.9
COG5116926 RPN2 26S proteasome regulatory complex component [ 85.67
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 85.52
KOG4413524 consensus 26S proteasome regulatory complex, subun 85.51
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 85.5
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 85.49
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 85.43
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 85.24
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 84.79
PF04510174 DUF577: Family of unknown function (DUF577); Inter 84.33
KOG4535728 consensus HEAT and armadillo repeat-containing pro 84.03
KOG1293678 consensus Proteins containing armadillo/beta-caten 84.0
PF05804708 KAP: Kinesin-associated protein (KAP) 83.74
KOG1293678 consensus Proteins containing armadillo/beta-caten 83.61
PF05536543 Neurochondrin: Neurochondrin 83.12
KOG1061734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 82.85
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 82.81
PF05804708 KAP: Kinesin-associated protein (KAP) 82.62
KOG2842427 consensus Interferon-related protein PC4 like [Cyt 82.52
KOG4413524 consensus 26S proteasome regulatory complex, subun 82.27
KOG1243690 consensus Protein kinase [General function predict 82.25
KOG04141251 consensus Chromosome condensation complex Condensi 82.13
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 82.1
KOG1992960 consensus Nuclear export receptor CSE1/CAS (import 81.6
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 81.21
PF10350255 DUF2428: Putative death-receptor fusion protein (D 80.96
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 80.85
PLN030761780 ARF guanine nucleotide exchange factor (ARF-GEF); 80.78
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 80.09
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=1.2e-33  Score=308.36  Aligned_cols=236  Identities=21%  Similarity=0.209  Sum_probs=214.8

Q ss_pred             hHHHHHHHHHHHHHhCCcCcHHHHHHhhhhcCCCCChHHHHHHHHHHHHHHHHccccchhhHHHHHHHHHhhccCCChhH
Q 046417           35 TLPVATAELESIARTLTQDSFSSFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSV  114 (595)
Q Consensus        35 T~r~A~~~LD~lA~~L~~~~lp~fL~~L~d~~ss~kp~vRKaaI~lLG~lAEg~gd~I~PhLpkIL~~IvrrLkD~ds~V  114 (595)
                      -+||.++.||.||..++.+.++.+|+.|.+...++.|.+|+++|++||++||||.+++.||||.++|+++..|.|-.|.|
T Consensus       371 LRkCSAAaLDVLanvf~~elL~~l~PlLk~~L~~~~W~vrEagvLAlGAIAEGcM~g~~p~LpeLip~l~~~L~DKkplV  450 (885)
T KOG2023|consen  371 LRKCSAAALDVLANVFGDELLPILLPLLKEHLSSEEWKVREAGVLALGAIAEGCMQGFVPHLPELIPFLLSLLDDKKPLV  450 (885)
T ss_pred             HhhccHHHHHHHHHhhHHHHHHHHHHHHHHHcCcchhhhhhhhHHHHHHHHHHHhhhcccchHHHHHHHHHHhccCccce
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhhhcCCcchhccHHHHHHHhh---cCChhHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHHhhccCc
Q 046417          115 RSACVAATTAMSLNITKPSFSVLSKPLIELILV---EQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEG  191 (595)
Q Consensus       115 R~Ac~~aLg~LA~~l~~~~~~~~l~PLi~aLl~---d~nk~VQ~~AA~cLaaviE~a~d~~~~~L~~Ll~rL~klL~~~~  191 (595)
                      |.++||||++++.|+..++-..||+|+++.|+.   |.||.||++||+|+|.+.|.|.+.++|||..|+..|.++|  ..
T Consensus       451 RsITCWTLsRys~wv~~~~~~~~f~pvL~~ll~~llD~NK~VQEAAcsAfAtleE~A~~eLVp~l~~IL~~l~~af--~k  528 (885)
T KOG2023|consen  451 RSITCWTLSRYSKWVVQDSRDEYFKPVLEGLLRRLLDSNKKVQEAACSAFATLEEEAGEELVPYLEYILDQLVFAF--GK  528 (885)
T ss_pred             eeeeeeeHhhhhhhHhcCChHhhhHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHHHHH--HH
Confidence            999999999999999876644589998888864   8999999999999999999999999999999999999999  77


