Citrus Sinensis ID: 046469
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 521 | 2.2.26 [Sep-21-2011] | |||||||
| Q94F87 | 1295 | DNA (cytosine-5)-methyltr | yes | no | 0.869 | 0.349 | 0.600 | 1e-170 | |
| Q9AXT8 | 912 | DNA (cytosine-5)-methyltr | N/A | no | 0.838 | 0.479 | 0.464 | 1e-119 | |
| Q8LPU5 | 915 | DNA (cytosine-5)-methyltr | N/A | no | 0.825 | 0.469 | 0.459 | 1e-115 | |
| O49139 | 791 | Putative DNA (cytosine-5) | no | no | 0.857 | 0.565 | 0.427 | 1e-114 | |
| Q9ARI6 | 915 | DNA (cytosine-5)-methyltr | N/A | no | 0.825 | 0.469 | 0.457 | 1e-114 | |
| Q94F88 | 839 | DNA (cytosine-5)-methyltr | no | no | 0.869 | 0.539 | 0.442 | 1e-109 | |
| Q7Y1I7 | 1527 | DNA (cytosine-5)-methyltr | no | no | 0.203 | 0.069 | 0.453 | 4e-21 | |
| B1Q3J6 | 1529 | DNA (cytosine-5)-methyltr | no | no | 0.195 | 0.066 | 0.432 | 7e-20 | |
| P34881 | 1534 | DNA (cytosine-5)-methyltr | no | no | 0.195 | 0.066 | 0.451 | 1e-19 | |
| Q27746 | 1612 | DNA (cytosine-5)-methyltr | N/A | no | 0.195 | 0.063 | 0.413 | 9e-18 |
| >sp|Q94F87|CMT2_ARATH DNA (cytosine-5)-methyltransferase CMT2 OS=Arabidopsis thaliana GN=CMT2 PE=2 SV=3 | Back alignment and function desciption |
|---|
Score = 600 bits (1546), Expect = e-170, Method: Compositional matrix adjust.
Identities = 299/498 (60%), Positives = 360/498 (72%), Gaps = 45/498 (9%)
Query: 24 HGAYSDDDEDKIVSNVECHYAQARIGECIFDLGDCAYIKGEGTQKHIGKILEFFKTTDGE 83
G S+DDEDKIV+NVECHY+QA++ F LGD AYIKGE + H+G+I+EFFKTTDGE
Sbjct: 551 RGQQSEDDEDKIVANVECHYSQAKVDGHTFSLGDFAYIKGEEEETHVGQIVEFFKTTDGE 610
Query: 84 EYFRVQWFYRAEDTVMKEAADFHDRKRLFYSTVMNDNPVDCIISKVIVAQIPPKIGLKSN 143
YFRVQWFYRA DT+M+ A HD++RLFYSTVMNDNPVDC+ISKV V Q+ P++GLK N
Sbjct: 611 SYFRVQWFYRATDTIMERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRVGLKPN 670
Query: 144 SIPSSDFYFDMEYCVEYSTFRTLLTGKIHDLSLPSCTETVPTTATSTFFENMPNHGPHKA 203
SI SD+YFDMEYCVEYSTF+TL K + L C + VPT +T + + G
Sbjct: 671 SI-KSDYYFDMEYCVEYSTFQTLRNPKTSENKLECCADVVPTESTESILKKKSFSG---- 725
Query: 204 ELALLDLYSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAAE 263
EL +LDLYSGCGGMSTGL LGAK+S ++VT+WA+D + +AC+SLKLNHP QVRN+AA
Sbjct: 726 ELPVLDLYSGCGGMSTGLSLGAKISGVDVVTKWAVDQNTAACKSLKLNHPNTQVRNDAAG 785
Query: 264 DFLELVKEWQKLCKRFAVNIVERENKQRSMSQRVTRNSVNSPSITRNSVDSPKVTGNSVD 323
DFL+L+KEW KLCKR+ N N QR+ + R
Sbjct: 786 DFLQLLKEWDKLCKRYVFN-----NDQRTDTLR--------------------------- 813
Query: 324 SPRVTRSSVNSPRVTRNSVNSPRDVDIPPGEYEVARIVDICYGDPNESGKRGLNFKVHWK 383
SVNS + T S +S D EYEV ++VDIC+GD +++GK GL FKVHWK
Sbjct: 814 -------SVNSTKETSGSSSSSDDDSDSE-EYEVEKLVDICFGDHDKTGKNGLKFKVHWK 865
Query: 384 GYSTSEDSWEPIEGLRNCPERIKEFVRNGFKSKILPLPGDVDVICGGPPCQGISGYNRFR 443
GY + ED+WE E L NC + I+EFV +GFKSKILPLPG V VICGGPPCQGISGYNR R
Sbjct: 866 GYRSDEDTWELAEELSNCQDAIREFVTSGFKSKILPLPGRVGVICGGPPCQGISGYNRHR 925
Query: 444 NVDSPLDDERNRQIVIFMDIVEFLKPKYVLMENVVDILKFDKASLGRYALSRLVHMKYQA 503
NVDSPL+DERN+QI++FMDIVE+LKP YVLMENVVDIL+ DK SLGRYALSRLV+M+YQA
Sbjct: 926 NVDSPLNDERNQQIIVFMDIVEYLKPSYVLMENVVDILRMDKGSLGRYALSRLVNMRYQA 985
Query: 504 RFGIIAAGCYGLPQFRLR 521
R GI+ AGCYGL QFR R
Sbjct: 986 RLGIMTAGCYGLSQFRSR 1003
|
May be involved in the CpXpG methylation and in gene silencing. Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7 |
| >sp|Q9AXT8|CMT1_MAIZE DNA (cytosine-5)-methyltransferase 1 OS=Zea mays GN=MET2A PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8LPU5|CMT3_MAIZE DNA (cytosine-5)-methyltransferase 3 OS=Zea mays GN=DMT105 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O49139|CMT1_ARATH Putative DNA (cytosine-5)-methyltransferase CMT1 OS=Arabidopsis thaliana GN=CMT1 PE=5 SV=2 | Back alignment and function description |
|---|
| >sp|Q9ARI6|CMT2_MAIZE DNA (cytosine-5)-methyltransferase 2 OS=Zea mays GN=ZMET5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q94F88|CMT3_ARATH DNA (cytosine-5)-methyltransferase CMT3 OS=Arabidopsis thaliana GN=CMT3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q7Y1I7|DNM1A_ORYSJ DNA (cytosine-5)-methyltransferase 1A OS=Oryza sativa subsp. japonica GN=MET1A PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|B1Q3J6|DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica GN=MET1B PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P34881|DNMT1_ARATH DNA (cytosine-5)-methyltransferase 1 OS=Arabidopsis thaliana GN=DMT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q27746|DNMT1_PARLI DNA (cytosine-5)-methyltransferase PliMCI OS=Paracentrotus lividus GN=DNMT PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 521 | ||||||
| 224071435 | 729 | DNA methyltransferase [Populus trichocar | 0.856 | 0.611 | 0.690 | 0.0 | |
| 359474666 | 1789 | PREDICTED: uncharacterized protein LOC10 | 0.892 | 0.259 | 0.639 | 0.0 | |
| 255557861 | 734 | protein with unknown function [Ricinus c | 0.819 | 0.581 | 0.677 | 0.0 | |
| 356560887 | 1143 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.865 | 0.394 | 0.626 | 1e-179 | |
| 449456909 | 1243 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.848 | 0.355 | 0.622 | 1e-179 | |
| 296088422 | 729 | unnamed protein product [Vitis vinifera] | 0.806 | 0.576 | 0.665 | 1e-179 | |
| 297737359 | 847 | unnamed protein product [Vitis vinifera] | 0.865 | 0.532 | 0.597 | 1e-169 | |
| 42566945 | 1295 | chromomethylase 2 [Arabidopsis thaliana] | 0.869 | 0.349 | 0.600 | 1e-169 | |
| 297804242 | 1253 | chromomethylase 2 [Arabidopsis lyrata su | 0.869 | 0.361 | 0.608 | 1e-167 | |
| 226088552 | 749 | chromomethylase OsMET2c [Oryza sativa Ja | 0.848 | 0.590 | 0.517 | 1e-142 |
| >gi|224071435|ref|XP_002303458.1| DNA methyltransferase [Populus trichocarpa] gi|222840890|gb|EEE78437.1| DNA methyltransferase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 695 bits (1793), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 342/495 (69%), Positives = 384/495 (77%), Gaps = 49/495 (9%)
Query: 27 YSDDDEDKIVSNVECHYAQARIGECIFDLGDCAYIKGEGTQKHIGKILEFFKTTDGEEYF 86
+SDDDEDK+V NVECHY QA I I +LGDC Y+KGEG + HIG ILEFFKTTD E+YF
Sbjct: 2 FSDDDEDKVVWNVECHYTQANIEGRIINLGDCVYVKGEGAKNHIGSILEFFKTTDREDYF 61
Query: 87 RVQWFYRAEDTVMKEAADFHDRKRLFYSTVMNDNPVDCIISKVIVAQIPPKIGLKSNSIP 146
RVQWFYRAEDTVMKEAADFHD KRLFYSTVMNDNP+DCIISKV V QI P++ LK +S P
Sbjct: 62 RVQWFYRAEDTVMKEAADFHDNKRLFYSTVMNDNPIDCIISKVTVVQISPRVHLKFHSTP 121
Query: 147 SSDFYFDMEYCVEYSTFRTLLTGKIHDLSLPSCTETVPTTATSTFFENMPNHGPHKAELA 206
+SDFYFDMEYCV+YSTFRTLLTGK +L+ T+ + ENM G +KA+L
Sbjct: 122 ASDFYFDMEYCVDYSTFRTLLTGK--NLNSTPGTDDIS-------MENMSTCGSYKAKLT 172
Query: 207 LLDLYSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAAEDFL 266
LLDL+SGCGGMSTGLCLGAK+SC +LVTRWALDSD+SAC+SLKLNHPE VRNEAAEDFL
Sbjct: 173 LLDLFSGCGGMSTGLCLGAKVSCVDLVTRWALDSDESACQSLKLNHPETHVRNEAAEDFL 232
Query: 267 ELVKEWQKLCKRFAVNIVERENKQRSMSQRVTRNSVNSPSITRNSVDSPKVTGNSVDSPR 326
EL+KEWQKLCKR+AVN V R +K RSM+ +++ + NS +
Sbjct: 233 ELLKEWQKLCKRYAVNDVGRTHKSRSMASSMSKQNKNSSN-------------------- 272
Query: 327 VTRSSVNSPRVTRNSVNSPRDVDIPPGEYEVARIVDICYGDPNESGKRGLNFKVHWKGYS 386
D DI GEYEVAR+VDICYG ++ GKRGL FKVHWKGYS
Sbjct: 273 --------------------DDDIASGEYEVARLVDICYGKTDKRGKRGLKFKVHWKGYS 312
Query: 387 TSEDSWEPIEGLRNCPERIKEFVRNGFKSKILPLPGDVDVICGGPPCQGISGYNRFRNVD 446
TSEDSWEPIEGL NC I++FVR GFKSKILPLPGD DVICGGPPCQGISGYNR+RNVD
Sbjct: 313 TSEDSWEPIEGLSNCEHSIRDFVREGFKSKILPLPGDADVICGGPPCQGISGYNRYRNVD 372
Query: 447 SPLDDERNRQIVIFMDIVEFLKPKYVLMENVVDILKFDKASLGRYALSRLVHMKYQARFG 506
SPL DERN QIV+FMDIV+FLKPKYVLMENVVDIL+FDKAS RYALSRLVHMKYQAR G
Sbjct: 373 SPLADERNIQIVVFMDIVQFLKPKYVLMENVVDILRFDKASFARYALSRLVHMKYQARLG 432
Query: 507 IIAAGCYGLPQFRLR 521
+AAGCYGLPQFRLR
Sbjct: 433 TVAAGCYGLPQFRLR 447
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359474666|ref|XP_002267685.2| PREDICTED: uncharacterized protein LOC100255190 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255557861|ref|XP_002519960.1| protein with unknown function [Ricinus communis] gi|223541006|gb|EEF42564.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356560887|ref|XP_003548718.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449456909|ref|XP_004146191.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis sativus] gi|449512953|ref|XP_004164187.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296088422|emb|CBI37413.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737359|emb|CBI26560.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|42566945|ref|NP_193637.2| chromomethylase 2 [Arabidopsis thaliana] gi|322510132|sp|Q94F87.3|CMT2_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT2; AltName: Full=Chromomethylase 2; AltName: Full=Protein CHROMOMETHYLASE 2 gi|332658726|gb|AEE84126.1| chromomethylase 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297804242|ref|XP_002870005.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata] gi|297315841|gb|EFH46264.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|226088552|dbj|BAH37021.1| chromomethylase OsMET2c [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 521 | ||||||