Q ss_pred             hhHHHHHH--HHHHHHHHhhcc--cCcCcHHhHHHHHHHhcc--CCCHHHHHHHHHHHHHHHHHhHHhHHHHHHHHHHHH
Q 046417          192 FKAKAAVL--GVIGSVVRVGGA--RSKGVLDWLVPCLVEFLC--CDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAAL  265 (595)
Q Consensus       192 ~kaK~alL--sAIgSlA~a~g~--~~~~yl~~lmp~L~e~L~--~dDW~~RkaAaEaLgsIA~avge~f~py~~~~I~~L  265 (595)
                      |+.|+.+|  +|||++|...|.  ..+.|++.+||+|++.|.  +++-..-++.+|||++||.++|.+|.||.++   ++
T Consensus       529 YQ~KNLlILYDAIgtlAdsvg~~Ln~~~YiqiLmPPLi~KW~~lsd~DKdLfPLLEClSsia~AL~~gF~P~~~~---Vy  605 (885)
T KOG2023|consen  529 YQKKNLLILYDAIGTLADSVGHALNKPAYIQILMPPLIEKWELLSDSDKDLFPLLECLSSIASALGVGFLPYAQP---VY  605 (885)
T ss_pred             HhhcceehHHHHHHHHHHHHHHhcCcHHHHHHhccHHHHHHHhcCcccchHHHHHHHHHHHHHHHhccccccCHH---HH
Confidence            88776554  999999995543  357899999999999996  3443667889999999999999999999887   88


Q ss_pred             HhccCCchHHHHHH
Q 046417          266 ETRRFDKVKIVRET  279 (595)
Q Consensus       266 e~crfDKVK~VRda  279 (595)
                      ++|    +.+++..
T Consensus       606 ~Rc----~~il~~t  615 (885)
T KOG2023|consen  606 QRC----FRILQKT  615 (885)
T ss_pred             HHH----HHHHHHH
Confidence            888    7777776



>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>KOG1837 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>KOG4524 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12397 U3snoRNP10: U3 small nucleolar RNA-associated protein 10 ; InterPro: IPR022125 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04510 DUF577: Family of unknown function (DUF577); InterPro: IPR007598 This is a family of Arabidopsis thaliana (Mouse-ear cress) proteins Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2842 consensus Interferon-related protein PC4 like [Cytoskeleton] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>PF10350 DUF2428: Putative death-receptor fusion protein (DUF2428); InterPro: IPR019442 This domain is found in a family of proteins of unknown function that are conserved from plants to humans Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-13
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 6e-08
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 8e-08
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 8e-13
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 4e-05
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 8e-05
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 9e-04
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 1e-11
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 6e-10
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 1e-08
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 7e-05
2db0_A253 253AA long hypothetical protein; heat repeats, hel 6e-08
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 1e-07
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 5e-06
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 8e-06
1qgr_A876 Protein (importin beta subunit); transport recepto 1e-05
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 1e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-04
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
 Score = 72.7 bits (178), Expect = 1e-13
 Identities = 52/279 (18%), Positives = 105/279 (37%), Gaps = 18/279 (6%)

Query: 15  STNDLKQRVITCLNKLA--DRDTLPVATAE-LESIARTLTQDSFSSF-LNCLQTTDSSSK 70
             +++K  +I   + LA  ++D++ +   E   +IA+ L Q+   +  +  L+       
Sbjct: 196 ELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKS 255

Query: 71  SPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSVRSACVAATTAMSLNIT 130
             VR    +  T L ++ G  ++   + ++      ++D ++ VR+A          N++
Sbjct: 256 WRVRYMVADKFTELQKAVGPEITK--TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLS 313

Query: 131 KPSFSVLSKPLIELILVE--QDVNSQVGGAMCLAAAID--AAPNPEVEQLRKLLPRLGKA 186
                 +    I   + E   D N  V     LA+ I   +    +   +  LLP     
Sbjct: 314 ADCRENVIMSQILPCIKELVSDANQHV--KSALASVIMGLSPILGKDNTIEHLLPLFLAQ 371

Query: 187 VRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKV 246
           ++ E  + +  ++  +  V  V G R   +   L+P +VE      W  R A  E +  +
Sbjct: 372 LKDECPEVRLNIISNLDCVNEVIGIRQ--LSQSLLPAIVELAEDAKWRVRLAIIEYMPLL 429

Query: 247 A-VFDKDLATEYKRSCLAALETRRFDKVKIVRETMNRSL 284
           A     +   E      +       D V  +RE    +L
Sbjct: 430 AGQLGVEFFDEK---LNSLCMAWLVDHVYAIREAATSNL 465


>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 99.86
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.82
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.82
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.81
1qgr_A876 Protein (importin beta subunit); transport recepto 99.79
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.76
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.73
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.71
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.7
1wa5_C960 Importin alpha RE-exporter; nuclear transport/comp 99.68
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.67
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 99.64
1qgr_A876 Protein (importin beta subunit); transport recepto 99.63
2x1g_F971 Cadmus; transport protein, developmental protein, 99.63
2x19_B963 Importin-13; nuclear transport, protein transport; 99.61
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.6
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.54
4hat_C1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 99.53
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.5
3m1i_C1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 99.44
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 99.41
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.38
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.38
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.37
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.36
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.35
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.35
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.34
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.28
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.27
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.24
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.24
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.24
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.23
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.22
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.2
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.18
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.18
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.17
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.14
3gjx_A1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 99.1
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.02
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 98.96
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 98.94
1wa5_C960 Importin alpha RE-exporter; nuclear transport/comp 98.91
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 98.9
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 98.9
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.88
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.87
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.84
2x1g_F971 Cadmus; transport protein, developmental protein, 98.83
2x19_B963 Importin-13; nuclear transport, protein transport; 98.82
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.81
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.71
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.66
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.64
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.63
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.62
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 98.62
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.62
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.6
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.57
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 98.56
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.55
3nmz_A458 APC variant protein; protein-protein complex, arma 98.55
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.52
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.5
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 98.48
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.45
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 98.41
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.35
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 98.34
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.29
3m1i_C1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.17
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.17
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.12
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.07
3nmz_A458 APC variant protein; protein-protein complex, arma 97.96
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 97.96
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 97.89
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.86
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.84
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.78
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 97.74
4hat_C1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.72
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.72
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.65
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 97.59
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.37
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.36
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 97.31
3oc3_A800 Helicase MOT1, MOT1; regulation of transcription, 97.27
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.25
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.19
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 97.16
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.12
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.1
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.01
3oc3_A800 Helicase MOT1, MOT1; regulation of transcription, 96.9
3gjx_A1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 96.57
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 96.57
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.38
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 96.1
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.1
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 96.05
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 95.99
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 95.88
3grl_A651 General vesicular transport factor P115; vesicle t 95.71
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 95.68
1vsy_4799 Proteasome activator BLM10; 20S proteasome BLM10, 94.85
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 93.68
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 91.74
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 91.1
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 89.57
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 88.9
1vsy_4799 Proteasome activator BLM10; 20S proteasome BLM10, 86.76
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 86.72
3grl_A 651 General vesicular transport factor P115; vesicle t 86.24
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 86.04
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 80.65
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
Probab=99.86  E-value=1.9e-20  Score=214.34  Aligned_cols=256  Identities=17%  Similarity=0.140  Sum_probs=208.4

Q ss_pred             hHHHHHHHHHHHHHhCCcCcHHHHHHhhhhcCCCCChHHHHHHHHHHHHHHHHccccchhhHHHHHHHHHhhccCCChhH
Q 046417           35 TLPVATAELESIARTLTQDSFSSFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSV  114 (595)
Q Consensus        35 T~r~A~~~LD~lA~~L~~~~lp~fL~~L~d~~ss~kp~vRKaaI~lLG~lAEg~gd~I~PhLpkIL~~IvrrLkD~ds~V  114 (595)
                      .++.|+..|+.++..++.+.++.+++.|.+...+++|.+|++++.+||.+++++++.+.||++.+++.+++.|+|+++.|
T Consensus       337 vr~~a~~~L~~la~~~~~~~~~~l~~~l~~~l~~~~~~~R~aa~~alg~i~~~~~~~~~~~l~~~l~~l~~~l~d~~~~V  416 (852)
T 4fdd_A          337 LRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALV  416 (852)
T ss_dssp             HHHHHHHHHHHHHHHHGGGGHHHHHHHHHHHHTCSSHHHHHHHHHHHHHTTTTTHHHHGGGHHHHHHHHHHHTTCSSHHH
T ss_pred             HHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHcCCCCHHH
Confidence            37899999999999998777999999999888888999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhhhcCCcchhccHHHHHHHh---hcCChhHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHHhhccCc
Q 046417          115 RSACVAATTAMSLNITKPSFSVLSKPLIELIL---VEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEG  191 (595)
Q Consensus       115 R~Ac~~aLg~LA~~l~~~~~~~~l~PLi~aLl---~d~nk~VQ~~AA~cLaaviE~a~d~~~~~L~~Ll~rL~klL~~~~  191 (595)
                      |.+|+|++|+|+.++.......++.+++..|+   .+.++.|+..|+.||..+++..+..+.+|++.|++.|..+++...
T Consensus       417 r~~a~~~l~~l~~~~~~~~~~~~~~~ll~~L~~~L~d~~~~vr~~a~~aL~~l~~~~~~~l~~~l~~ll~~L~~~l~~~~  496 (852)
T 4fdd_A          417 RSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQ  496 (852)
T ss_dssp             HHHHHHHHHHTHHHHHHSCTTTTHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHHHHHGGGGGGGHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHhhHhhHhHHHHHHHHHHHHHHHhC
Confidence            99999999999998753222224444444433   578899999999999999999777778999999999999998776