| TAIR|locus:2117104 | 1295 | CMT2 "chromomethylase 2" [Arab | 0.537 | 0.216 | 0.588 | 2.4e-161 | |
| TAIR|locus:2025787 | 791 | CMT1 "chromomethylase 1" [Arab | 0.332 | 0.218 | 0.566 | 1.8e-112 | |
| TAIR|locus:2205015 | 839 | CMT3 "chromomethylase 3" [Arab | 0.324 | 0.201 | 0.611 | 1.1e-103 | |
| UNIPROTKB|Q7Y1I7 | 1527 | MET1A "DNA (cytosine-5)-methyl | 0.203 | 0.069 | 0.453 | 1.1e-25 | |
| TAIR|locus:2122313 | 1512 | AT4G08990 [Arabidopsis thalian | 0.195 | 0.067 | 0.423 | 7.4e-24 | |
| TAIR|locus:2155959 | 1534 | MET1 "methyltransferase 1" [Ar | 0.195 | 0.066 | 0.451 | 1e-23 | |
| TAIR|locus:2140892 | 1404 | MEE57 "maternal effect embryo | 0.195 | 0.072 | 0.423 | 2e-23 | |
| UNIPROTKB|F1S3I5 | 1611 | DNMT1 "Cytosine-specific methy | 0.195 | 0.063 | 0.413 | 3.2e-23 | |
| UNIPROTKB|Q24K09 | 1611 | DNMT1 "DNA (cytosine-5)-methyl | 0.195 | 0.063 | 0.413 | 2.1e-22 | |
| UNIPROTKB|Q92072 | 1537 | DNMT1 "DNA (cytosine-5)-methyl | 0.195 | 0.066 | 0.403 | 2.5e-22 |
| TAIR|locus:2117104 CMT2 "chromomethylase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 887 (317.3 bits), Expect = 2.4e-161, Sum P(2) = 2.4e-161
Identities = 169/287 (58%), Positives = 214/287 (74%)
Query: 28 SDDDEDKIVSNVECHYAQARIGECIFDLGDCAYIKGEGTQKHIGKILEFFKTTDGEEYFR 87
S+DDEDKIV+NVECHY+QA++ F LGD AYIKGE + H+G+I+EFFKTTDGE YFR
Sbjct: 555 SEDDEDKIVANVECHYSQAKVDGHTFSLGDFAYIKGEEEETHVGQIVEFFKTTDGESYFR 614
Query: 88 VQWFYRAEDTVMKEAADFHDRKRLFYSTVMNDNPVDCIISKVIVAQIPPKIGLKSNSIPS 147
VQWFYRA DT+M+ A HD++RLFYSTVMNDNPVDC+ISKV V Q+ P++GLK NSI
Sbjct: 615 VQWFYRATDTIMERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRVGLKPNSI-K 673
Query: 148 SDFYFDMEYCVEYSTFRTLLTGKIHDLSLPSCTETVPTTATSTFFENMPNHGPHKAELAL 207
SD+YFDMEYCVEYSTF+TL K + L C + VPT +T + + G EL +
Sbjct: 674 SDYYFDMEYCVEYSTFQTLRNPKTSENKLECCADVVPTESTESILKKKSFSG----ELPV 729
Query: 208 LDLYSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAAEDFLE 267
LDLYSGCGGMSTGL LGAK+S ++VT+WA+D + +AC+SLKLNHP QVRN+AA DFL+
Sbjct: 730 LDLYSGCGGMSTGLSLGAKISGVDVVTKWAVDQNTAACKSLKLNHPNTQVRNDAAGDFLQ 789
Query: 268 LVKEWQKLCKRFAVNIVERENKQRSMSQRVTRNSVNSPSITRNSVDS 314
L+KEW KLCKR+ N +R + RS++ T+ + S S + + DS
Sbjct: 790 LLKEWDKLCKRYVFNNDQRTDTLRSVNS--TKETSGSSSSSDDDSDS 834
|
|
| TAIR|locus:2025787 CMT1 "chromomethylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205015 CMT3 "chromomethylase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Y1I7 MET1A "DNA (cytosine-5)-methyltransferase 1A" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122313 AT4G08990 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155959 MET1 "methyltransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140892 MEE57 "maternal effect embryo arrest 57" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3I5 DNMT1 "Cytosine-specific methyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q24K09 DNMT1 "DNA (cytosine-5)-methyltransferase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92072 DNMT1 "DNA (cytosine-5)-methyltransferase 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.1.37 | 0.737 |
| 3rd Layer | 2.1.1 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 521 | |||
| cd04716 | 122 | cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho | 3e-51 | |
| smart00439 | 121 | smart00439, BAH, Bromo adjacent homology domain | 3e-24 | |
| cd04370 | 123 | cd04370, BAH, BAH, or Bromo Adjacent Homology doma | 2e-20 | |
| pfam01426 | 120 | pfam01426, BAH, BAH domain | 4e-16 | |
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 3e-15 | |
| cd00024 | 55 | cd00024, CHROMO, Chromatin organization modifier ( | 4e-13 | |
| smart00298 | 55 | smart00298, CHROMO, Chromatin organization modifie | 1e-12 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 2e-11 | |
| pfam00385 | 52 | pfam00385, Chromo, Chromo (CHRromatin Organisation | 6e-11 | |
| pfam00145 | 320 | pfam00145, DNA_methylase, C-5 cytosine-specific DN | 1e-10 | |
| cd04717 | 121 | cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom | 1e-10 | |
| TIGR00675 | 315 | TIGR00675, dcm, DNA-methyltransferase (dcm) | 6e-09 | |
| cd04713 | 146 | cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol | 2e-06 | |
| cd04760 | 124 | cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homol | 9e-06 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 2e-05 | |
| cd04714 | 121 | cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo | 2e-05 | |
| cd04712 | 130 | cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homolog | 6e-05 | |
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 4e-04 | |
| cd04715 | 159 | cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Ho | 0.002 |
| >gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
Score = 170 bits (433), Expect = 3e-51
Identities = 66/118 (55%), Positives = 86/118 (72%), Gaps = 3/118 (2%)
Query: 52 IFDLGDCAYIKG-EGTQKHIGKILEFFKTTDGEEYFRVQWFYRAEDTVMKEAADFHDRKR 110
++LGD AY++G EG + I KI EFF+ TDG+ YF QWFYRAEDTV++ A HD+KR
Sbjct: 3 TYNLGDDAYVQGGEGEEPFICKITEFFEGTDGKTYFTAQWFYRAEDTVIERQATNHDKKR 62
Query: 111 LFYSTVMNDNPVDCIISKVIVAQIPPKIGLKSNS--IPSSDFYFDMEYCVEYSTFRTL 166
+FYS + NDNP+DC+ISKV + Q+PP +G K D+Y+DMEYCV YSTF+TL
Sbjct: 63 VFYSEIKNDNPLDCLISKVKILQVPPNVGTKRKKPNSEKCDYYYDMEYCVPYSTFQTL 120
|
DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the genome. These effects include transcriptional repression via inhibition of transcription factor binding, the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting, and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 122 |
| >gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >gnl|CDD|216495 pfam01426, BAH, BAH domain | Back alignment and domain information |
|---|
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus | Back alignment and domain information |
|---|
| >gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain | Back alignment and domain information |
|---|
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|215889 pfam00385, Chromo, Chromo (CHRromatin Organisation MOdifier) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|233085 TIGR00675, dcm, DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240107 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240063 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240066 cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 521 | |||
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 100.0 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 100.0 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 100.0 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 100.0 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 100.0 | |
| cd04708 | 202 | BAH_plantDCM_II BAH, or Bromo Adjacent Homology do | 100.0 | |
| cd04716 | 122 | BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom | 99.97 | |
| cd04713 | 146 | BAH_plant_3 BAH, or Bromo Adjacent Homology domain | 99.94 | |
| cd04717 | 121 | BAH_polybromo BAH, or Bromo Adjacent Homology doma | 99.94 | |
| cd04709 | 164 | BAH_MTA BAH, or Bromo Adjacent Homology domain, as | 99.93 | |
| cd04714 | 121 | BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, | 99.92 | |
| cd04710 | 135 | BAH_fungalPHD BAH, or Bromo Adjacent Homology doma | 99.92 | |
| PF01426 | 119 | BAH: BAH domain; InterPro: IPR001025 The BAH (brom | 99.91 | |
| smart00439 | 120 | BAH Bromo adjacent homology domain. | 99.91 | |
| cd04370 | 123 | BAH BAH, or Bromo Adjacent Homology domain (also c | 99.91 | |
| cd04715 | 159 | BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom | 99.9 | |
| cd04760 | 124 | BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain | 99.89 | |
| cd04721 | 130 | BAH_plant_1 BAH, or Bromo Adjacent Homology domain | 99.87 | |
| cd04712 | 130 | BAH_DCM_I BAH, or Bromo Adjacent Homology domain, | 99.86 | |
| cd04711 | 137 | BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai | 99.84 | |
| KOG0919 | 338 | consensus C-5 cytosine-specific DNA methylase [Tra | 99.84 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 99.82 | |
| cd04720 | 179 | BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do | 99.74 | |
| cd04719 | 128 | BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d | 99.71 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 99.53 | |
| KOG1886 | 464 | consensus BAH domain proteins [Transcription] | 99.47 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 99.1 | |
| PF00385 | 55 | Chromo: Chromo (CHRromatin Organisation MOdifier) | 97.22 | |
| cd00024 | 55 | CHROMO Chromatin organization modifier (chromo) do | 97.16 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 96.96 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 96.91 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 96.91 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 96.74 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 96.68 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 96.56 | |
| KOG1911 | 270 | consensus Heterochromatin-associated protein HP1 a | 96.55 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 96.27 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 96.07 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 96.0 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 95.73 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 95.73 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 95.65 | |
| smart00298 | 55 | CHROMO Chromatin organization modifier domain. | 95.61 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 95.57 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 95.56 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 95.54 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 95.26 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 95.25 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 94.99 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 94.99 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 94.79 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 94.74 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 94.69 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 94.65 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 94.25 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 94.25 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 94.05 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 93.85 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 93.84 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 93.59 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 93.13 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 92.85 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 92.83 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 92.82 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 92.47 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 92.24 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 92.19 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 91.99 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 91.75 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 91.57 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 90.96 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 90.19 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 89.52 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 89.42 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 89.31 | |
| KOG1227 | 351 | consensus Putative methyltransferase [General func | 89.11 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 89.1 | |
| KOG2078 | 495 | consensus tRNA modification enzyme [RNA processing | 89.02 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 88.32 | |
| KOG2748 | 369 | consensus Uncharacterized conserved protein, conta | 88.29 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 88.24 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 88.19 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 87.74 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 87.64 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 86.98 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 86.88 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 86.72 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 86.63 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 86.16 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 86.13 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 85.89 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 85.52 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 85.3 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 85.12 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 85.12 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 85.09 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 84.53 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 84.42 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 84.29 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 84.28 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 84.11 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 83.95 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 83.79 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 83.59 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 83.49 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 82.89 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 82.74 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 82.36 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 82.28 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 82.05 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 81.91 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 81.74 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 81.36 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 81.24 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 80.97 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 80.66 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 80.49 | |
| PRK04266 | 226 | fibrillarin; Provisional | 80.48 | |
| PF11599 | 246 | AviRa: RRNA methyltransferase AviRa; InterPro: IPR | 80.42 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 80.27 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 80.12 |
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-39 Score=329.35 Aligned_cols=155 Identities=38% Similarity=0.637 Sum_probs=132.5
Q ss_pred ccEEeeeccCChhhHHHHHhhhhcCCcceEEEEEcCCHHHHHHHHHcCCCCceeecchHHHHHHHHHHHHHhhhhhhhhh
Q 046469 205 LALLDLYSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAAEDFLELVKEWQKLCKRFAVNIV 284 (521)
Q Consensus 205 l~vldLFsG~GG~s~Gl~~g~~~aG~~~~~~~avd~d~~a~~t~~~N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 284 (521)
++++||||||||+++||+ +||++ ++||+|+|+.|++||++||| .+.+.|+.++..-
T Consensus 1 ~~~~dlFsG~Gg~~~g~~----~ag~~--~~~a~e~~~~a~~~y~~N~~--~~~~~Di~~~~~~---------------- 56 (335)
T PF00145_consen 1 MKVIDLFSGIGGFSLGLE----QAGFE--VVWAVEIDPDACETYKANFP--EVICGDITEIDPS---------------- 56 (335)
T ss_dssp EEEEEET-TTTHHHHHHH----HTTEE--EEEEEESSHHHHHHHHHHHT--EEEESHGGGCHHH----------------
T ss_pred CcEEEEccCccHHHHHHH----hcCcE--EEEEeecCHHHHHhhhhccc--ccccccccccccc----------------
Confidence 589999999999999998 89955 99999999999999999999 7778887755410
Q ss_pred hhhhhhhcccccccccCCCCCCccccCCCCCCccCCCCCCCcccccccCCCccccCCCCCCCCCCCCCCcceeeeEeeee
Q 046469 285 ERENKQRSMSQRVTRNSVNSPSITRNSVDSPKVTGNSVDSPRVTRSSVNSPRVTRNSVNSPRDVDIPPGEYEVARIVDIC 364 (521)
Q Consensus 285 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~~~ 364 (521)
T Consensus 57 -------------------------------------------------------------------------------- 56 (335)
T PF00145_consen 57 -------------------------------------------------------------------------------- 56 (335)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred cCCCCcccCCcceeEEEEccCCCCCCCcccccccCCChhhHHHHHhcccccccCCCCCCcceeecCCCCcCccccCCcCC
Q 046469 365 YGDPNESGKRGLNFKVHWKGYSTSEDSWEPIEGLRNCPERIKEFVRNGFKSKILPLPGDVDVICGGPPCQGISGYNRFRN 444 (521)
Q Consensus 365 ~g~~~~~~~~~l~~~v~w~gy~~~~d~~ep~e~~~~~~~~I~~~v~~~~~~~~~~~~~~vDlL~ggpPCQ~fS~an~~~~ 444 (521)
.++ +++|||+||||||+||.||+.
T Consensus 57 ----------------------------------------------------~l~--~~~D~l~ggpPCQ~fS~ag~~-- 80 (335)
T PF00145_consen 57 ----------------------------------------------------DLP--KDVDLLIGGPPCQGFSIAGKR-- 80 (335)
T ss_dssp ----------------------------------------------------HHH--HT-SEEEEE---TTTSTTSTH--
T ss_pred ----------------------------------------------------ccc--ccceEEEeccCCceEeccccc--
Confidence 000 136999999999999999963
Q ss_pred CCCCCcccchhhHHHHHHHHhhcCCcEEEEecccchhccCcchHHHHHHHHHhcCCCeEEEEEEecCCCCCCCCCCC
Q 046469 445 VDSPLDDERNRQIVIFMDIVEFLKPKYVLMENVVDILKFDKASLGRYALSRLVHMKYQARFGIIAAGCYGLPQFRLR 521 (521)
Q Consensus 445 ~~~~~~d~r~~L~~~~lrii~~~rP~~~l~ENV~gl~~~~~~~~~~~il~~l~~lGY~v~~~vlna~~yGvPQ~R~R 521 (521)
++.+|+|+.|+++++++|+.++|++||||||+||++.+++..++.+++.|.++||++.+.+|||++||+||+|+|
T Consensus 81 --~~~~d~r~~L~~~~~~~v~~~~Pk~~~~ENV~~l~~~~~~~~~~~i~~~l~~lGY~v~~~vlna~~yGvPQ~R~R 155 (335)
T PF00145_consen 81 --KGFDDPRNSLFFEFLRIVKELKPKYFLLENVPGLLSSKNGEVFKEILEELEELGYNVQWRVLNAADYGVPQNRER 155 (335)
T ss_dssp --HCCCCHTTSHHHHHHHHHHHHS-SEEEEEEEGGGGTGGGHHHHHHHHHHHHHTTEEEEEEEEEGGGGTSSBE-EE
T ss_pred --cccccccchhhHHHHHHHhhccceEEEecccceeeccccccccccccccccccceeehhccccHhhCCCCCceee
Confidence 456899999999999999999999999999999999988889999999999999999999999999999999998
|
1.1.37 from EC) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine [, , ]. In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA [, ]. The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A []: the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.; GO: 0003677 DNA binding, 0006306 DNA methylation; PDB: 4DA4_A 3PT6_B 3AV6_A 3AV5_A 3AV4_A 3PT9_A 1DCT_A 3LX6_A 3ME5_A 2QRV_A .... |
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins | Back alignment and domain information |
|---|
| >cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
| >cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation | Back alignment and domain information |
|---|
| >smart00439 BAH Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
| >cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p | Back alignment and domain information |
|---|
| >cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1886 consensus BAH domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation | Back alignment and domain information |
|---|
| >cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >KOG1911 consensus Heterochromatin-associated protein HP1 and related CHROMO domain proteins [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >smart00298 CHROMO Chromatin organization modifier domain | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1227 consensus Putative methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2078 consensus tRNA modification enzyme [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >KOG2748 consensus Uncharacterized conserved protein, contains chromo domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 521 | ||||
| 4ft2_A | 784 | Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 | 1e-120 | ||
| 4fsx_A | 784 | Crystal Structure Of Se-Substituted Zea Mays Zmet2 | 1e-115 | ||
| 3swr_A | 1002 | Structure Of Human Dnmt1 (601-1600) In Complex With | 1e-18 | ||
| 3pta_A | 956 | Crystal Structure Of Human Dnmt1(646-1600) In Compl | 2e-18 | ||
| 3av4_A | 1330 | Crystal Structure Of Mouse Dna Methyltransferase 1 | 4e-18 | ||
| 3pt6_A | 954 | Crystal Structure Of Mouse Dnmt1(650-1602) In Compl | 5e-18 | ||
| 3pt9_A | 873 | Crystal Structure Of Mouse Dnmt1(731-1602) In The F | 6e-18 | ||
| 3g7u_A | 376 | Crystal Structure Of Putative Dna Modification Meth | 1e-05 | ||
| 4hae_A | 81 | Crystal Structure Of The Cdyl2-Chromodomain Length | 1e-05 | ||
| 2dnt_A | 78 | Solution Structure Of Rsgi Ruh-064, A Chromo Domain | 3e-05 | ||
| 2uyh_A | 327 | Hhai Dna Methyltransferase S87q-Q237s Mutant Comple | 1e-04 | ||
| 3qo2_A | 64 | Structural Insights For Mpp8 Chromodomain Interacti | 1e-04 | ||
| 1svu_A | 327 | Structure Of The Q237w Mutant Of Hhai Dna Methyltra | 2e-04 | ||
| 3lwe_A | 62 | The Crystal Structure Of Mpp8 Length = 62 | 2e-04 | ||
| 1mht_A | 327 | Covalent Ternary Structure Of Hhai Methyltransferas | 2e-04 | ||
| 1fjx_A | 327 | Structure Of Ternary Complex Of Hhai Methyltransfer | 2e-04 | ||
| 2i9k_A | 327 | Engineered Extrahelical Base Destabilization Enhanc | 3e-04 | ||
| 2uz4_A | 327 | Hhai Dna Methyltransferase R165n Mutant Complex Wit | 4e-04 | ||
| 2z6q_A | 327 | Ternary Structure Of Arg165ala M.Hhai C5-Cytosine D | 4e-04 | ||
| 2zcj_A | 327 | Ternary Structure Of The Glu119gln M.Hhai, C5-Cytos | 4e-04 | ||
| 2uyc_A | 327 | Hhai Dna Methyltransferase R163n Mutant Complex Wit | 6e-04 |
| >pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 Peptide And Sah Length = 784 | Back alignment and structure |
|
| >pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In Complex With Sah Length = 784 | Back alignment and structure |
| >pdb|3SWR|A Chain A, Structure Of Human Dnmt1 (601-1600) In Complex With Sinefungin Length = 1002 | Back alignment and structure |
| >pdb|3PTA|A Chain A, Crystal Structure Of Human Dnmt1(646-1600) In Complex With Dna Length = 956 | Back alignment and structure |
| >pdb|3AV4|A Chain A, Crystal Structure Of Mouse Dna Methyltransferase 1 Length = 1330 | Back alignment and structure |
| >pdb|3PT6|A Chain A, Crystal Structure Of Mouse Dnmt1(650-1602) In Complex With Dna Length = 954 | Back alignment and structure |
| >pdb|3PT9|A Chain A, Crystal Structure Of Mouse Dnmt1(731-1602) In The Free State Length = 873 | Back alignment and structure |
| >pdb|3G7U|A Chain A, Crystal Structure Of Putative Dna Modification Methyltransferase Encoded Within Prophage Cp-933r (E.Coli) Length = 376 | Back alignment and structure |
| >pdb|4HAE|A Chain A, Crystal Structure Of The Cdyl2-Chromodomain Length = 81 | Back alignment and structure |
| >pdb|2DNT|A Chain A, Solution Structure Of Rsgi Ruh-064, A Chromo Domain From Human Cdna Length = 78 | Back alignment and structure |
| >pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|3QO2|A Chain A, Structural Insights For Mpp8 Chromodomain Interaction With Histone H3 Lysine 9 Length = 64 | Back alignment and structure |
| >pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 | Back alignment and structure |
| >pdb|3LWE|A Chain A, The Crystal Structure Of Mpp8 Length = 62 | Back alignment and structure |
| >pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine Length = 327 | Back alignment and structure |
| >pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 | Back alignment and structure |
| >pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
| >pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 | Back alignment and structure |
| >pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
Score = 137 bits (346), Expect = 1e-34
Identities = 48/217 (22%), Positives = 77/217 (35%), Gaps = 18/217 (8%)
Query: 69 HIGKILEFFKTTDGEE-------YFRVQWFYRAEDTVMKEAADFH-DRKRLFYSTVMNDN 120
IG+I E F RV FYR E+T A +H D L++S
Sbjct: 394 RIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVV 453
Query: 121 PVDCIISKVIVAQIP--PKIGLKSNSIPSSDFYFDMEYCVEYSTFRTL-LTGKIHDLSLP 177
+ + V P+ + + FYF Y + +F +
Sbjct: 454 DFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGK 513
Query: 178 SCTETVPTTATSTFFENMPNHGPHKAELALLDLYSGCGGMSTGLCL-GAKLSCTNLVTRW 236
+ + + P +L LD++SGCGG+S G G T W
Sbjct: 514 GKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGIS------DTLW 567
Query: 237 ALDSDKSACESLKLNHPEAQVRNEAAEDFLELVKEWQ 273
A++ A ++ +LN+P + V E L+LV +
Sbjct: 568 AIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGE 604
|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 | Back alignment and structure |
|---|
| >1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Length = 70 | Back alignment and structure |
|---|
| >3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} PDB: 3r93_A* 3svm_A* 3qo2_A* Length = 62 | Back alignment and structure |
|---|
| >2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Length = 78 | Back alignment and structure |
|---|
| >3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Length = 61 | Back alignment and structure |
|---|
| >3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Length = 55 | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 | Back alignment and structure |
|---|
| >3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Length = 59 | Back alignment and structure |
|---|
| >1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Length = 69 | Back alignment and structure |
|---|
| >1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Length = 73 | Back alignment and structure |
|---|
| >2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Length = 73 | Back alignment and structure |
|---|
| >2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Length = 64 | Back alignment and structure |
|---|
| >3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} PDB: 2k28_A 3i8z_A Length = 54 | Back alignment and structure |
|---|
| >2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 72 | Back alignment and structure |
|---|
| >2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Length = 74 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 55 | Back alignment and structure |
|---|
| >3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} PDB: 3gv6_A* 3i90_A* Length = 54 | Back alignment and structure |
|---|
| >2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 230 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 521 | |||
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 100.0 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 100.0 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 100.0 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 100.0 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 100.0 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 100.0 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 100.0 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 100.0 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 100.0 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 100.0 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 100.0 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 99.98 | |
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 99.95 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 99.9 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 99.9 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.88 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.86 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 99.76 | |
| 2fl7_A | 232 | Regulatory protein SIR3; ORC, silencing, chromatin | 98.96 | |
| 1m4z_A | 238 | Origin recognition complex subunit 1; DNA replicat | 98.9 | |
| 2rso_A | 92 | Chromatin-associated protein SWI6; chromodomain, s | 98.62 | |
| 3f2u_A | 55 | Chromobox protein homolog 1; human chromobox homol | 98.32 | |
| 2rsn_A | 75 | Chromo domain-containing protein 1; chromodomain, | 98.29 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 98.29 | |
| 3fdt_A | 59 | Chromobox protein homolog 5; chromobox homolog5, C | 98.25 | |
| 3lwe_A | 62 | M-phase phosphoprotein 8; MPP8, structural genomic | 98.23 | |
| 1g6z_A | 70 | CLR4 protein; transferase; NMR {Schizosaccharomyce | 98.22 | |
| 1ap0_A | 73 | Modifier protein 1; chromatin-binding, protein int | 98.16 | |
| 1q3l_A | 69 | Heterochromatin protein 1; chromodomain, HP1, chro | 98.13 | |
| 2dnt_A | 78 | Chromodomain protein, Y chromosome-like, isoform B | 98.08 | |
| 3i91_A | 54 | Chromobox protein homolog 8; chromobox homolog 8, | 98.08 | |
| 3g7l_A | 61 | Chromo domain-containing protein 1; chromodomain, | 98.06 | |
| 2k1b_A | 73 | Chromobox protein homolog 7; alpha/beta protein, c | 98.0 | |
| 3h91_A | 54 | Chromobox protein homolog 2; human chromobox homol | 98.0 | |
| 1pfb_A | 55 | Polycomb protein; chromatin, histone methylation, | 98.0 | |
| 1pdq_A | 72 | Polycomb protein; methyllysine, chromodomain, poly | 97.98 | |
| 2dnv_A | 64 | Chromobox protein homolog 8; chromo domain, histon | 97.97 | |
| 2d9u_A | 74 | Chromobox protein homolog 2 (isoform 2); chromobox | 97.95 | |
| 4hae_A | 81 | CDY-like 2, chromodomain Y-like protein 2; protein | 97.93 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 97.84 | |
| 3mts_A | 64 | Histone-lysine N-methyltransferase SUV39H1; histon | 97.77 | |
| 2kvm_A | 74 | Chromobox protein homolog 7; histone modification, | 97.76 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 97.13 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 96.85 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 96.82 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 96.82 | |
| 2epb_A | 68 | Chromodomain-helicase-DNA-binding protein 6; struc | 96.8 | |
| 1x3p_A | 54 | Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot | 96.79 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 96.53 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 96.5 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 96.48 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 96.4 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 96.37 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 96.29 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 96.21 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.2 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 95.95 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 95.89 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 95.83 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 95.72 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 95.7 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 95.61 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 95.51 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 95.41 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 95.39 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 95.36 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 95.33 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 95.07 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 95.01 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 94.91 | |
| 2ee1_A | 64 | Chromodomain helicase-DNA-binding protein 4; EC 3. | 94.82 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 94.57 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 94.27 | |
| 2b2y_C | 115 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 94.09 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 93.87 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 93.61 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 93.49 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 93.25 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 93.21 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 93.18 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 93.17 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 92.95 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 92.93 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 92.86 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 92.66 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 92.6 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 92.57 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 92.43 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 92.41 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 92.32 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 91.78 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 91.77 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 91.76 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 91.71 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 91.51 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 91.47 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 91.47 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 91.44 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 91.4 | |
| 2h1e_A | 177 | Chromo domain protein 1; CHD1, tandem chromodomain | 91.38 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 91.3 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 91.13 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 90.79 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 90.69 | |
| 2b2y_A | 187 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 90.64 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 90.57 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 90.19 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 90.16 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 90.07 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 90.04 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 90.02 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 89.96 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 89.93 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 89.8 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 89.71 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 89.62 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 89.56 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 89.34 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 89.31 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 89.18 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 89.14 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 89.14 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 89.04 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 88.65 | |
| 2b2y_A | 187 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 88.61 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 88.53 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 88.43 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 88.38 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 88.25 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 88.24 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 88.23 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 88.2 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 88.1 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 88.09 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 87.88 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 87.77 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 87.72 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 87.62 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 87.6 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 87.44 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 87.44 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 87.39 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 87.35 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 87.35 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 87.31 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 87.23 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 87.23 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 87.18 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 87.11 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 87.08 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 86.99 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 86.98 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 86.91 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 86.88 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 86.81 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 86.77 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 86.74 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 86.72 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 86.67 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 86.64 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 86.63 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 86.63 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 86.62 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 86.52 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 86.46 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 86.45 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 86.4 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 86.33 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 86.31 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 86.31 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 86.27 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 86.11 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 86.09 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 85.92 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 85.91 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 85.91 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 85.83 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 85.8 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 85.77 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 85.54 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 85.39 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 85.36 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 85.35 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 85.33 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 85.1 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 85.04 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 85.04 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 85.01 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 84.97 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 84.83 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 84.64 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 84.5 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 84.49 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 84.29 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 84.22 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 83.82 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 83.81 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 83.81 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 83.57 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 83.47 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 83.34 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 83.26 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 83.06 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 82.99 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 82.97 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 82.94 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 82.86 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 82.83 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 82.39 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 82.2 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 82.18 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 82.17 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 82.15 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 82.13 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 82.05 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 81.99 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 81.9 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 81.9 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 81.88 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 81.74 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 81.64 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 81.57 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 81.44 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 81.39 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 81.36 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 81.25 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 81.21 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 81.05 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 80.71 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 80.46 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 80.39 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 80.28 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 80.05 |
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-74 Score=658.64 Aligned_cols=428 Identities=51% Similarity=0.955 Sum_probs=346.5
Q ss_pred ccCcceeEEEEEECCEEEeCCCEEEEec-CCCccEEEEEeEEeeCCCCeEEEEEEEEeecccccccc------ccCCCCc
Q 046469 36 VSNVECHYAQARIGECIFDLGDCAYIKG-EGTQKHIGKILEFFKTTDGEEYFRVQWFYRAEDTVMKE------AADFHDR 108 (521)
Q Consensus 36 ~~~~r~~Y~~~~vdG~~Y~vGD~VyV~~-~~~p~~IarI~~i~~~~~g~~~v~v~WFyRpedt~~~~------~~~~~~~ 108 (521)
++++||||+++.++|+.|++||+|||+. ++.|+|||||.+||++.+|..+|+|+|||||+||+... ..+.+|+
T Consensus 41 ~~~~~~~~~~~~~~~~~~~~~d~~~v~~~~~~~~~i~~i~~~~~~~~~~~~~~~~~~~r~~d~~~~~~~~~~~~~~~~d~ 120 (784)
T 4ft4_B 41 ELKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQCHYFTCRWFFRAEDTVINSLVSISVDGHKHDP 120 (784)
T ss_dssp CCCEEEECSEEEETTEEEETTCEEEECCSTTSCCEEEEEEEEEEETTSCEEEEEEEEEEGGGSTTGGGGGCCBTTBCCCT
T ss_pred ccccceeeeeeeECCEEEeCCCeEEEeCCCCCCCEEEEEEEEEEcCCCCEEEEEEEeeChhhhccccccccccccccccc
Confidence 3789999999999999999999999998 77899999999999999999999999999999997653 2466899
Q ss_pred ceeEEeCCccccccceeeeeeEEEecCCCCCC--CCCCCCCCcEEEeeeeecCCcEEEcCCCCCcccCCCCCCCCCCCCC
Q 046469 109 KRLFYSTVMNDNPVDCIISKVIVAQIPPKIGL--KSNSIPSSDFYFDMEYCVEYSTFRTLLTGKIHDLSLPSCTETVPTT 186 (521)
Q Consensus 109 rELF~S~~~d~~pv~~I~GKC~V~~~~~~~~~--~~~~~~~~dFyc~~~Yd~~~~~f~~lp~~~~~~~S~~~~~~~~~~~ 186 (521)
||||+|++++++|+++|.|||+|++.++..+. .......++|||++.|...+.+|.+++.......+... ++..
T Consensus 121 ~~~~~s~~~~~~~~~~i~~k~~v~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~--~~~~-- 196 (784)
T 4ft4_B 121 RRVFLSEEKNDNVLDCIISKVKIVHVDPNMDPKAKAQLIESCDLYYDMSYSVAYSTFANISSENGQSGSDTA--SGIS-- 196 (784)
T ss_dssp TBEEEEEEEEEEEGGGEEEECCEEECCTTSCHHHHHHHHHHCSEEESEEEETGGGEEEEC--------------------
T ss_pred ceEEEeCcEEEechHHeeeeEEEEeeCccccchhhhhccCCcceEeccccCccccCccCCCccccccccccc--cccc--
Confidence 99999999999999999999999999876554 22334578999999999999999999987543222111 1110
Q ss_pred CCCccccCCCCCCCCCCcccEEeeeccCChhhHHHHHhhhhcCCcceEEEEEcCCHHHHHHHHHcCCCCceeecchHHHH
Q 046469 187 ATSTFFENMPNHGPHKAELALLDLYSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAAEDFL 266 (521)
Q Consensus 187 k~k~~~~~~~~~~~~~~~l~vldLFsG~GG~s~Gl~~g~~~aG~~~~~~~avd~d~~a~~t~~~N~~~~~~~~~~~~~~~ 266 (521)
.+ ..+.......++++|++|||||||||+|+||+++...+|.+++++||+|+|+.|++||++|||++.++++|+.+++
T Consensus 197 -~~-~~~~~~~~~~~~k~ltvIDLFAG~GGls~Gfe~AG~~~~~~f~vv~AvE~d~~A~~Ty~~Nhp~~~~~~~di~~i~ 274 (784)
T 4ft4_B 197 -SD-DVDLETSSSMPTRTATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDFNSFACQSLKYNHPQTEVRNEKADEFL 274 (784)
T ss_dssp ---------------CEEEEEEEETCTTSHHHHHHHHHHHHHTEEEEEEEEEESCHHHHHHHHHHCTTSEEEESCHHHHH
T ss_pred -cc-ccccccccccCCCCCeEEEeCcCccHHHHHHHHhCcccCCceeEEEEEeCCHHHHHHHHHHCCCCceecCcHHHhh
Confidence 00 1111223455678999999999999999999955445555677999999999999999999999999999999999
Q ss_pred HHHHHHHHHhhhhhhhhhhhhhhhhcccccccccCCCCCCccccCCCCCCccCCCCCCCcccccccCCCccccCCCCCCC
Q 046469 267 ELVKEWQKLCKRFAVNIVERENKQRSMSQRVTRNSVNSPSITRNSVDSPKVTGNSVDSPRVTRSSVNSPRVTRNSVNSPR 346 (521)
Q Consensus 267 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 346 (521)
...++|..+|+.+......... ..+.+...
T Consensus 275 ~~~~~~~~~~~~~~~~~~~~~~--------------------------------------------------~~~~~~~~ 304 (784)
T 4ft4_B 275 ALLKEWAVLCKKYVQDVDSNLA--------------------------------------------------SSEDQADE 304 (784)
T ss_dssp HHHHHHHHHHHHTC------------------------------------------------------------------
T ss_pred hhhhhccccccccccccccccc--------------------------------------------------cccccccc
Confidence 9999999999887633221100 01111122
Q ss_pred CCCCCCCcceeeeEeeeecCCCCcccCCcceeEEEEccCCCCCCCcccccccCCChhhHHHHHhcccccccCCCCCCcce
Q 046469 347 DVDIPPGEYEVARIVDICYGDPNESGKRGLNFKVHWKGYSTSEDSWEPIEGLRNCPERIKEFVRNGFKSKILPLPGDVDV 426 (521)
Q Consensus 347 ~~~~~~~~~~v~~l~~~~~g~~~~~~~~~l~~~v~w~gy~~~~d~~ep~e~~~~~~~~I~~~v~~~~~~~~~~~~~~vDl 426 (521)
......+++..+++.+.|.+... ...++.+.+.|.++....+.|++...+.++...|..++........++.+++|||
T Consensus 305 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~i~~~~~~~~~~~~~~~~G~VDv 382 (784)
T 4ft4_B 305 DSPLDKDEFVVEKLVGICYGGSD--RENGIYFKVQWEGYGPEEDTWEPIDNLSDCPQKIREFVQEGHKRKILPLPGDVDV 382 (784)
T ss_dssp -------CCCEEEEEEEEESCSS--SCSSEEEEEEETTCCTTSCEEEESGGGTTCHHHHHHHHHHHHHHTSSCCTTSCSE
T ss_pred ccccccccchhhhhccccccccc--ccccccchhhhcccccccccccccccccccchhccccccccchhhccCCCCCeEE
Confidence 33345678889999999999865 4677889999999999999999999999999999999888888888999999999
Q ss_pred eecCCCCcCccccCCcCCCCCCCcccchhhHHHHHHHHhhcCCcEEEEecccchhccCcchHHHHHHHHHhcCCCeEEEE
Q 046469 427 ICGGPPCQGISGYNRFRNVDSPLDDERNRQIVIFMDIVEFLKPKYVLMENVVDILKFDKASLGRYALSRLVHMKYQARFG 506 (521)
Q Consensus 427 L~ggpPCQ~fS~an~~~~~~~~~~d~r~~L~~~~lrii~~~rP~~~l~ENV~gl~~~~~~~~~~~il~~l~~lGY~v~~~ 506 (521)
|+||||||+||.||++++...+.+|+|+.|+++++++|+.+||++||||||+||++..++.+++.++..|.++||++.+.
T Consensus 383 l~GGpPCQ~FS~aG~~kg~~~~~~D~R~~L~~~~~riv~~~rPk~fvlENV~glls~~~g~~~~~il~~l~~lGY~v~~~ 462 (784)
T 4ft4_B 383 ICGGPPCQGISGFNRYRNRDEPLKDEKNKQMVTFMDIVAYLKPKYVLMENVVDILKFADGYLGKYALSCLVAMKYQARLG 462 (784)
T ss_dssp EEECCCCCSSSGGGGGSCTTSTTTSTTCHHHHHHHHHHHHHCCSEEEEEEEGGGGTGGGGHHHHHHHHHHHHTTCEEEEE
T ss_pred EEecCCCcchhhhhcccCcCccccCchhHHHHHHHHHHHHHCCCEEEEEecCCccccccchHHHHHHHHHHhCCCeeeee
Confidence 99999999999999987666678899999999999999999999999999999999999999999999999999999999
Q ss_pred EEecCCCCCCCCCCC
Q 046469 507 IIAAGCYGLPQFRLR 521 (521)
Q Consensus 507 vlna~~yGvPQ~R~R 521 (521)
+|||++||+||+|+|
T Consensus 463 vLnA~dyGVPQ~R~R 477 (784)
T 4ft4_B 463 MMVAGCYGLPQFRMR 477 (784)
T ss_dssp EEEGGGGTCSSCCEE
T ss_pred ecCHHHcCCCccccc
Confidence 999999999999998
|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* | Back alignment and structure |
|---|
| >2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* | Back alignment and structure |
|---|
| >1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A | Back alignment and structure |
|---|
| >2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* | Back alignment and structure |
|---|
| >2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* | Back alignment and structure |
|---|
| >1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* | Back alignment and structure |
|---|
| >1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* | Back alignment and structure |
|---|
| >2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* | Back alignment and structure |
|---|
| >3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* | Back alignment and structure |
|---|
| >3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A | Back alignment and structure |
|---|
| >1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 521 | ||||
| d1g6za_ | 70 | b.34.13.2 (A:) Histone methyltransferase clr4, chr | 4e-14 | |
| d2dnta1 | 66 | b.34.13.2 (A:8-73) Chromodomain protein, Y-like is | 1e-12 | |
| d1guwa_ | 73 | b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mou | 9e-12 | |
| d1q3la_ | 52 | b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fru | 1e-11 | |
| d2dy8a1 | 69 | b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 | 3e-11 | |
| d2dnva1 | 52 | b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mo | 1e-09 | |
| d2b2ya1 | 80 | b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 | 6e-09 | |
| d1pfba_ | 55 | b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Dr | 7e-09 | |
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 3e-07 | |
| d2dy7a1 | 81 | b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 | 6e-07 | |
| d1m4za_ | 217 | b.34.12.1 (A:) Origin-recognition complex protein | 7e-07 | |
| d1dcta_ | 324 | c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a | 3e-05 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 3e-05 | |
| d1x3pa1 | 54 | b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidops | 3e-04 | |
| d2b2ya2 | 95 | b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 ( | 0.001 |
| >d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 70 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Chromo domain-like family: Chromo domain domain: Histone methyltransferase clr4, chromo domain species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
Score = 65.2 bits (159), Expect = 4e-14
Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 4/63 (6%)
Query: 354 EYEVARIVDICYGDPNESGKRGLNFKVHWKGYSTSEDSWEPIEGLRNCPERIKEFVRNGF 413
EYEV RIVD +++ W YS+ D+WEP E L C + E+ R
Sbjct: 8 EYEVERIVDEKLDR----NGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKR 63
Query: 414 KSK 416
+ K
Sbjct: 64 RLK 66
|
| >d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 73 | Back information, alignment and structure |
|---|
| >d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 | Back information, alignment and structure |
|---|
| >d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 69 | Back information, alignment and structure |
|---|
| >d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 55 | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
| >d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 54 | Back information, alignment and structure |
|---|
| >d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 521 | |||
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 100.0 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 100.0 | |
| d1m4za_ | 217 | Origin-recognition complex protein 120kDa subunit, | 99.59 | |
| d1q3la_ | 52 | Heterochromatin protein 1, HP1 {Fruit fly (Drosoph | 98.14 | |
| d1guwa_ | 73 | Heterochromatin protein 1, HP1 {Mouse (Mus musculu | 98.1 | |
| d2dnva1 | 52 | Chromobox protein homolog 8 {Mouse (Mus musculus) | 98.07 | |
| d1pfba_ | 55 | Polycomb protein, Pc {Fruit fly (Drosophila melano | 97.99 | |
| d2dnta1 | 66 | Chromodomain protein, Y-like isoform {Human (Homo | 97.96 | |
| d1g6za_ | 70 | Histone methyltransferase clr4, chromo domain {Fis | 97.87 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 97.36 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 97.33 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 97.21 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 97.09 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 97.08 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 96.82 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 96.82 | |
| d2dy8a1 | 69 | ATP-dependent helicase CHD1 (Chromo domain protein | 96.75 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 96.7 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 96.69 | |
| d1x3pa1 | 54 | CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId | 96.63 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 96.5 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 96.37 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 96.28 | |
| d2b2ya1 | 80 | ATP-dependent helicase CHD1 (Chromo domain protein | 96.01 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 95.52 | |
| d2dy7a1 | 81 | ATP-dependent helicase CHD1 (Chromo domain protein | 95.24 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 95.18 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 92.03 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 91.99 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 91.7 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 90.99 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 90.58 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 90.23 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 89.69 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 89.47 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 88.57 | |
| d2b2ya2 | 95 | ATP-dependent helicase CHD1 (Chromo domain protein | 87.38 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 87.29 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 86.95 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 86.52 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 86.4 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 85.02 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 84.01 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 83.61 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 83.42 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 83.28 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 83.23 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 82.21 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 81.84 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 81.66 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 81.62 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 81.39 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 80.28 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 80.24 |
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNMT2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.3e-39 Score=325.35 Aligned_cols=159 Identities=29% Similarity=0.430 Sum_probs=125.4
Q ss_pred CcccEEeeeccCChhhHHHHHhhhhcCCcceEEEEEcCCHHHHHHHHHcCCCCceeecchHHHHHHHHHHHHHhhhhhhh
Q 046469 203 AELALLDLYSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAAEDFLELVKEWQKLCKRFAVN 282 (521)
Q Consensus 203 ~~l~vldLFsG~GG~s~Gl~~g~~~aG~~~~~~~avd~d~~a~~t~~~N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 282 (521)
++|+++|||||+||+++||+ .||++.+++||+|+|+.|++||++|||++.++++|++++..-
T Consensus 1 ~p~kv~~lF~G~Gg~~~gl~----~aG~~~~~~~a~E~~~~a~~~~~~n~~~~~~~~~di~~~~~~-------------- 62 (343)
T d1g55a_ 1 EPLRVLELYSGVGGMHHALR----ESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLE-------------- 62 (343)
T ss_dssp CCEEEEEETCTTCHHHHHHH----HHTCSEEEEEEECCCHHHHHHHHHHCTTSCEECSCGGGCCHH--------------
T ss_pred CCCEEEEcCcCccHHHHHHH----HcCCCCeEEEEEECCHHHHHHHHHHCCCCCcccCchhhCCHh--------------
Confidence 47999999999999999998 899988899999999999999999999999999888755310
Q ss_pred hhhhhhhhhcccccccccCCCCCCccccCCCCCCccCCCCCCCcccccccCCCccccCCCCCCCCCCCCCCcceeeeEee
Q 046469 283 IVERENKQRSMSQRVTRNSVNSPSITRNSVDSPKVTGNSVDSPRVTRSSVNSPRVTRNSVNSPRDVDIPPGEYEVARIVD 362 (521)
Q Consensus 283 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~ 362 (521)
T Consensus 63 -------------------------------------------------------------------------------- 62 (343)
T d1g55a_ 63 -------------------------------------------------------------------------------- 62 (343)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred eecCCCCcccCCcceeEEEEccCCCCCCCcccccccCCChhhHHHHHhcccccccCCCCCCcceeecCCCCcCccccCCc
Q 046469 363 ICYGDPNESGKRGLNFKVHWKGYSTSEDSWEPIEGLRNCPERIKEFVRNGFKSKILPLPGDVDVICGGPPCQGISGYNRF 442 (521)
Q Consensus 363 ~~~g~~~~~~~~~l~~~v~w~gy~~~~d~~ep~e~~~~~~~~I~~~v~~~~~~~~~~~~~~vDlL~ggpPCQ~fS~an~~ 442 (521)
++ + .+++|||+||||||+||.||++
T Consensus 63 -----------------------------------------~~-------------~-~~~~Dll~ggpPCq~fS~ag~~ 87 (343)
T d1g55a_ 63 -----------------------------------------EF-------------D-RLSFDMILMSPPCQPFTRIGRQ 87 (343)
T ss_dssp -----------------------------------------HH-------------H-HHCCSEEEECCC----------
T ss_pred -----------------------------------------Hc-------------C-CCCccEEEeecccccccccccc
Confidence 00 0 0156999999999999999973
Q ss_pred CCCCCCCcccchhhHHHHHHHHhhc--CCcEEEEecccchhccCcchHHHHHHHHHhcCCCeEEEEEEecCCCCCCCCCC
Q 046469 443 RNVDSPLDDERNRQIVIFMDIVEFL--KPKYVLMENVVDILKFDKASLGRYALSRLVHMKYQARFGIIAAGCYGLPQFRL 520 (521)
Q Consensus 443 ~~~~~~~~d~r~~L~~~~lrii~~~--rP~~~l~ENV~gl~~~~~~~~~~~il~~l~~lGY~v~~~vlna~~yGvPQ~R~ 520 (521)
++.+|+|+.|+++++++|+.+ +|++|+||||+||++.. .++.+++.|+++||++.+.+|||++||+||+|+
T Consensus 88 ----~~~~d~r~~l~~~~~~~i~~~~~kPk~~i~ENV~~l~~~~---~~~~i~~~l~~~GY~v~~~vlna~dyGvPQ~R~ 160 (343)
T d1g55a_ 88 ----GDMTDSRTNSFLHILDILPRLQKLPKYILLENVKGFEVSS---TRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRL 160 (343)
T ss_dssp ------------CHHHHHHHHGGGCSSCCSEEEEEEETTGGGSH---HHHHHHHHHHHTTEEEEEEEECGGGGTCSCCCC
T ss_pred ----cccccccccccchhhhhHhhhcCCCceeeeeccCCcccch---hhHHHHhhhhccccccceeeeeccccCCcccce
Confidence 457899999999999999987 79999999999998854 578899999999999999999999999999999
Q ss_pred C
Q 046469 521 R 521 (521)
Q Consensus 521 R 521 (521)
|
T Consensus 161 R 161 (343)
T d1g55a_ 161 R 161 (343)
T ss_dssp E
T ss_pred e
Confidence 8
|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|