Q ss_pred             hhHHHHHHHHHHHHHHhhcccC--cCcHHhHHHHHHHhc---cCCCHHHHHHHHHHHHHHHHHhHHhHHHHHHH----HH
Q 046417          192 FKAKAAVLGVIGSVVRVGGARS--KGVLDWLVPCLVEFL---CCDDWATRKAAAEVLGKVAVFDKDLATEYKRS----CL  262 (595)
Q Consensus       192 ~kaK~alLsAIgSlA~a~g~~~--~~yl~~lmp~L~e~L---~~dDW~~RkaAaEaLgsIA~avge~f~py~~~----~I  262 (595)
                      .+....++++|++++.+.|..+  .+|++.+||.|.+.|   .+++...| .+++||+.|+.++|..|.||.+.    |+
T Consensus       497 ~~~~~~~~~ai~~l~~~~~~~~~~~~~~~~l~p~l~~~~~~l~d~~~~~~-~~~~~l~~i~~~~g~~~~~~~~~i~~~~~  575 (852)
T 4fdd_A          497 HKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLF-PLLECLSSVATALQSGFLPYCEPVYQRCV  575 (852)
T ss_dssp             HHHHHHHHHHHHHHHHHHGGGGCCHHHHHHHHHHHHHHHHHSCTTCTTHH-HHHHHHHHHHHHHGGGGHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHhhhhhccHHHHHHHHHHHHHHHHhcccccHHHH-HHHHHHHHHHHHHhHhHHHHHHHHHHHHH
Confidence            6666778899999998776543  469999999999665   45665665 89999999999999988888765    45


Q ss_pred             HHHHhc------------cCCc-hHHHHHHHHHHHHHhHhcC
Q 046417          263 AALETR------------RFDK-VKIVRETMNRSLEMWKEVP  291 (595)
Q Consensus       263 ~~Le~c------------rfDK-VK~VRda~~~aL~~~K~i~  291 (595)
                      ..|+.+            .++. -+.+|..+..+|..+-+.-
T Consensus       576 ~~l~~~l~~~~~~~~~~~~~~~~d~~~~~~~l~~l~~l~~~l  617 (852)
T 4fdd_A          576 NLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGL  617 (852)
T ss_dssp             HHHHHHHHHHHHHHHCTTTSCCCCTHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhhcCCcccCCCcchHHHHHHHHHHHHHHHH
Confidence            566654            2221 1346666666666555433



>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1vsy_4 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_5 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1vsy_4 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_5 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 595
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-12
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 7e-11
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 6e-08
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 7e-05
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 8e-06
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 2e-05
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 3e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 8e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.001
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.002
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.002
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 0.001
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Cullin-associated NEDD8-dissociated protein 1 (Tip120)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.5 bits (163), Expect = 3e-12
 Identities = 33/251 (13%), Positives = 82/251 (32%), Gaps = 5/251 (1%)

Query: 38  VATAELESIARTLTQDSFSSFLNCLQTTDSSSKSP-VRKQCVNLLTLLSRSHGDSLSPHL 96
           +      S    L  +        L +  +  +   V+ + ++++  +    G  L    
Sbjct: 111 IGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFH 170

Query: 97  SKMISTVSCRLRDPDSSVRSACVAATTAMSLNITKPSFSVLSKPLIELILVEQDVNSQVG 156
             +++ +  +L  P  +VR   + A   + ++     F  L + L+  +     +++   
Sbjct: 171 PSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRT 230

Query: 157 GAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGV 216
              C+AA    A +   E L K++P + K   ++  + +   +    S VR         
Sbjct: 231 YIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPH 290

Query: 217 LDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKRSCLAALETRRFDKVKIV 276
           +  ++   +++L  D         E    +         +          +   D    V
Sbjct: 291 VSTIINICLKYLTYDPNYNYDDEDEDENAM----DADGGDDDDQGSDDEYSDDDDMSWKV 346

Query: 277 RETMNRSLEMW 287
           R    + L+  
Sbjct: 347 RRAAAKCLDAV 357


>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.86
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.62
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.61
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.53
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.45
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.37
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.26
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.24
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.12
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.05
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.93
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.88
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.87
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.76
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.68
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 98.66
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.59
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.56
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.56
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.53
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.3
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.25
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.18
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.09
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.61
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.42
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.81
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 94.58
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 94.42
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 92.91
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 84.71
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin beta2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=5.4e-21  Score=215.35  Aligned_cols=226  Identities=18%  Similarity=0.148  Sum_probs=196.0

Q ss_pred             hHHHHHHHHHHHHHhCCcCcHHHHHHhhhhcCCCCChHHHHHHHHHHHHHHHHccccchhhHHHHHHHHHhhccCCChhH
Q 046417           35 TLPVATAELESIARTLTQDSFSSFLNCLQTTDSSSKSPVRKQCVNLLTLLSRSHGDSLSPHLSKMISTVSCRLRDPDSSV  114 (595)
Q Consensus        35 T~r~A~~~LD~lA~~L~~~~lp~fL~~L~d~~ss~kp~vRKaaI~lLG~lAEg~gd~I~PhLpkIL~~IvrrLkD~ds~V  114 (595)
                      .+++|+..|+.++..++.+.++.+++.|.+...+++|..|++++.+||.+++||.+.+.||+++++++++..|+|+++.|
T Consensus       373 ~r~~a~~~L~~l~~~~~~~il~~~l~~l~~~l~s~~~~~reaa~~alg~i~eg~~~~~~~~l~~li~~l~~~l~d~~~~V  452 (888)
T d1qbkb_         373 LRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALV  452 (888)
T ss_dssp             SHHHHHHHSTTTTTTCCSSSHHHHHHHHHHTTTSSSHHHHHHHHHHHHHHTTTSHHHHTTTHHHHHHHHHHHTTSSCHHH
T ss_pred             HHHHHHHHHhhHhhhhHHHHHHHHHHHHHHhhccchhHHHHHHHHHhhhhhhhHHHHhcccchhhhHHHHHhccCCCHHH
Confidence            68899999999999998888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhhhcCCcchhccHHHHHHHh---hcCChhHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHHhhccCc
Q 046417          115 RSACVAATTAMSLNITKPSFSVLSKPLIELIL---VEQDVNSQVGGAMCLAAAIDAAPNPEVEQLRKLLPRLGKAVRIEG  191 (595)
Q Consensus       115 R~Ac~~aLg~LA~~l~~~~~~~~l~PLi~aLl---~d~nk~VQ~~AA~cLaaviE~a~d~~~~~L~~Ll~rL~klL~~~~  191 (595)
                      |.++||+||+|+.|+.......++.+++..|+   .+.++.||.+||.||..++|.+.....||++.+++.|.++++...
T Consensus       453 r~~a~~~l~~~~~~~~~~~~~~~~~~~l~~ll~~l~d~~~~V~~~a~~al~~l~~~~~~~l~p~~~~il~~l~~~l~~~~  532 (888)
T d1qbkb_         453 RSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQ  532 (888)
T ss_dssp             HHHHHHHHHHTHHHHHSSCHHHHTTTHHHHHHHHHSSSCHHHHHHHHHHHHHHHHHHTTSSGGGHHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHHHHHHHhhhhhhhhhhhhhHHHHHHHhcCCCHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHhhhh
Confidence            99999999999999865432234555555443   478899999999999999999888888999999999999998887


Q ss_pred             hhHHHHHHHHHHHHHHhhccc--CcCcHHhHHHHHHHhcc--CCCHHHHHHHHHHHHHHHHHhHHhHHHHHHH
Q 046417          192 FKAKAAVLGVIGSVVRVGGAR--SKGVLDWLVPCLVEFLC--CDDWATRKAAAEVLGKVAVFDKDLATEYKRS  260 (595)
Q Consensus       192 ~kaK~alLsAIgSlA~a~g~~--~~~yl~~lmp~L~e~L~--~dDW~~RkaAaEaLgsIA~avge~f~py~~~  260 (595)
                      .+.+..+++++++++...+..  ...|++.++|.+.+.|.  .++-..+..+++||+.++.+.|+.|.||...
T Consensus       533 ~~~~~~~~~al~~l~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~le~l~~i~~~~~~~~~~~~~~  605 (888)
T d1qbkb_         533 HKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEP  605 (888)
T ss_dssp             HHHHHHHHHHHHHHHHHHGGGGCSHHHHHHHHHHHHHHHTTSCTTCTTHHHHHHHHHHHHHHSTTTTHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhhhccccchHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHhHHHHhhhHHH
Confidence            777888899999999866543  35788999999999885  2233456678999999999999888888755



>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure